data_5H5C # _entry.id 5H5C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5H5C pdb_00005h5c 10.2210/pdb5h5c/pdb WWPDB D_1300002053 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-08 2 'Structure model' 1 1 2018-02-28 3 'Structure model' 1 2 2018-03-21 4 'Structure model' 1 3 2024-03-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation.year' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H5C _pdbx_database_status.recvd_initial_deposition_date 2016-11-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5H55 PDB . unspecified 5H54 PDB . unspecified 5H5A PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kawano, S.' 1 'Quinbara, S.' 2 'Endo, T.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Cell Biol.' _citation.journal_id_ASTM JCLBA3 _citation.journal_id_CSD 2019 _citation.journal_id_ISSN 1540-8140 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 217 _citation.language ? _citation.page_first 959 _citation.page_last 974 _citation.title 'Structure-function insights into direct lipid transfer between membranes by Mmm1-Mdm12 of ERMES' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1083/jcb.201704119 _citation.pdbx_database_id_PubMed 29279306 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kawano, S.' 1 ? primary 'Tamura, Y.' 2 ? primary 'Kojima, R.' 3 ? primary 'Bala, S.' 4 ? primary 'Asai, E.' 5 ? primary 'Michel, A.H.' 6 ? primary 'Kornmann, B.' 7 ? primary 'Riezman, I.' 8 ? primary 'Riezman, H.' 9 ? primary 'Sakae, Y.' 10 ? primary 'Okamoto, Y.' 11 ? primary 'Endo, T.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Mitochondrial distribution and morphology protein 12' _entity.formula_weight 27466.426 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Mitochondrial inheritance component MDM12' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDISKE AAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLEN DKLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDFTPED ; _entity_poly.pdbx_seq_one_letter_code_can ;HMSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDISKE AAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLEN DKLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDFTPED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 SER n 1 4 VAL n 1 5 GLU n 1 6 ILE n 1 7 ASP n 1 8 TRP n 1 9 ASP n 1 10 ASN n 1 11 ILE n 1 12 ARG n 1 13 GLY n 1 14 ASP n 1 15 LEU n 1 16 SER n 1 17 VAL n 1 18 ASN n 1 19 GLN n 1 20 GLY n 1 21 VAL n 1 22 LYS n 1 23 ASP n 1 24 PHE n 1 25 LEU n 1 26 ASN n 1 27 SER n 1 28 ARG n 1 29 LEU n 1 30 GLN n 1 31 GLU n 1 32 PHE n 1 33 GLU n 1 34 LEU n 1 35 PRO n 1 36 SER n 1 37 TYR n 1 38 VAL n 1 39 ASN n 1 40 ASN n 1 41 LEU n 1 42 LYS n 1 43 VAL n 1 44 THR n 1 45 ASN n 1 46 PHE n 1 47 ASP n 1 48 LEU n 1 49 GLY n 1 50 THR n 1 51 MET n 1 52 PRO n 1 53 PRO n 1 54 ASN n 1 55 VAL n 1 56 ILE n 1 57 LEU n 1 58 LYS n 1 59 GLN n 1 60 MET n 1 61 ASP n 1 62 ASP n 1 63 PRO n 1 64 LEU n 1 65 ASP n 1 66 GLU n 1 67 PHE n 1 68 TYR n 1 69 SER n 1 70 TYR n 1 71 LEU n 1 72 LEU n 1 73 GLN n 1 74 GLU n 1 75 GLY n 1 76 ASP n 1 77 ILE n 1 78 SER n 1 79 LYS n 1 80 GLU n 1 81 ALA n 1 82 ALA n 1 83 LYS n 1 84 ASP n 1 85 LYS n 1 86 ASN n 1 87 THR n 1 88 ASP n 1 89 VAL n 1 90 GLN n 1 91 LEU n 1 92 LEU n 1 93 VAL n 1 94 GLU n 1 95 LEU n 1 96 ASP n 1 97 TYR n 1 98 LYS n 1 99 GLY n 1 100 ASP n 1 101 MET n 1 102 SER n 1 103 ILE n 1 104 GLU n 1 105 LEU n 1 106 SER n 1 107 ALA n 1 108 ASP n 1 109 LEU n 1 110 VAL n 1 111 LEU n 1 112 ASN n 1 113 TYR n 1 114 PRO n 1 115 SER n 1 116 PRO n 1 117 GLN n 1 118 PHE n 1 119 MET n 1 120 ILE n 1 121 LEU n 1 122 PRO n 1 123 VAL n 1 124 LYS n 1 125 LEU n 1 126 ARG n 1 127 ILE n 1 128 SER n 1 129 ASP n 1 130 ILE n 1 131 GLY n 1 132 MET n 1 133 HIS n 1 134 CYS n 1 135 LEU n 1 136 CYS n 1 137 LEU n 1 138 LEU n 1 139 ALA n 1 140 TYR n 1 141 LEU n 1 142 LYS n 1 143 LYS n 1 144 GLN n 1 145 LEU n 1 146 PHE n 1 147 ILE n 1 148 SER n 1 149 PHE n 1 150 LEU n 1 151 CYS n 1 152 ASP n 1 153 VAL n 1 154 SER n 1 155 ASP n 1 156 PRO n 1 157 LEU n 1 158 LEU n 1 159 GLU n 1 160 ASN n 1 161 ASP n 1 162 LYS n 1 163 LEU n 1 164 GLN n 1 165 VAL n 1 166 ASP n 1 167 PRO n 1 168 SER n 1 169 GLY n 1 170 PRO n 1 171 ASN n 1 172 PHE n 1 173 MET n 1 174 GLY n 1 175 LYS n 1 176 ARG n 1 177 ALA n 1 178 LEU n 1 179 GLU n 1 180 ARG n 1 181 ILE n 1 182 SER n 1 183 LEU n 1 184 ILE n 1 185 ARG n 1 186 ASN n 1 187 ILE n 1 188 LYS n 1 189 ILE n 1 190 HIS n 1 191 THR n 1 192 GLU n 1 193 LEU n 1 194 GLY n 1 195 GLN n 1 196 LEU n 1 197 ASP n 1 198 GLN n 1 199 GLY n 1 200 GLU n 1 201 GLY n 1 202 SER n 1 203 VAL n 1 204 LEU n 1 205 ARG n 1 206 SER n 1 207 VAL n 1 208 GLY n 1 209 LYS n 1 210 LEU n 1 211 GLU n 1 212 GLU n 1 213 PHE n 1 214 LEU n 1 215 VAL n 1 216 ASP n 1 217 LEU n 1 218 PHE n 1 219 ARG n 1 220 ASN n 1 221 LEU n 1 222 ILE n 1 223 ARG n 1 224 LYS n 1 225 GLU n 1 226 ALA n 1 227 ALA n 1 228 TRP n 1 229 PRO n 1 230 SER n 1 231 TRP n 1 232 ILE n 1 233 ASP n 1 234 LEU n 1 235 ASP n 1 236 PHE n 1 237 THR n 1 238 PRO n 1 239 GLU n 1 240 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 240 _entity_src_gen.gene_src_common_name Yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MDM12, KLLA0C06028g' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 284590 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 0 0 HIS HIS A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 ILE 6 5 5 ILE ILE A . n A 1 7 ASP 7 6 6 ASP ASP A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 ASN 10 9 9 ASN ASN A . n A 1 11 ILE 11 10 10 ILE ILE A . n A 1 12 ARG 12 11 11 ARG ARG A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 ASP 14 13 13 ASP ASP A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 SER 16 15 15 SER SER A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 ASN 18 17 17 ASN ASN A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 ASP 23 22 22 ASP ASP A . n A 1 24 PHE 24 23 23 PHE PHE A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 SER 27 26 26 SER SER A . n A 1 28 ARG 28 27 27 ARG ARG A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 GLN 30 29 29 GLN GLN A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 PHE 32 31 31 PHE PHE A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 LEU 34 33 33 LEU LEU A . n A 1 35 PRO 35 34 34 PRO PRO A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 TYR 37 36 36 TYR TYR A . n A 1 38 VAL 38 37 37 VAL VAL A . n A 1 39 ASN 39 38 38 ASN ASN A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 VAL 43 42 42 VAL VAL A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 ASN 45 44 44 ASN ASN A . n A 1 46 PHE 46 45 45 PHE PHE A . n A 1 47 ASP 47 46 46 ASP ASP A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 THR 50 49 49 THR THR A . n A 1 51 MET 51 50 50 MET MET A . n A 1 52 PRO 52 51 51 PRO PRO A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 ASN 54 53 53 ASN ASN A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 LYS 58 57 57 LYS LYS A . n A 1 59 GLN 59 58 58 GLN GLN A . n A 1 60 MET 60 59 59 MET MET A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 PRO 63 62 62 PRO PRO A . n A 1 64 LEU 64 63 63 LEU LEU A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 PHE 67 66 66 PHE PHE A . n A 1 68 TYR 68 67 67 TYR TYR A . n A 1 69 SER 69 68 68 SER SER A . n A 1 70 TYR 70 69 ? ? ? A . n A 1 71 LEU 71 70 ? ? ? A . n A 1 72 LEU 72 71 ? ? ? A . n A 1 73 GLN 73 72 ? ? ? A . n A 1 74 GLU 74 73 ? ? ? A . n A 1 75 GLY 75 74 ? ? ? A . n A 1 76 ASP 76 75 ? ? ? A . n A 1 77 ILE 77 76 ? ? ? A . n A 1 78 SER 78 77 ? ? ? A . n A 1 79 LYS 79 78 ? ? ? A . n A 1 80 GLU 80 79 ? ? ? A . n A 1 81 ALA 81 80 ? ? ? A . n A 1 82 ALA 82 81 ? ? ? A . n A 1 83 LYS 83 82 ? ? ? A . n A 1 84 ASP 84 83 ? ? ? A . n A 1 85 LYS 85 84 ? ? ? A . n A 1 86 ASN 86 85 ? ? ? A . n A 1 87 THR 87 86 ? ? ? A . n A 1 88 ASP 88 87 87 ASP ASP A . n A 1 89 VAL 89 88 88 VAL VAL A . n A 1 90 GLN 90 89 89 GLN GLN A . n A 1 91 LEU 91 90 90 LEU LEU A . n A 1 92 LEU 92 91 91 LEU LEU A . n A 1 93 VAL 93 92 92 VAL VAL A . n A 1 94 GLU 94 93 93 GLU GLU A . n A 1 95 LEU 95 94 94 LEU LEU A . n A 1 96 ASP 96 95 95 ASP ASP A . n A 1 97 TYR 97 96 96 TYR TYR A . n A 1 98 LYS 98 97 97 LYS LYS A . n A 1 99 GLY 99 98 98 GLY GLY A . n A 1 100 ASP 100 99 99 ASP ASP A . n A 1 101 MET 101 100 100 MET MET A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 ILE 103 102 102 ILE ILE A . n A 1 104 GLU 104 103 103 GLU GLU A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 ALA 107 106 106 ALA ALA A . n A 1 108 ASP 108 107 107 ASP ASP A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 VAL 110 109 ? ? ? A . n A 1 111 LEU 111 110 ? ? ? A . n A 1 112 ASN 112 111 ? ? ? A . n A 1 113 TYR 113 112 ? ? ? A . n A 1 114 PRO 114 113 ? ? ? A . n A 1 115 SER 115 114 ? ? ? A . n A 1 116 PRO 116 115 ? ? ? A . n A 1 117 GLN 117 116 ? ? ? A . n A 1 118 PHE 118 117 ? ? ? A . n A 1 119 MET 119 118 ? ? ? A . n A 1 120 ILE 120 119 ? ? ? A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 PRO 122 121 121 PRO PRO A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 LYS 124 123 123 LYS LYS A . n A 1 125 LEU 125 124 124 LEU LEU A . n A 1 126 ARG 126 125 125 ARG ARG A . n A 1 127 ILE 127 126 126 ILE ILE A . n A 1 128 SER 128 127 127 SER SER A . n A 1 129 ASP 129 128 128 ASP ASP A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 GLY 131 130 130 GLY GLY A . n A 1 132 MET 132 131 131 MET MET A . n A 1 133 HIS 133 132 132 HIS HIS A . n A 1 134 CYS 134 133 133 CYS CYS A . n A 1 135 LEU 135 134 134 LEU LEU A . n A 1 136 CYS 136 135 135 CYS CYS A . n A 1 137 LEU 137 136 136 LEU LEU A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 ALA 139 138 138 ALA ALA A . n A 1 140 TYR 140 139 139 TYR TYR A . n A 1 141 LEU 141 140 140 LEU LEU A . n A 1 142 LYS 142 141 141 LYS LYS A . n A 1 143 LYS 143 142 142 LYS LYS A . n A 1 144 GLN 144 143 143 GLN GLN A . n A 1 145 LEU 145 144 144 LEU LEU A . n A 1 146 PHE 146 145 145 PHE PHE A . n A 1 147 ILE 147 146 146 ILE ILE A . n A 1 148 SER 148 147 147 SER SER A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 CYS 151 150 150 CYS CYS A . n A 1 152 ASP 152 151 151 ASP ASP A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 SER 154 153 153 SER SER A . n A 1 155 ASP 155 154 154 ASP ASP A . n A 1 156 PRO 156 155 155 PRO PRO A . n A 1 157 LEU 157 156 156 LEU LEU A . n A 1 158 LEU 158 157 157 LEU LEU A . n A 1 159 GLU 159 158 158 GLU GLU A . n A 1 160 ASN 160 159 159 ASN ASN A . n A 1 161 ASP 161 160 160 ASP ASP A . n A 1 162 LYS 162 161 161 LYS LYS A . n A 1 163 LEU 163 162 162 LEU LEU A . n A 1 164 GLN 164 163 163 GLN GLN A . n A 1 165 VAL 165 164 164 VAL VAL A . n A 1 166 ASP 166 165 165 ASP ASP A . n A 1 167 PRO 167 166 166 PRO PRO A . n A 1 168 SER 168 167 167 SER SER A . n A 1 169 GLY 169 168 ? ? ? A . n A 1 170 PRO 170 169 ? ? ? A . n A 1 171 ASN 171 170 170 ASN ASN A . n A 1 172 PHE 172 171 171 PHE PHE A . n A 1 173 MET 173 172 172 MET MET A . n A 1 174 GLY 174 173 173 GLY GLY A . n A 1 175 LYS 175 174 174 LYS LYS A . n A 1 176 ARG 176 175 175 ARG ARG A . n A 1 177 ALA 177 176 176 ALA ALA A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 GLU 179 178 178 GLU GLU A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 SER 182 181 181 SER SER A . n A 1 183 LEU 183 182 182 LEU LEU A . n A 1 184 ILE 184 183 183 ILE ILE A . n A 1 185 ARG 185 184 184 ARG ARG A . n A 1 186 ASN 186 185 185 ASN ASN A . n A 1 187 ILE 187 186 186 ILE ILE A . n A 1 188 LYS 188 187 187 LYS LYS A . n A 1 189 ILE 189 188 188 ILE ILE A . n A 1 190 HIS 190 189 189 HIS HIS A . n A 1 191 THR 191 190 190 THR THR A . n A 1 192 GLU 192 191 191 GLU GLU A . n A 1 193 LEU 193 192 192 LEU LEU A . n A 1 194 GLY 194 193 ? ? ? A . n A 1 195 GLN 195 194 ? ? ? A . n A 1 196 LEU 196 195 ? ? ? A . n A 1 197 ASP 197 196 ? ? ? A . n A 1 198 GLN 198 197 ? ? ? A . n A 1 199 GLY 199 198 ? ? ? A . n A 1 200 GLU 200 199 ? ? ? A . n A 1 201 GLY 201 200 ? ? ? A . n A 1 202 SER 202 201 ? ? ? A . n A 1 203 VAL 203 202 ? ? ? A . n A 1 204 LEU 204 203 203 LEU LEU A . n A 1 205 ARG 205 204 204 ARG ARG A . n A 1 206 SER 206 205 205 SER SER A . n A 1 207 VAL 207 206 206 VAL VAL A . n A 1 208 GLY 208 207 207 GLY GLY A . n A 1 209 LYS 209 208 208 LYS LYS A . n A 1 210 LEU 210 209 209 LEU LEU A . n A 1 211 GLU 211 210 210 GLU GLU A . n A 1 212 GLU 212 211 211 GLU GLU A . n A 1 213 PHE 213 212 212 PHE PHE A . n A 1 214 LEU 214 213 213 LEU LEU A . n A 1 215 VAL 215 214 214 VAL VAL A . n A 1 216 ASP 216 215 215 ASP ASP A . n A 1 217 LEU 217 216 216 LEU LEU A . n A 1 218 PHE 218 217 217 PHE PHE A . n A 1 219 ARG 219 218 218 ARG ARG A . n A 1 220 ASN 220 219 219 ASN ASN A . n A 1 221 LEU 221 220 220 LEU LEU A . n A 1 222 ILE 222 221 221 ILE ILE A . n A 1 223 ARG 223 222 222 ARG ARG A . n A 1 224 LYS 224 223 223 LYS LYS A . n A 1 225 GLU 225 224 224 GLU GLU A . n A 1 226 ALA 226 225 225 ALA ALA A . n A 1 227 ALA 227 226 226 ALA ALA A . n A 1 228 TRP 228 227 227 TRP TRP A . n A 1 229 PRO 229 228 228 PRO PRO A . n A 1 230 SER 230 229 229 SER SER A . n A 1 231 TRP 231 230 230 TRP TRP A . n A 1 232 ILE 232 231 231 ILE ILE A . n A 1 233 ASP 233 232 232 ASP ASP A . n A 1 234 LEU 234 233 233 LEU LEU A . n A 1 235 ASP 235 234 234 ASP ASP A . n A 1 236 PHE 236 235 ? ? ? A . n A 1 237 THR 237 236 ? ? ? A . n A 1 238 PRO 238 237 ? ? ? A . n A 1 239 GLU 239 238 ? ? ? A . n A 1 240 ASP 240 239 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 0 ? CG ? A HIS 1 CG 2 1 Y 1 A HIS 0 ? ND1 ? A HIS 1 ND1 3 1 Y 1 A HIS 0 ? CD2 ? A HIS 1 CD2 4 1 Y 1 A HIS 0 ? CE1 ? A HIS 1 CE1 5 1 Y 1 A HIS 0 ? NE2 ? A HIS 1 NE2 6 1 Y 1 A GLU 4 ? CG ? A GLU 5 CG 7 1 Y 1 A GLU 4 ? CD ? A GLU 5 CD 8 1 Y 1 A GLU 4 ? OE1 ? A GLU 5 OE1 9 1 Y 1 A GLU 4 ? OE2 ? A GLU 5 OE2 10 1 Y 1 A LYS 21 ? CG ? A LYS 22 CG 11 1 Y 1 A LYS 21 ? CD ? A LYS 22 CD 12 1 Y 1 A LYS 21 ? CE ? A LYS 22 CE 13 1 Y 1 A LYS 21 ? NZ ? A LYS 22 NZ 14 1 Y 1 A GLN 29 ? CG ? A GLN 30 CG 15 1 Y 1 A GLN 29 ? CD ? A GLN 30 CD 16 1 Y 1 A GLN 29 ? OE1 ? A GLN 30 OE1 17 1 Y 1 A GLN 29 ? NE2 ? A GLN 30 NE2 18 1 Y 1 A GLU 32 ? CG ? A GLU 33 CG 19 1 Y 1 A GLU 32 ? CD ? A GLU 33 CD 20 1 Y 1 A GLU 32 ? OE1 ? A GLU 33 OE1 21 1 Y 1 A GLU 32 ? OE2 ? A GLU 33 OE2 22 1 Y 1 A LYS 41 ? CG ? A LYS 42 CG 23 1 Y 1 A LYS 41 ? CD ? A LYS 42 CD 24 1 Y 1 A LYS 41 ? CE ? A LYS 42 CE 25 1 Y 1 A LYS 41 ? NZ ? A LYS 42 NZ 26 1 Y 1 A LEU 47 ? CG ? A LEU 48 CG 27 1 Y 1 A LEU 47 ? CD1 ? A LEU 48 CD1 28 1 Y 1 A LEU 47 ? CD2 ? A LEU 48 CD2 29 1 Y 1 A TYR 67 ? CG ? A TYR 68 CG 30 1 Y 1 A TYR 67 ? CD1 ? A TYR 68 CD1 31 1 Y 1 A TYR 67 ? CD2 ? A TYR 68 CD2 32 1 Y 1 A TYR 67 ? CE1 ? A TYR 68 CE1 33 1 Y 1 A TYR 67 ? CE2 ? A TYR 68 CE2 34 1 Y 1 A TYR 67 ? CZ ? A TYR 68 CZ 35 1 Y 1 A TYR 67 ? OH ? A TYR 68 OH 36 1 Y 1 A LYS 123 ? CG ? A LYS 124 CG 37 1 Y 1 A LYS 123 ? CD ? A LYS 124 CD 38 1 Y 1 A LYS 123 ? CE ? A LYS 124 CE 39 1 Y 1 A LYS 123 ? NZ ? A LYS 124 NZ 40 1 Y 1 A LEU 136 ? CG ? A LEU 137 CG 41 1 Y 1 A LEU 136 ? CD1 ? A LEU 137 CD1 42 1 Y 1 A LEU 136 ? CD2 ? A LEU 137 CD2 43 1 Y 1 A LYS 141 ? CG ? A LYS 142 CG 44 1 Y 1 A LYS 141 ? CD ? A LYS 142 CD 45 1 Y 1 A LYS 141 ? CE ? A LYS 142 CE 46 1 Y 1 A LYS 141 ? NZ ? A LYS 142 NZ 47 1 Y 1 A LYS 142 ? CG ? A LYS 143 CG 48 1 Y 1 A LYS 142 ? CD ? A LYS 143 CD 49 1 Y 1 A LYS 142 ? CE ? A LYS 143 CE 50 1 Y 1 A LYS 142 ? NZ ? A LYS 143 NZ 51 1 Y 1 A LEU 156 ? CG ? A LEU 157 CG 52 1 Y 1 A LEU 156 ? CD1 ? A LEU 157 CD1 53 1 Y 1 A LEU 156 ? CD2 ? A LEU 157 CD2 54 1 Y 1 A GLU 158 ? CG ? A GLU 159 CG 55 1 Y 1 A GLU 158 ? CD ? A GLU 159 CD 56 1 Y 1 A GLU 158 ? OE1 ? A GLU 159 OE1 57 1 Y 1 A GLU 158 ? OE2 ? A GLU 159 OE2 58 1 Y 1 A ASN 159 ? CG ? A ASN 160 CG 59 1 Y 1 A ASN 159 ? OD1 ? A ASN 160 OD1 60 1 Y 1 A ASN 159 ? ND2 ? A ASN 160 ND2 61 1 Y 1 A LEU 162 ? CG ? A LEU 163 CG 62 1 Y 1 A LEU 162 ? CD1 ? A LEU 163 CD1 63 1 Y 1 A LEU 162 ? CD2 ? A LEU 163 CD2 64 1 Y 1 A GLN 163 ? CG ? A GLN 164 CG 65 1 Y 1 A GLN 163 ? CD ? A GLN 164 CD 66 1 Y 1 A GLN 163 ? OE1 ? A GLN 164 OE1 67 1 Y 1 A GLN 163 ? NE2 ? A GLN 164 NE2 68 1 Y 1 A ARG 175 ? CG ? A ARG 176 CG 69 1 Y 1 A ARG 175 ? CD ? A ARG 176 CD 70 1 Y 1 A ARG 175 ? NE ? A ARG 176 NE 71 1 Y 1 A ARG 175 ? CZ ? A ARG 176 CZ 72 1 Y 1 A ARG 175 ? NH1 ? A ARG 176 NH1 73 1 Y 1 A ARG 175 ? NH2 ? A ARG 176 NH2 74 1 Y 1 A LYS 187 ? CG ? A LYS 188 CG 75 1 Y 1 A LYS 187 ? CD ? A LYS 188 CD 76 1 Y 1 A LYS 187 ? CE ? A LYS 188 CE 77 1 Y 1 A LYS 187 ? NZ ? A LYS 188 NZ 78 1 Y 1 A HIS 189 ? CG ? A HIS 190 CG 79 1 Y 1 A HIS 189 ? ND1 ? A HIS 190 ND1 80 1 Y 1 A HIS 189 ? CD2 ? A HIS 190 CD2 81 1 Y 1 A HIS 189 ? CE1 ? A HIS 190 CE1 82 1 Y 1 A HIS 189 ? NE2 ? A HIS 190 NE2 83 1 Y 1 A LEU 192 ? CG ? A LEU 193 CG 84 1 Y 1 A LEU 192 ? CD1 ? A LEU 193 CD1 85 1 Y 1 A LEU 192 ? CD2 ? A LEU 193 CD2 86 1 Y 1 A LEU 203 ? CG ? A LEU 204 CG 87 1 Y 1 A LEU 203 ? CD1 ? A LEU 204 CD1 88 1 Y 1 A LEU 203 ? CD2 ? A LEU 204 CD2 89 1 Y 1 A ARG 204 ? CG ? A ARG 205 CG 90 1 Y 1 A ARG 204 ? CD ? A ARG 205 CD 91 1 Y 1 A ARG 204 ? NE ? A ARG 205 NE 92 1 Y 1 A ARG 204 ? CZ ? A ARG 205 CZ 93 1 Y 1 A ARG 204 ? NH1 ? A ARG 205 NH1 94 1 Y 1 A ARG 204 ? NH2 ? A ARG 205 NH2 95 1 Y 1 A LYS 208 ? CG ? A LYS 209 CG 96 1 Y 1 A LYS 208 ? CD ? A LYS 209 CD 97 1 Y 1 A LYS 208 ? CE ? A LYS 209 CE 98 1 Y 1 A LYS 208 ? NZ ? A LYS 209 NZ 99 1 Y 1 A ASP 215 ? CG ? A ASP 216 CG 100 1 Y 1 A ASP 215 ? OD1 ? A ASP 216 OD1 101 1 Y 1 A ASP 215 ? OD2 ? A ASP 216 OD2 102 1 Y 1 A ARG 218 ? CG ? A ARG 219 CG 103 1 Y 1 A ARG 218 ? CD ? A ARG 219 CD 104 1 Y 1 A ARG 218 ? NE ? A ARG 219 NE 105 1 Y 1 A ARG 218 ? CZ ? A ARG 219 CZ 106 1 Y 1 A ARG 218 ? NH1 ? A ARG 219 NH1 107 1 Y 1 A ARG 218 ? NH2 ? A ARG 219 NH2 108 1 Y 1 A ARG 222 ? CG ? A ARG 223 CG 109 1 Y 1 A ARG 222 ? CD ? A ARG 223 CD 110 1 Y 1 A ARG 222 ? NE ? A ARG 223 NE 111 1 Y 1 A ARG 222 ? CZ ? A ARG 223 CZ 112 1 Y 1 A ARG 222 ? NH1 ? A ARG 223 NH1 113 1 Y 1 A ARG 222 ? NH2 ? A ARG 223 NH2 114 1 Y 1 A LYS 223 ? CG ? A LYS 224 CG 115 1 Y 1 A LYS 223 ? CD ? A LYS 224 CD 116 1 Y 1 A LYS 223 ? CE ? A LYS 224 CE 117 1 Y 1 A LYS 223 ? NZ ? A LYS 224 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0073 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5H5C _cell.details ? _cell.formula_units_Z ? _cell.length_a 93.391 _cell.length_a_esd ? _cell.length_b 93.391 _cell.length_b_esd ? _cell.length_c 81.129 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H5C _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H5C _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1.26M NaH2PO4 0.14M K2HPO4 pH5.6 0.55mM FOS-MEA-10 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 300 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-07-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H5C _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.31 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 535031 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.45 _refine.aniso_B[1][2] 0.22 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 0.45 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.45 _refine.B_iso_max ? _refine.B_iso_mean 79.727 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.878 _refine.correlation_coeff_Fo_to_Fc_free 0.824 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5H5C _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.31 _refine.ls_d_res_low 50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6065 _refine.ls_number_reflns_R_free 295 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.58 _refine.ls_percent_reflns_R_free 4.6 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.29826 _refine.ls_R_factor_R_free 0.33512 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.29641 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.490 _refine.pdbx_overall_ESU_R_Free 0.554 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.019 _refine.overall_SU_ML 0.000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1458 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1458 _refine_hist.d_res_high 3.31 _refine_hist.d_res_low 50 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.312 _refine_ls_shell.d_res_low 3.398 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_R_work 457 _refine_ls_shell.percent_reflns_obs 98.76 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.392 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.334 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5H5C _struct.title 'Mdm12 from K. lactis (1-239), uniformly Lys dimethyl modified, crystallized in FOS-MEA-10' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5H5C _struct_keywords.text 'lipid binding protein' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MDM12_KLULA _struct_ref.pdbx_db_accession Q6CUC3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDISKEA AKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLEND KLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDFTPED ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H5C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6CUC3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 239 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 239 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5H5C _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q6CUC3 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10900 ? 2 'ABSA (A^2)' 1680 ? 2 MORE -16 ? 2 'SSA (A^2)' 20110 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A 2 1,2 A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_675 x-y+1,-y+2,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 161.7579569697 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TRP A 8 ? GLY A 13 ? TRP A 7 GLY A 12 1 ? 6 HELX_P HELX_P2 AA2 ASP A 14 ? GLN A 30 ? ASP A 13 GLN A 29 1 ? 17 HELX_P HELX_P3 AA3 ASP A 155 ? GLU A 159 ? ASP A 154 GLU A 158 5 ? 5 HELX_P HELX_P4 AA4 GLY A 174 ? ARG A 180 ? GLY A 173 ARG A 179 5 ? 7 HELX_P HELX_P5 AA5 SER A 206 ? ALA A 227 ? SER A 205 ALA A 226 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 228 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 227 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 229 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 228 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.94 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 39 ? ASP A 47 ? ASN A 38 ASP A 46 AA1 2 SER A 102 ? ASP A 108 ? SER A 101 ASP A 107 AA1 3 VAL A 123 ? SER A 128 ? VAL A 122 SER A 127 AA1 4 LYS A 188 ? GLU A 192 ? LYS A 187 GLU A 191 AA2 1 ASN A 54 ? ASP A 61 ? ASN A 53 ASP A 60 AA2 2 VAL A 89 ? LYS A 98 ? VAL A 88 LYS A 97 AA2 3 GLY A 131 ? LEU A 141 ? GLY A 130 LEU A 140 AA2 4 GLN A 144 ? ASP A 152 ? GLN A 143 ASP A 151 AA2 5 ILE A 232 ? LEU A 234 ? ILE A 231 LEU A 233 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 45 ? N ASN A 44 O GLU A 104 ? O GLU A 103 AA1 2 3 N ILE A 103 ? N ILE A 102 O ILE A 127 ? O ILE A 126 AA1 3 4 N SER A 128 ? N SER A 127 O LYS A 188 ? O LYS A 187 AA2 1 2 N GLN A 59 ? N GLN A 58 O LEU A 92 ? O LEU A 91 AA2 2 3 N LEU A 91 ? N LEU A 90 O LEU A 138 ? O LEU A 137 AA2 3 4 N LEU A 135 ? N LEU A 134 O CYS A 151 ? O CYS A 150 AA2 4 5 N LEU A 145 ? N LEU A 144 O LEU A 234 ? O LEU A 233 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 18 ? ? -69.75 93.88 2 1 LYS A 97 ? ? -110.09 69.60 3 1 ASP A 99 ? ? -104.46 52.42 4 1 MET A 131 ? ? -170.90 135.78 5 1 LYS A 142 ? ? 57.36 17.71 6 1 LEU A 149 ? ? -83.74 -77.62 7 1 ASN A 159 ? ? -140.03 46.10 8 1 PRO A 166 ? ? -69.53 21.30 9 1 MET A 172 ? ? 54.67 72.56 10 1 GLU A 178 ? ? -89.74 32.70 11 1 LEU A 216 ? ? -158.48 -57.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 69 ? A TYR 70 2 1 Y 1 A LEU 70 ? A LEU 71 3 1 Y 1 A LEU 71 ? A LEU 72 4 1 Y 1 A GLN 72 ? A GLN 73 5 1 Y 1 A GLU 73 ? A GLU 74 6 1 Y 1 A GLY 74 ? A GLY 75 7 1 Y 1 A ASP 75 ? A ASP 76 8 1 Y 1 A ILE 76 ? A ILE 77 9 1 Y 1 A SER 77 ? A SER 78 10 1 Y 1 A LYS 78 ? A LYS 79 11 1 Y 1 A GLU 79 ? A GLU 80 12 1 Y 1 A ALA 80 ? A ALA 81 13 1 Y 1 A ALA 81 ? A ALA 82 14 1 Y 1 A LYS 82 ? A LYS 83 15 1 Y 1 A ASP 83 ? A ASP 84 16 1 Y 1 A LYS 84 ? A LYS 85 17 1 Y 1 A ASN 85 ? A ASN 86 18 1 Y 1 A THR 86 ? A THR 87 19 1 Y 1 A VAL 109 ? A VAL 110 20 1 Y 1 A LEU 110 ? A LEU 111 21 1 Y 1 A ASN 111 ? A ASN 112 22 1 Y 1 A TYR 112 ? A TYR 113 23 1 Y 1 A PRO 113 ? A PRO 114 24 1 Y 1 A SER 114 ? A SER 115 25 1 Y 1 A PRO 115 ? A PRO 116 26 1 Y 1 A GLN 116 ? A GLN 117 27 1 Y 1 A PHE 117 ? A PHE 118 28 1 Y 1 A MET 118 ? A MET 119 29 1 Y 1 A ILE 119 ? A ILE 120 30 1 Y 1 A GLY 168 ? A GLY 169 31 1 Y 1 A PRO 169 ? A PRO 170 32 1 Y 1 A GLY 193 ? A GLY 194 33 1 Y 1 A GLN 194 ? A GLN 195 34 1 Y 1 A LEU 195 ? A LEU 196 35 1 Y 1 A ASP 196 ? A ASP 197 36 1 Y 1 A GLN 197 ? A GLN 198 37 1 Y 1 A GLY 198 ? A GLY 199 38 1 Y 1 A GLU 199 ? A GLU 200 39 1 Y 1 A GLY 200 ? A GLY 201 40 1 Y 1 A SER 201 ? A SER 202 41 1 Y 1 A VAL 202 ? A VAL 203 42 1 Y 1 A PHE 235 ? A PHE 236 43 1 Y 1 A THR 236 ? A THR 237 44 1 Y 1 A PRO 237 ? A PRO 238 45 1 Y 1 A GLU 238 ? A GLU 239 46 1 Y 1 A ASP 239 ? A ASP 240 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 25840020 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5H5C _atom_sites.fract_transf_matrix[1][1] 0.010708 _atom_sites.fract_transf_matrix[1][2] 0.006182 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012364 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012326 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_