data_5H9C # _entry.id 5H9C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5H9C WWPDB D_1000216696 # _pdbx_database_related.db_name PDB _pdbx_database_related.details '4JPR contains the same protein structure' _pdbx_database_related.db_id 4JPR _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H9C _pdbx_database_status.recvd_initial_deposition_date 2015-12-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aydin, H.' 1 'Lee, J.E.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Faseb J.' _citation.journal_id_ASTM FAJOEC _citation.journal_id_CSD 2074 _citation.journal_id_ISSN 1530-6860 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 5059 _citation.page_last 5071 _citation.title 'Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.' _citation.year 2013 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1096/fj.13-232371 _citation.pdbx_database_id_PubMed 24036886 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aydin, H.' 1 ? primary 'Smrke, B.M.' 2 ? primary 'Lee, J.E.' 3 ? # _cell.entry_id 5H9C _cell.length_a 42.800 _cell.length_b 42.800 _cell.length_c 119.428 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 9 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H9C _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Envelope glycoprotein gp95' 10579.786 1 ? C499S ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Env polyprotein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHVDDDDKSENLYFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSES IQKKFQLMKEHVNK ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHVDDDDKSENLYFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSES IQKKFQLMKEHVNK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 LYS n 1 15 SER n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 GLY n 1 23 THR n 1 24 ALA n 1 25 ASN n 1 26 LEU n 1 27 THR n 1 28 THR n 1 29 SER n 1 30 LEU n 1 31 LEU n 1 32 GLY n 1 33 ASP n 1 34 LEU n 1 35 LEU n 1 36 ASP n 1 37 ASP n 1 38 VAL n 1 39 THR n 1 40 SER n 1 41 ILE n 1 42 ARG n 1 43 HIS n 1 44 ALA n 1 45 VAL n 1 46 LEU n 1 47 GLN n 1 48 ASN n 1 49 ARG n 1 50 ALA n 1 51 ALA n 1 52 ILE n 1 53 ASP n 1 54 PHE n 1 55 LEU n 1 56 LEU n 1 57 LEU n 1 58 ALA n 1 59 HIS n 1 60 GLY n 1 61 HIS n 1 62 GLY n 1 63 CYS n 1 64 GLU n 1 65 ASP n 1 66 VAL n 1 67 ALA n 1 68 GLY n 1 69 MET n 1 70 CYS n 1 71 SER n 1 72 PHE n 1 73 ASN n 1 74 LEU n 1 75 SER n 1 76 ASP n 1 77 GLN n 1 78 SER n 1 79 GLU n 1 80 SER n 1 81 ILE n 1 82 GLN n 1 83 LYS n 1 84 LYS n 1 85 PHE n 1 86 GLN n 1 87 LEU n 1 88 MET n 1 89 LYS n 1 90 GLU n 1 91 HIS n 1 92 VAL n 1 93 ASN n 1 94 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 94 _entity_src_gen.gene_src_common_name RSV-SRA _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene env _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Avian leukosis virus RSA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 269446 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ENV_RSVSA _struct_ref.pdbx_db_accession P03397 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCCFNLSDHSESIQKKFQLMKEHVNK _struct_ref.pdbx_align_begin 452 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H9C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03397 _struct_ref_seq.db_align_beg 452 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 522 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 455 _struct_ref_seq.pdbx_auth_seq_align_end 526 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5H9C MET A 1 ? UNP P03397 ? ? 'initiating methionine' -22 1 1 5H9C ALA A 2 ? UNP P03397 ? ? 'expression tag' -21 2 1 5H9C HIS A 3 ? UNP P03397 ? ? 'expression tag' -20 3 1 5H9C HIS A 4 ? UNP P03397 ? ? 'expression tag' -19 4 1 5H9C HIS A 5 ? UNP P03397 ? ? 'expression tag' -18 5 1 5H9C HIS A 6 ? UNP P03397 ? ? 'expression tag' -17 6 1 5H9C HIS A 7 ? UNP P03397 ? ? 'expression tag' -16 7 1 5H9C HIS A 8 ? UNP P03397 ? ? 'expression tag' -15 8 1 5H9C VAL A 9 ? UNP P03397 ? ? 'expression tag' -14 9 1 5H9C ASP A 10 ? UNP P03397 ? ? 'expression tag' -13 10 1 5H9C ASP A 11 ? UNP P03397 ? ? 'expression tag' -12 11 1 5H9C ASP A 12 ? UNP P03397 ? ? 'expression tag' -11 12 1 5H9C ASP A 13 ? UNP P03397 ? ? 'expression tag' -10 13 1 5H9C LYS A 14 ? UNP P03397 ? ? 'expression tag' -9 14 1 5H9C SER A 15 ? UNP P03397 ? ? 'expression tag' -8 15 1 5H9C GLU A 16 ? UNP P03397 ? ? 'expression tag' -7 16 1 5H9C ASN A 17 ? UNP P03397 ? ? 'expression tag' -6 17 1 5H9C LEU A 18 ? UNP P03397 ? ? 'expression tag' -5 18 1 5H9C TYR A 19 ? UNP P03397 ? ? 'expression tag' -4 19 1 5H9C PHE A 20 ? UNP P03397 ? ? 'expression tag' -3 20 1 5H9C GLN A 21 ? UNP P03397 ? ? 'expression tag' -2 21 1 5H9C GLY A 22 ? UNP P03397 ? ? 'expression tag' -1 22 1 5H9C THR A 23 ? UNP P03397 ? ? 'expression tag' 0 23 1 5H9C SER A 71 ? UNP P03397 CYS 499 'engineered mutation' 502 24 1 5H9C GLN A 77 ? UNP P03397 HIS 505 variant 508 25 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H9C _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v) 2-methyl-2,4-pentanediol, 5% (w/v) PEG 8000, and 0.1 M sodium cacodylate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H9C _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.78 _reflns.d_resolution_low 39.81 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7712 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.500 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.38 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.78 _reflns_shell.d_res_low 1.82 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.700 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 80.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.708 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.800 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5H9C _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7701 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.97 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.809 _refine.ls_d_res_high 1.783 _refine.ls_percent_reflns_obs 98.81 _refine.ls_R_factor_obs 0.1595 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1575 _refine.ls_R_factor_R_free 0.1993 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.57 _refine.ls_number_reflns_R_free 352 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 4JPR _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.13 _refine.pdbx_overall_phase_error 27.35 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 588 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 612 _refine_hist.d_res_high 1.783 _refine_hist.d_res_low 39.809 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 599 'X-RAY DIFFRACTION' ? f_angle_d 0.987 ? ? 807 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 12.566 ? ? 212 'X-RAY DIFFRACTION' ? f_chiral_restr 0.035 ? ? 96 'X-RAY DIFFRACTION' ? f_plane_restr 0.003 ? ? 105 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.7832 2.0412 2402 0.1912 97.00 0.2276 . . 112 . . 'X-RAY DIFFRACTION' . 2.0412 2.5717 2468 0.1751 100.00 0.2028 . . 129 . . 'X-RAY DIFFRACTION' . 2.5717 39.8192 2479 0.1460 100.00 0.1936 . . 111 . . # _struct.entry_id 5H9C _struct.title 'Crystal structure of the ASLV fusion protein core' _struct.pdbx_descriptor 'Envelope glycoprotein gp95' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5H9C _struct_keywords.text 'fusion, ASLV, glycoprotein, entry, virus, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 17 ? HIS A 59 ? ASN A -6 HIS A 490 1 ? 43 HELX_P HELX_P2 AA2 GLY A 62 ? VAL A 66 ? GLY A 493 VAL A 497 5 ? 5 HELX_P HELX_P3 AA3 GLN A 77 ? LYS A 94 ? GLN A 508 LYS A 526 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 63 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 70 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 494 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 501 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.037 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CL _struct_site.pdbx_auth_seq_id 601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue CL A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 48 ? ASN A 479 . ? 3_675 ? 2 AC1 3 ASN A 48 ? ASN A 479 . ? 2_765 ? 3 AC1 3 ASN A 48 ? ASN A 479 . ? 1_555 ? # _atom_sites.entry_id 5H9C _atom_sites.fract_transf_matrix[1][1] 0.023364 _atom_sites.fract_transf_matrix[1][2] 0.013489 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026979 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008373 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -22 ? ? ? A . n A 1 2 ALA 2 -21 ? ? ? A . n A 1 3 HIS 3 -20 ? ? ? A . n A 1 4 HIS 4 -19 ? ? ? A . n A 1 5 HIS 5 -18 ? ? ? A . n A 1 6 HIS 6 -17 ? ? ? A . n A 1 7 HIS 7 -16 ? ? ? A . n A 1 8 HIS 8 -15 ? ? ? A . n A 1 9 VAL 9 -14 ? ? ? A . n A 1 10 ASP 10 -13 ? ? ? A . n A 1 11 ASP 11 -12 ? ? ? A . n A 1 12 ASP 12 -11 ? ? ? A . n A 1 13 ASP 13 -10 ? ? ? A . n A 1 14 LYS 14 -9 ? ? ? A . n A 1 15 SER 15 -8 ? ? ? A . n A 1 16 GLU 16 -7 ? ? ? A . n A 1 17 ASN 17 -6 -6 ASN ASN A . n A 1 18 LEU 18 -5 -5 LEU LEU A . n A 1 19 TYR 19 -4 -4 TYR TYR A . n A 1 20 PHE 20 -3 -3 PHE PHE A . n A 1 21 GLN 21 -2 -2 GLN GLN A . n A 1 22 GLY 22 -1 -1 GLY GLY A . n A 1 23 THR 23 0 0 THR THR A . n A 1 24 ALA 24 455 455 ALA ALA A . n A 1 25 ASN 25 456 456 ASN ASN A . n A 1 26 LEU 26 457 457 LEU LEU A . n A 1 27 THR 27 458 458 THR THR A . n A 1 28 THR 28 459 459 THR THR A . n A 1 29 SER 29 460 460 SER SER A . n A 1 30 LEU 30 461 461 LEU LEU A . n A 1 31 LEU 31 462 462 LEU LEU A . n A 1 32 GLY 32 463 463 GLY GLY A . n A 1 33 ASP 33 464 464 ASP ASP A . n A 1 34 LEU 34 465 465 LEU LEU A . n A 1 35 LEU 35 466 466 LEU LEU A . n A 1 36 ASP 36 467 467 ASP ASP A . n A 1 37 ASP 37 468 468 ASP ASP A . n A 1 38 VAL 38 469 469 VAL VAL A . n A 1 39 THR 39 470 470 THR THR A . n A 1 40 SER 40 471 471 SER SER A . n A 1 41 ILE 41 472 472 ILE ILE A . n A 1 42 ARG 42 473 473 ARG ARG A . n A 1 43 HIS 43 474 474 HIS HIS A . n A 1 44 ALA 44 475 475 ALA ALA A . n A 1 45 VAL 45 476 476 VAL VAL A . n A 1 46 LEU 46 477 477 LEU LEU A . n A 1 47 GLN 47 478 478 GLN GLN A . n A 1 48 ASN 48 479 479 ASN ASN A . n A 1 49 ARG 49 480 480 ARG ARG A . n A 1 50 ALA 50 481 481 ALA ALA A . n A 1 51 ALA 51 482 482 ALA ALA A . n A 1 52 ILE 52 483 483 ILE ILE A . n A 1 53 ASP 53 484 484 ASP ASP A . n A 1 54 PHE 54 485 485 PHE PHE A . n A 1 55 LEU 55 486 486 LEU LEU A . n A 1 56 LEU 56 487 487 LEU LEU A . n A 1 57 LEU 57 488 488 LEU LEU A . n A 1 58 ALA 58 489 489 ALA ALA A . n A 1 59 HIS 59 490 490 HIS HIS A . n A 1 60 GLY 60 491 491 GLY GLY A . n A 1 61 HIS 61 492 492 HIS HIS A . n A 1 62 GLY 62 493 493 GLY GLY A . n A 1 63 CYS 63 494 494 CYS CYS A . n A 1 64 GLU 64 495 495 GLU GLU A . n A 1 65 ASP 65 496 496 ASP ASP A . n A 1 66 VAL 66 497 497 VAL VAL A . n A 1 67 ALA 67 498 498 ALA ALA A . n A 1 68 GLY 68 499 499 GLY GLY A . n A 1 69 MET 69 500 500 MET MET A . n A 1 70 CYS 70 501 501 CYS CYS A . n A 1 71 SER 71 502 502 SER SER A . n A 1 72 PHE 72 503 503 PHE PHE A . n A 1 73 ASN 73 504 504 ASN ASN A . n A 1 74 LEU 74 505 505 LEU LEU A . n A 1 75 SER 75 506 506 SER SER A . n A 1 76 ASP 76 507 507 ASP ASP A . n A 1 77 GLN 77 508 508 GLN GLN A . n A 1 78 SER 78 509 509 SER SER A . n A 1 79 GLU 79 510 510 GLU GLU A . n A 1 80 SER 80 511 511 SER SER A . n A 1 81 ILE 81 512 512 ILE ILE A . n A 1 82 GLN 82 513 513 GLN GLN A . n A 1 83 LYS 83 515 515 LYS LYS A . n A 1 84 LYS 84 516 516 LYS LYS A . n A 1 85 PHE 85 517 517 PHE PHE A . n A 1 86 GLN 86 518 518 GLN GLN A . n A 1 87 LEU 87 519 519 LEU LEU A . n A 1 88 MET 88 520 520 MET MET A . n A 1 89 LYS 89 521 521 LYS LYS A . n A 1 90 GLU 90 522 522 GLU GLU A . n A 1 91 HIS 91 523 523 HIS HIS A . n A 1 92 VAL 92 524 524 VAL VAL A . n A 1 93 ASN 93 525 525 ASN ASN A . n A 1 94 LYS 94 526 526 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 601 1 CL CL A . C 3 HOH 1 701 22 HOH HOH A . C 3 HOH 2 702 9 HOH HOH A . C 3 HOH 3 703 3 HOH HOH A . C 3 HOH 4 704 20 HOH HOH A . C 3 HOH 5 705 1 HOH HOH A . C 3 HOH 6 706 2 HOH HOH A . C 3 HOH 7 707 5 HOH HOH A . C 3 HOH 8 708 7 HOH HOH A . C 3 HOH 9 709 4 HOH HOH A . C 3 HOH 10 710 12 HOH HOH A . C 3 HOH 11 711 21 HOH HOH A . C 3 HOH 12 712 18 HOH HOH A . C 3 HOH 13 713 10 HOH HOH A . C 3 HOH 14 714 6 HOH HOH A . C 3 HOH 15 715 14 HOH HOH A . C 3 HOH 16 716 13 HOH HOH A . C 3 HOH 17 717 16 HOH HOH A . C 3 HOH 18 718 23 HOH HOH A . C 3 HOH 19 719 19 HOH HOH A . C 3 HOH 20 720 15 HOH HOH A . C 3 HOH 21 721 8 HOH HOH A . C 3 HOH 22 722 11 HOH HOH A . C 3 HOH 23 723 17 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7340 ? 1 MORE -76 ? 1 'SSA (A^2)' 11050 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_765 -y+2,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 64.2000000000 0.8660254038 -0.5000000000 0.0000000000 37.0658872820 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_675 -x+y+1,-x+2,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 74.1317745639 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 601 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-06 2 'Structure model' 1 1 2017-09-06 3 'Structure model' 1 2 2020-01-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 23.4849 32.3700 64.4763 0.2242 0.1818 0.1950 0.0083 0.0194 -0.0137 1.7004 0.7979 2.2061 0.0047 -1.3534 -0.2414 0.0473 0.1761 0.0010 -0.0786 0.0140 -0.0540 0.2238 -0.0623 0.0034 'X-RAY DIFFRACTION' 2 ? refined 11.1113 32.5401 79.0592 0.2625 0.3446 0.2955 -0.1056 0.0102 -0.0070 1.7466 1.1771 5.3624 -1.0959 -0.4290 0.4553 0.1472 0.2289 0.0706 0.0544 0.0731 0.2251 0.5963 -1.0424 0.1043 'X-RAY DIFFRACTION' 3 ? refined 19.7699 25.2185 49.9416 0.2591 0.3595 0.4583 -0.0082 -0.0354 0.0128 4.3212 2.8601 2.9074 -0.9443 -2.6655 2.3142 0.0384 0.0406 -0.7507 0.0714 -0.0998 -0.0611 0.0984 0.2696 -0.0075 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid -6 through 490 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 491 through 508 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 509 through 526 ) ; # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HH12 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 473 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 701 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 HD22 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASN _pdbx_validate_symm_contact.auth_seq_id_1 456 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 H _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ALA _pdbx_validate_symm_contact.auth_seq_id_2 498 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_544 _pdbx_validate_symm_contact.dist 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 504 ? ? -101.86 70.32 2 1 GLN A 508 ? ? -99.62 36.74 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU -5 ? CG ? A LEU 18 CG 2 1 Y 1 A LEU -5 ? CD1 ? A LEU 18 CD1 3 1 Y 1 A LEU -5 ? CD2 ? A LEU 18 CD2 4 1 Y 1 A PHE -3 ? CG ? A PHE 20 CG 5 1 Y 1 A PHE -3 ? CD1 ? A PHE 20 CD1 6 1 Y 1 A PHE -3 ? CD2 ? A PHE 20 CD2 7 1 Y 1 A PHE -3 ? CE1 ? A PHE 20 CE1 8 1 Y 1 A PHE -3 ? CE2 ? A PHE 20 CE2 9 1 Y 1 A PHE -3 ? CZ ? A PHE 20 CZ 10 1 Y 1 A ASN 504 ? CG ? A ASN 73 CG 11 1 Y 1 A ASN 504 ? OD1 ? A ASN 73 OD1 12 1 Y 1 A ASN 504 ? ND2 ? A ASN 73 ND2 13 1 Y 1 A LYS 526 ? CG ? A LYS 94 CG 14 1 Y 1 A LYS 526 ? CD ? A LYS 94 CD 15 1 Y 1 A LYS 526 ? CE ? A LYS 94 CE 16 1 Y 1 A LYS 526 ? NZ ? A LYS 94 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -22 ? A MET 1 2 1 Y 1 A ALA -21 ? A ALA 2 3 1 Y 1 A HIS -20 ? A HIS 3 4 1 Y 1 A HIS -19 ? A HIS 4 5 1 Y 1 A HIS -18 ? A HIS 5 6 1 Y 1 A HIS -17 ? A HIS 6 7 1 Y 1 A HIS -16 ? A HIS 7 8 1 Y 1 A HIS -15 ? A HIS 8 9 1 Y 1 A VAL -14 ? A VAL 9 10 1 Y 1 A ASP -13 ? A ASP 10 11 1 Y 1 A ASP -12 ? A ASP 11 12 1 Y 1 A ASP -11 ? A ASP 12 13 1 Y 1 A ASP -10 ? A ASP 13 14 1 Y 1 A LYS -9 ? A LYS 14 15 1 Y 1 A SER -8 ? A SER 15 16 1 Y 1 A GLU -7 ? A GLU 16 # _pdbx_audit_support.country Canada _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.grant_number MOP-115066 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH #