data_5HBO # _entry.id 5HBO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5HBO pdb_00005hbo 10.2210/pdb5hbo/pdb WWPDB D_1000216789 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-10 2 'Structure model' 1 1 2016-09-28 3 'Structure model' 1 2 2021-09-08 4 'Structure model' 1 3 2024-01-10 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' struct_conn 3 3 'Structure model' struct_ref_seq_dif 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HBO _pdbx_database_status.recvd_initial_deposition_date 2016-01-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5HBL is the same protein but it was prepare with presence of 1mM DTT' _pdbx_database_related.db_id 5HBL _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eichmann, C.' 1 'Tzitzilonis, C.' 2 'Nakamura, T.' 3 'Kwiatkowski, W.' 4 'Maslennikov, I.' 5 'Choe, S.' 6 'Lipton, S.A.' 7 'Riek, R.' 8 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 428 _citation.language ? _citation.page_first 3737 _citation.page_last 3751 _citation.title 'S-Nitrosylation Induces Structural and Dynamical Changes in a Rhodanese Family Protein.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2016.07.010 _citation.pdbx_database_id_PubMed 27473602 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eichmann, C.' 1 ? primary 'Tzitzilonis, C.' 2 ? primary 'Nakamura, T.' 3 ? primary 'Kwiatkowski, W.' 4 ? primary 'Maslennikov, I.' 5 ? primary 'Choe, S.' 6 ? primary 'Lipton, S.A.' 7 ? primary 'Riek, R.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Inner membrane protein YgaP' 14075.828 1 ? ? ? ? 2 water nat water 18.015 143 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MKSSHHHHHHENLYFQSNAALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIF H(SNC)QAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSSHHHHHHENLYFQSNAALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIF HCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLU n 1 12 ASN n 1 13 LEU n 1 14 TYR n 1 15 PHE n 1 16 GLN n 1 17 SER n 1 18 ASN n 1 19 ALA n 1 20 ALA n 1 21 LEU n 1 22 THR n 1 23 THR n 1 24 ILE n 1 25 SER n 1 26 PRO n 1 27 HIS n 1 28 ASP n 1 29 ALA n 1 30 GLN n 1 31 GLU n 1 32 LEU n 1 33 ILE n 1 34 ALA n 1 35 ARG n 1 36 GLY n 1 37 ALA n 1 38 LYS n 1 39 LEU n 1 40 ILE n 1 41 ASP n 1 42 ILE n 1 43 ARG n 1 44 ASP n 1 45 ALA n 1 46 ASP n 1 47 GLU n 1 48 TYR n 1 49 LEU n 1 50 ARG n 1 51 GLU n 1 52 HIS n 1 53 ILE n 1 54 PRO n 1 55 GLU n 1 56 ALA n 1 57 ASP n 1 58 LEU n 1 59 ALA n 1 60 PRO n 1 61 LEU n 1 62 SER n 1 63 VAL n 1 64 LEU n 1 65 GLU n 1 66 GLN n 1 67 SER n 1 68 GLY n 1 69 LEU n 1 70 PRO n 1 71 ALA n 1 72 LYS n 1 73 LEU n 1 74 ARG n 1 75 HIS n 1 76 GLU n 1 77 GLN n 1 78 ILE n 1 79 ILE n 1 80 PHE n 1 81 HIS n 1 82 SNC y 1 82 CSS y 1 83 GLN n 1 84 ALA n 1 85 GLY n 1 86 LYS n 1 87 ARG n 1 88 THR n 1 89 SER n 1 90 ASN n 1 91 ASN n 1 92 ALA n 1 93 ASP n 1 94 LYS n 1 95 LEU n 1 96 ALA n 1 97 ALA n 1 98 ILE n 1 99 ALA n 1 100 ALA n 1 101 PRO n 1 102 ALA n 1 103 GLU n 1 104 ILE n 1 105 PHE n 1 106 LEU n 1 107 LEU n 1 108 GLU n 1 109 ASP n 1 110 GLY n 1 111 ILE n 1 112 ASP n 1 113 GLY n 1 114 TRP n 1 115 LYS n 1 116 LYS n 1 117 ALA n 1 118 GLY n 1 119 LEU n 1 120 PRO n 1 121 VAL n 1 122 ALA n 1 123 VAL n 1 124 ASN n 1 125 LYS n 1 126 SER n 1 127 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 127 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ygaP, b2668, JW2643' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant star _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSS 'L-peptide linking' n S-MERCAPTOCYSTEINE ? 'C3 H7 N O2 S2' 153.223 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SNC 'L-peptide linking' n S-NITROSO-CYSTEINE ? 'C3 H6 N2 O3 S' 150.156 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -18 ? ? ? A . n A 1 2 LYS 2 -17 ? ? ? A . n A 1 3 SER 3 -16 ? ? ? A . n A 1 4 SER 4 -15 ? ? ? A . n A 1 5 HIS 5 -14 ? ? ? A . n A 1 6 HIS 6 -13 ? ? ? A . n A 1 7 HIS 7 -12 ? ? ? A . n A 1 8 HIS 8 -11 ? ? ? A . n A 1 9 HIS 9 -10 ? ? ? A . n A 1 10 HIS 10 -9 ? ? ? A . n A 1 11 GLU 11 -8 ? ? ? A . n A 1 12 ASN 12 -7 ? ? ? A . n A 1 13 LEU 13 -6 ? ? ? A . n A 1 14 TYR 14 -5 ? ? ? A . n A 1 15 PHE 15 -4 ? ? ? A . n A 1 16 GLN 16 -3 ? ? ? A . n A 1 17 SER 17 -2 ? ? ? A . n A 1 18 ASN 18 -1 ? ? ? A . n A 1 19 ALA 19 0 ? ? ? A . n A 1 20 ALA 20 1 ? ? ? A . n A 1 21 LEU 21 2 ? ? ? A . n A 1 22 THR 22 3 3 THR THR A . n A 1 23 THR 23 4 4 THR THR A . n A 1 24 ILE 24 5 5 ILE ILE A . n A 1 25 SER 25 6 6 SER SER A . n A 1 26 PRO 26 7 7 PRO PRO A . n A 1 27 HIS 27 8 8 HIS HIS A . n A 1 28 ASP 28 9 9 ASP ASP A . n A 1 29 ALA 29 10 10 ALA ALA A . n A 1 30 GLN 30 11 11 GLN GLN A . n A 1 31 GLU 31 12 12 GLU GLU A . n A 1 32 LEU 32 13 13 LEU LEU A . n A 1 33 ILE 33 14 14 ILE ILE A . n A 1 34 ALA 34 15 15 ALA ALA A . n A 1 35 ARG 35 16 16 ARG ARG A . n A 1 36 GLY 36 17 17 GLY GLY A . n A 1 37 ALA 37 18 18 ALA ALA A . n A 1 38 LYS 38 19 19 LYS LYS A . n A 1 39 LEU 39 20 20 LEU LEU A . n A 1 40 ILE 40 21 21 ILE ILE A . n A 1 41 ASP 41 22 22 ASP ASP A . n A 1 42 ILE 42 23 23 ILE ILE A . n A 1 43 ARG 43 24 24 ARG ARG A . n A 1 44 ASP 44 25 25 ASP ASP A . n A 1 45 ALA 45 26 26 ALA ALA A . n A 1 46 ASP 46 27 27 ASP ASP A . n A 1 47 GLU 47 28 28 GLU GLU A . n A 1 48 TYR 48 29 29 TYR TYR A . n A 1 49 LEU 49 30 30 LEU LEU A . n A 1 50 ARG 50 31 31 ARG ARG A . n A 1 51 GLU 51 32 32 GLU GLU A . n A 1 52 HIS 52 33 33 HIS HIS A . n A 1 53 ILE 53 34 34 ILE ILE A . n A 1 54 PRO 54 35 35 PRO PRO A . n A 1 55 GLU 55 36 36 GLU GLU A . n A 1 56 ALA 56 37 37 ALA ALA A . n A 1 57 ASP 57 38 38 ASP ASP A . n A 1 58 LEU 58 39 39 LEU LEU A . n A 1 59 ALA 59 40 40 ALA ALA A . n A 1 60 PRO 60 41 41 PRO PRO A . n A 1 61 LEU 61 42 42 LEU LEU A . n A 1 62 SER 62 43 43 SER SER A . n A 1 63 VAL 63 44 44 VAL VAL A . n A 1 64 LEU 64 45 45 LEU LEU A . n A 1 65 GLU 65 46 46 GLU GLU A . n A 1 66 GLN 66 47 47 GLN GLN A . n A 1 67 SER 67 48 48 SER SER A . n A 1 68 GLY 68 49 49 GLY GLY A . n A 1 69 LEU 69 50 50 LEU LEU A . n A 1 70 PRO 70 51 51 PRO PRO A . n A 1 71 ALA 71 52 52 ALA ALA A . n A 1 72 LYS 72 53 53 LYS LYS A . n A 1 73 LEU 73 54 54 LEU LEU A . n A 1 74 ARG 74 55 55 ARG ARG A . n A 1 75 HIS 75 56 56 HIS HIS A . n A 1 76 GLU 76 57 57 GLU GLU A . n A 1 77 GLN 77 58 58 GLN GLN A . n A 1 78 ILE 78 59 59 ILE ILE A . n A 1 79 ILE 79 60 60 ILE ILE A . n A 1 80 PHE 80 61 61 PHE PHE A . n A 1 81 HIS 81 62 62 HIS HIS A . n A 1 82 SNC 82 63 63 SNC SNC A . y A 1 82 CSS 82 63 63 CSS CSS A . y A 1 83 GLN 83 64 64 GLN GLN A . n A 1 84 ALA 84 65 65 ALA ALA A . n A 1 85 GLY 85 66 66 GLY GLY A . n A 1 86 LYS 86 67 67 LYS LYS A . n A 1 87 ARG 87 68 68 ARG ARG A . n A 1 88 THR 88 69 69 THR THR A . n A 1 89 SER 89 70 70 SER SER A . n A 1 90 ASN 90 71 71 ASN ASN A . n A 1 91 ASN 91 72 72 ASN ASN A . n A 1 92 ALA 92 73 73 ALA ALA A . n A 1 93 ASP 93 74 74 ASP ASP A . n A 1 94 LYS 94 75 75 LYS LYS A . n A 1 95 LEU 95 76 76 LEU LEU A . n A 1 96 ALA 96 77 77 ALA ALA A . n A 1 97 ALA 97 78 78 ALA ALA A . n A 1 98 ILE 98 79 79 ILE ILE A . n A 1 99 ALA 99 80 80 ALA ALA A . n A 1 100 ALA 100 81 81 ALA ALA A . n A 1 101 PRO 101 82 82 PRO PRO A . n A 1 102 ALA 102 83 83 ALA ALA A . n A 1 103 GLU 103 84 84 GLU GLU A . n A 1 104 ILE 104 85 85 ILE ILE A . n A 1 105 PHE 105 86 86 PHE PHE A . n A 1 106 LEU 106 87 87 LEU LEU A . n A 1 107 LEU 107 88 88 LEU LEU A . n A 1 108 GLU 108 89 89 GLU GLU A . n A 1 109 ASP 109 90 90 ASP ASP A . n A 1 110 GLY 110 91 91 GLY GLY A . n A 1 111 ILE 111 92 92 ILE ILE A . n A 1 112 ASP 112 93 93 ASP ASP A . n A 1 113 GLY 113 94 94 GLY GLY A . n A 1 114 TRP 114 95 95 TRP TRP A . n A 1 115 LYS 115 96 96 LYS LYS A . n A 1 116 LYS 116 97 97 LYS LYS A . n A 1 117 ALA 117 98 98 ALA ALA A . n A 1 118 GLY 118 99 99 GLY GLY A . n A 1 119 LEU 119 100 100 LEU LEU A . n A 1 120 PRO 120 101 101 PRO PRO A . n A 1 121 VAL 121 102 102 VAL VAL A . n A 1 122 ALA 122 103 103 ALA ALA A . n A 1 123 VAL 123 104 104 VAL VAL A . n A 1 124 ASN 124 105 105 ASN ASN A . n A 1 125 LYS 125 106 ? ? ? A . n A 1 126 SER 126 107 ? ? ? A . n A 1 127 GLN 127 108 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 204 HOH HOH A . B 2 HOH 2 202 165 HOH HOH A . B 2 HOH 3 203 92 HOH HOH A . B 2 HOH 4 204 123 HOH HOH A . B 2 HOH 5 205 71 HOH HOH A . B 2 HOH 6 206 61 HOH HOH A . B 2 HOH 7 207 18 HOH HOH A . B 2 HOH 8 208 162 HOH HOH A . B 2 HOH 9 209 99 HOH HOH A . B 2 HOH 10 210 209 HOH HOH A . B 2 HOH 11 211 89 HOH HOH A . B 2 HOH 12 212 23 HOH HOH A . B 2 HOH 13 213 173 HOH HOH A . B 2 HOH 14 214 110 HOH HOH A . B 2 HOH 15 215 20 HOH HOH A . B 2 HOH 16 216 47 HOH HOH A . B 2 HOH 17 217 49 HOH HOH A . B 2 HOH 18 218 12 HOH HOH A . B 2 HOH 19 219 11 HOH HOH A . B 2 HOH 20 220 152 HOH HOH A . B 2 HOH 21 221 17 HOH HOH A . B 2 HOH 22 222 16 HOH HOH A . B 2 HOH 23 223 6 HOH HOH A . B 2 HOH 24 224 50 HOH HOH A . B 2 HOH 25 225 157 HOH HOH A . B 2 HOH 26 226 52 HOH HOH A . B 2 HOH 27 227 5 HOH HOH A . B 2 HOH 28 228 105 HOH HOH A . B 2 HOH 29 229 65 HOH HOH A . B 2 HOH 30 230 195 HOH HOH A . B 2 HOH 31 231 86 HOH HOH A . B 2 HOH 32 232 57 HOH HOH A . B 2 HOH 33 233 73 HOH HOH A . B 2 HOH 34 234 185 HOH HOH A . B 2 HOH 35 235 179 HOH HOH A . B 2 HOH 36 236 103 HOH HOH A . B 2 HOH 37 237 4 HOH HOH A . B 2 HOH 38 238 39 HOH HOH A . B 2 HOH 39 239 186 HOH HOH A . B 2 HOH 40 240 10 HOH HOH A . B 2 HOH 41 241 26 HOH HOH A . B 2 HOH 42 242 108 HOH HOH A . B 2 HOH 43 243 41 HOH HOH A . B 2 HOH 44 244 24 HOH HOH A . B 2 HOH 45 245 63 HOH HOH A . B 2 HOH 46 246 22 HOH HOH A . B 2 HOH 47 247 9 HOH HOH A . B 2 HOH 48 248 13 HOH HOH A . B 2 HOH 49 249 27 HOH HOH A . B 2 HOH 50 250 7 HOH HOH A . B 2 HOH 51 251 53 HOH HOH A . B 2 HOH 52 252 8 HOH HOH A . B 2 HOH 53 253 1 HOH HOH A . B 2 HOH 54 254 58 HOH HOH A . B 2 HOH 55 255 43 HOH HOH A . B 2 HOH 56 256 59 HOH HOH A . B 2 HOH 57 257 19 HOH HOH A . B 2 HOH 58 258 96 HOH HOH A . B 2 HOH 59 259 31 HOH HOH A . B 2 HOH 60 260 70 HOH HOH A . B 2 HOH 61 261 2 HOH HOH A . B 2 HOH 62 262 198 HOH HOH A . B 2 HOH 63 263 34 HOH HOH A . B 2 HOH 64 264 67 HOH HOH A . B 2 HOH 65 265 51 HOH HOH A . B 2 HOH 66 266 78 HOH HOH A . B 2 HOH 67 267 21 HOH HOH A . B 2 HOH 68 268 32 HOH HOH A . B 2 HOH 69 269 25 HOH HOH A . B 2 HOH 70 270 46 HOH HOH A . B 2 HOH 71 271 30 HOH HOH A . B 2 HOH 72 272 72 HOH HOH A . B 2 HOH 73 273 205 HOH HOH A . B 2 HOH 74 274 29 HOH HOH A . B 2 HOH 75 275 44 HOH HOH A . B 2 HOH 76 276 74 HOH HOH A . B 2 HOH 77 277 114 HOH HOH A . B 2 HOH 78 278 28 HOH HOH A . B 2 HOH 79 279 95 HOH HOH A . B 2 HOH 80 280 75 HOH HOH A . B 2 HOH 81 281 37 HOH HOH A . B 2 HOH 82 282 83 HOH HOH A . B 2 HOH 83 283 85 HOH HOH A . B 2 HOH 84 284 90 HOH HOH A . B 2 HOH 85 285 146 HOH HOH A . B 2 HOH 86 286 154 HOH HOH A . B 2 HOH 87 287 45 HOH HOH A . B 2 HOH 88 288 55 HOH HOH A . B 2 HOH 89 289 127 HOH HOH A . B 2 HOH 90 290 139 HOH HOH A . B 2 HOH 91 291 122 HOH HOH A . B 2 HOH 92 292 84 HOH HOH A . B 2 HOH 93 293 40 HOH HOH A . B 2 HOH 94 294 36 HOH HOH A . B 2 HOH 95 295 113 HOH HOH A . B 2 HOH 96 296 54 HOH HOH A . B 2 HOH 97 297 38 HOH HOH A . B 2 HOH 98 298 35 HOH HOH A . B 2 HOH 99 299 98 HOH HOH A . B 2 HOH 100 300 213 HOH HOH A . B 2 HOH 101 301 112 HOH HOH A . B 2 HOH 102 302 33 HOH HOH A . B 2 HOH 103 303 14 HOH HOH A . B 2 HOH 104 304 3 HOH HOH A . B 2 HOH 105 305 64 HOH HOH A . B 2 HOH 106 306 15 HOH HOH A . B 2 HOH 107 307 102 HOH HOH A . B 2 HOH 108 308 93 HOH HOH A . B 2 HOH 109 309 200 HOH HOH A . B 2 HOH 110 310 167 HOH HOH A . B 2 HOH 111 311 126 HOH HOH A . B 2 HOH 112 312 88 HOH HOH A . B 2 HOH 113 313 210 HOH HOH A . B 2 HOH 114 314 66 HOH HOH A . B 2 HOH 115 315 148 HOH HOH A . B 2 HOH 116 316 48 HOH HOH A . B 2 HOH 117 317 97 HOH HOH A . B 2 HOH 118 318 144 HOH HOH A . B 2 HOH 119 319 118 HOH HOH A . B 2 HOH 120 320 106 HOH HOH A . B 2 HOH 121 321 91 HOH HOH A . B 2 HOH 122 322 116 HOH HOH A . B 2 HOH 123 323 189 HOH HOH A . B 2 HOH 124 324 81 HOH HOH A . B 2 HOH 125 325 56 HOH HOH A . B 2 HOH 126 326 131 HOH HOH A . B 2 HOH 127 327 115 HOH HOH A . B 2 HOH 128 328 80 HOH HOH A . B 2 HOH 129 329 82 HOH HOH A . B 2 HOH 130 330 149 HOH HOH A . B 2 HOH 131 331 143 HOH HOH A . B 2 HOH 132 332 197 HOH HOH A . B 2 HOH 133 333 94 HOH HOH A . B 2 HOH 134 334 87 HOH HOH A . B 2 HOH 135 335 164 HOH HOH A . B 2 HOH 136 336 120 HOH HOH A . B 2 HOH 137 337 166 HOH HOH A . B 2 HOH 138 338 42 HOH HOH A . B 2 HOH 139 339 172 HOH HOH A . B 2 HOH 140 340 153 HOH HOH A . B 2 HOH 141 341 150 HOH HOH A . B 2 HOH 142 342 77 HOH HOH A . B 2 HOH 143 343 101 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5HBO _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.683 _cell.length_a_esd ? _cell.length_b 43.683 _cell.length_b_esd ? _cell.length_c 52.417 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 3 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HBO _symmetry.cell_setting ? _symmetry.Int_Tables_number 144 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HBO _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M sodium acetate in 0.1 M Tris HCl pH 8.5, and 30% PEG 4000.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-03 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.127 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.127 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HBO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.66 _reflns.d_resolution_low 37.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13034 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 0.197 _reflns_shell.d_res_high 1.66 _reflns_shell.d_res_low 1.75 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 6.6 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 4.2 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 91.3 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.aniso_B[1][1] -0.14 _refine.aniso_B[1][2] -0.07 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.14 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.46 _refine.B_iso_max ? _refine.B_iso_mean 17.659 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.951 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HBO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.66 _refine.ls_d_res_low 37.8 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12378 _refine.ls_number_reflns_R_free 643 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.56 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17663 _refine.ls_R_factor_R_free 0.19858 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17556 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5HBL _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.103 _refine.pdbx_overall_ESU_R_Free 0.096 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.771 _refine.overall_SU_ML 0.060 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 787 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 143 _refine_hist.number_atoms_total 933 _refine_hist.d_res_high 1.66 _refine_hist.d_res_low 37.8 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.019 889 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 879 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.323 1.977 1219 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.981 3.003 2040 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.922 5.000 125 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.008 25.238 42 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.616 15.000 162 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.688 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.071 0.200 138 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 1033 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 189 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.787 1.597 445 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.783 1.594 443 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.366 2.384 562 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.365 2.387 563 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.945 1.730 444 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.944 1.730 445 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.546 2.543 649 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.570 14.204 1126 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.109 13.189 1052 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.660 _refine_ls_shell.d_res_low 1.703 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 782 _refine_ls_shell.percent_reflns_obs 83.79 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.347 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5HBO _struct.title 'Native rhodanese domain of YgaP prepared without DDT is both S-nitrosylated and S-sulfhydrated' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HBO _struct_keywords.text 'S-nitrosylation, S-sulfhydration. rhodanese, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YGAP_ECOLI _struct_ref.pdbx_db_accession P55734 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIA APAEIFLLEDGIDGWKKAGLPVAVNKSQ ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HBO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 127 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55734 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HBO MET A 1 ? UNP P55734 ? ? 'initiating methionine' -18 1 1 5HBO LYS A 2 ? UNP P55734 ? ? 'expression tag' -17 2 1 5HBO SER A 3 ? UNP P55734 ? ? 'expression tag' -16 3 1 5HBO SER A 4 ? UNP P55734 ? ? 'expression tag' -15 4 1 5HBO HIS A 5 ? UNP P55734 ? ? 'expression tag' -14 5 1 5HBO HIS A 6 ? UNP P55734 ? ? 'expression tag' -13 6 1 5HBO HIS A 7 ? UNP P55734 ? ? 'expression tag' -12 7 1 5HBO HIS A 8 ? UNP P55734 ? ? 'expression tag' -11 8 1 5HBO HIS A 9 ? UNP P55734 ? ? 'expression tag' -10 9 1 5HBO HIS A 10 ? UNP P55734 ? ? 'expression tag' -9 10 1 5HBO GLU A 11 ? UNP P55734 ? ? 'expression tag' -8 11 1 5HBO ASN A 12 ? UNP P55734 ? ? 'expression tag' -7 12 1 5HBO LEU A 13 ? UNP P55734 ? ? 'expression tag' -6 13 1 5HBO TYR A 14 ? UNP P55734 ? ? 'expression tag' -5 14 1 5HBO PHE A 15 ? UNP P55734 ? ? 'expression tag' -4 15 1 5HBO GLN A 16 ? UNP P55734 ? ? 'expression tag' -3 16 1 5HBO SER A 17 ? UNP P55734 ? ? 'expression tag' -2 17 1 5HBO ASN A 18 ? UNP P55734 ? ? 'expression tag' -1 18 1 5HBO ALA A 19 ? UNP P55734 ? ? 'expression tag' 0 19 1 5HBO SNC A 82 ? UNP P55734 CYS 64 'microheterogeneity/modified residue' 63 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 25 ? ALA A 34 ? SER A 6 ALA A 15 1 ? 10 HELX_P HELX_P2 AA2 ASP A 44 ? ARG A 50 ? ASP A 25 ARG A 31 1 ? 7 HELX_P HELX_P3 AA3 PRO A 60 ? GLY A 68 ? PRO A 41 GLY A 49 1 ? 9 HELX_P HELX_P4 AA4 PRO A 70 ? ARG A 74 ? PRO A 51 ARG A 55 5 ? 5 HELX_P HELX_P5 AA5 GLY A 85 ? ASN A 91 ? GLY A 66 ASN A 72 1 ? 7 HELX_P HELX_P6 AA6 ASN A 91 ? ALA A 99 ? ASN A 72 ALA A 80 1 ? 9 HELX_P HELX_P7 AA7 ASP A 109 ? ALA A 117 ? ASP A 90 ALA A 98 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A HIS 81 C ? ? ? 1_555 A SNC 82 N A ? A HIS 62 A SNC 63 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? A HIS 81 C ? ? ? 1_555 A CSS 82 N B ? A HIS 62 A CSS 63 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A HIS 81 C ? ? ? 1_555 A CSS 82 N C ? A HIS 62 A CSS 63 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale4 covale both ? A SNC 82 C A ? ? 1_555 A GLN 83 N ? ? A SNC 63 A GLN 64 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale5 covale both ? A CSS 82 C B ? ? 1_555 A GLN 83 N ? ? A CSS 63 A GLN 64 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale6 covale both ? A CSS 82 C C ? ? 1_555 A GLN 83 N ? ? A CSS 63 A GLN 64 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 SNC A 82 A . . . . SNC A 63 ? 1_555 . . . . . . . CYS 1 SNC Nitrosylation 'Named protein modification' 2 CSS A 82 B . . . . CSS A 63 ? 1_555 . . . . . . . CYS 1 CSS Sulfhydration 'Named protein modification' 3 CSS A 82 C . . . . CSS A 63 ? 1_555 . . . . . . . CYS 1 CSS Sulfhydration 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 100 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 81 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 101 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 82 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.28 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 23 ? ILE A 24 ? THR A 4 ILE A 5 AA1 2 GLU A 103 ? LEU A 107 ? GLU A 84 LEU A 88 AA1 3 GLN A 77 ? HIS A 81 ? GLN A 58 HIS A 62 AA1 4 LYS A 38 ? ASP A 41 ? LYS A 19 ASP A 22 AA1 5 ASP A 57 ? LEU A 58 ? ASP A 38 LEU A 39 AA2 1 GLU A 51 ? HIS A 52 ? GLU A 32 HIS A 33 AA2 2 ALA A 122 ? VAL A 123 ? ALA A 103 VAL A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 24 ? N ILE A 5 O LEU A 106 ? O LEU A 87 AA1 2 3 O LEU A 107 ? O LEU A 88 N PHE A 80 ? N PHE A 61 AA1 3 4 O ILE A 79 ? O ILE A 60 N ILE A 40 ? N ILE A 21 AA1 4 5 N LEU A 39 ? N LEU A 20 O ASP A 57 ? O ASP A 38 AA2 1 2 N HIS A 52 ? N HIS A 33 O ALA A 122 ? O ALA A 103 # _pdbx_entry_details.entry_id 5HBO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SNC A 63 ? A -135.77 -149.26 2 1 CSS A 63 ? B -134.39 -147.25 3 1 CSS A 63 ? C -135.72 -153.54 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SNC _pdbx_struct_mod_residue.label_seq_id 82 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SNC _pdbx_struct_mod_residue.auth_seq_id 63 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -18 ? A MET 1 2 1 Y 1 A LYS -17 ? A LYS 2 3 1 Y 1 A SER -16 ? A SER 3 4 1 Y 1 A SER -15 ? A SER 4 5 1 Y 1 A HIS -14 ? A HIS 5 6 1 Y 1 A HIS -13 ? A HIS 6 7 1 Y 1 A HIS -12 ? A HIS 7 8 1 Y 1 A HIS -11 ? A HIS 8 9 1 Y 1 A HIS -10 ? A HIS 9 10 1 Y 1 A HIS -9 ? A HIS 10 11 1 Y 1 A GLU -8 ? A GLU 11 12 1 Y 1 A ASN -7 ? A ASN 12 13 1 Y 1 A LEU -6 ? A LEU 13 14 1 Y 1 A TYR -5 ? A TYR 14 15 1 Y 1 A PHE -4 ? A PHE 15 16 1 Y 1 A GLN -3 ? A GLN 16 17 1 Y 1 A SER -2 ? A SER 17 18 1 Y 1 A ASN -1 ? A ASN 18 19 1 Y 1 A ALA 0 ? A ALA 19 20 1 Y 1 A ALA 1 ? A ALA 20 21 1 Y 1 A LEU 2 ? A LEU 21 22 1 Y 1 A LYS 106 ? A LYS 125 23 1 Y 1 A SER 107 ? A SER 126 24 1 Y 1 A GLN 108 ? A GLN 127 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSS N N N N 74 CSS CA C N R 75 CSS CB C N N 76 CSS SG S N N 77 CSS SD S N N 78 CSS C C N N 79 CSS O O N N 80 CSS OXT O N N 81 CSS H H N N 82 CSS H2 H N N 83 CSS HA H N N 84 CSS HB2 H N N 85 CSS HB3 H N N 86 CSS HD H N N 87 CSS HXT H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PHE N N N N 265 PHE CA C N S 266 PHE C C N N 267 PHE O O N N 268 PHE CB C N N 269 PHE CG C Y N 270 PHE CD1 C Y N 271 PHE CD2 C Y N 272 PHE CE1 C Y N 273 PHE CE2 C Y N 274 PHE CZ C Y N 275 PHE OXT O N N 276 PHE H H N N 277 PHE H2 H N N 278 PHE HA H N N 279 PHE HB2 H N N 280 PHE HB3 H N N 281 PHE HD1 H N N 282 PHE HD2 H N N 283 PHE HE1 H N N 284 PHE HE2 H N N 285 PHE HZ H N N 286 PHE HXT H N N 287 PRO N N N N 288 PRO CA C N S 289 PRO C C N N 290 PRO O O N N 291 PRO CB C N N 292 PRO CG C N N 293 PRO CD C N N 294 PRO OXT O N N 295 PRO H H N N 296 PRO HA H N N 297 PRO HB2 H N N 298 PRO HB3 H N N 299 PRO HG2 H N N 300 PRO HG3 H N N 301 PRO HD2 H N N 302 PRO HD3 H N N 303 PRO HXT H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 SNC N N N N 319 SNC CA C N R 320 SNC CB C N N 321 SNC SG S N N 322 SNC ND N N N 323 SNC OE O N N 324 SNC C C N N 325 SNC O O N N 326 SNC OXT O N N 327 SNC H H N N 328 SNC H2 H N N 329 SNC HA H N N 330 SNC HB2 H N N 331 SNC HB3 H N N 332 SNC HXT H N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 VAL N N N N 402 VAL CA C N S 403 VAL C C N N 404 VAL O O N N 405 VAL CB C N N 406 VAL CG1 C N N 407 VAL CG2 C N N 408 VAL OXT O N N 409 VAL H H N N 410 VAL H2 H N N 411 VAL HA H N N 412 VAL HB H N N 413 VAL HG11 H N N 414 VAL HG12 H N N 415 VAL HG13 H N N 416 VAL HG21 H N N 417 VAL HG22 H N N 418 VAL HG23 H N N 419 VAL HXT H N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSS N CA sing N N 70 CSS N H sing N N 71 CSS N H2 sing N N 72 CSS CA CB sing N N 73 CSS CA C sing N N 74 CSS CA HA sing N N 75 CSS CB SG sing N N 76 CSS CB HB2 sing N N 77 CSS CB HB3 sing N N 78 CSS SG SD sing N N 79 CSS SD HD sing N N 80 CSS C O doub N N 81 CSS C OXT sing N N 82 CSS OXT HXT sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 GLN N CA sing N N 97 GLN N H sing N N 98 GLN N H2 sing N N 99 GLN CA C sing N N 100 GLN CA CB sing N N 101 GLN CA HA sing N N 102 GLN C O doub N N 103 GLN C OXT sing N N 104 GLN CB CG sing N N 105 GLN CB HB2 sing N N 106 GLN CB HB3 sing N N 107 GLN CG CD sing N N 108 GLN CG HG2 sing N N 109 GLN CG HG3 sing N N 110 GLN CD OE1 doub N N 111 GLN CD NE2 sing N N 112 GLN NE2 HE21 sing N N 113 GLN NE2 HE22 sing N N 114 GLN OXT HXT sing N N 115 GLU N CA sing N N 116 GLU N H sing N N 117 GLU N H2 sing N N 118 GLU CA C sing N N 119 GLU CA CB sing N N 120 GLU CA HA sing N N 121 GLU C O doub N N 122 GLU C OXT sing N N 123 GLU CB CG sing N N 124 GLU CB HB2 sing N N 125 GLU CB HB3 sing N N 126 GLU CG CD sing N N 127 GLU CG HG2 sing N N 128 GLU CG HG3 sing N N 129 GLU CD OE1 doub N N 130 GLU CD OE2 sing N N 131 GLU OE2 HE2 sing N N 132 GLU OXT HXT sing N N 133 GLY N CA sing N N 134 GLY N H sing N N 135 GLY N H2 sing N N 136 GLY CA C sing N N 137 GLY CA HA2 sing N N 138 GLY CA HA3 sing N N 139 GLY C O doub N N 140 GLY C OXT sing N N 141 GLY OXT HXT sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 ILE N CA sing N N 166 ILE N H sing N N 167 ILE N H2 sing N N 168 ILE CA C sing N N 169 ILE CA CB sing N N 170 ILE CA HA sing N N 171 ILE C O doub N N 172 ILE C OXT sing N N 173 ILE CB CG1 sing N N 174 ILE CB CG2 sing N N 175 ILE CB HB sing N N 176 ILE CG1 CD1 sing N N 177 ILE CG1 HG12 sing N N 178 ILE CG1 HG13 sing N N 179 ILE CG2 HG21 sing N N 180 ILE CG2 HG22 sing N N 181 ILE CG2 HG23 sing N N 182 ILE CD1 HD11 sing N N 183 ILE CD1 HD12 sing N N 184 ILE CD1 HD13 sing N N 185 ILE OXT HXT sing N N 186 LEU N CA sing N N 187 LEU N H sing N N 188 LEU N H2 sing N N 189 LEU CA C sing N N 190 LEU CA CB sing N N 191 LEU CA HA sing N N 192 LEU C O doub N N 193 LEU C OXT sing N N 194 LEU CB CG sing N N 195 LEU CB HB2 sing N N 196 LEU CB HB3 sing N N 197 LEU CG CD1 sing N N 198 LEU CG CD2 sing N N 199 LEU CG HG sing N N 200 LEU CD1 HD11 sing N N 201 LEU CD1 HD12 sing N N 202 LEU CD1 HD13 sing N N 203 LEU CD2 HD21 sing N N 204 LEU CD2 HD22 sing N N 205 LEU CD2 HD23 sing N N 206 LEU OXT HXT sing N N 207 LYS N CA sing N N 208 LYS N H sing N N 209 LYS N H2 sing N N 210 LYS CA C sing N N 211 LYS CA CB sing N N 212 LYS CA HA sing N N 213 LYS C O doub N N 214 LYS C OXT sing N N 215 LYS CB CG sing N N 216 LYS CB HB2 sing N N 217 LYS CB HB3 sing N N 218 LYS CG CD sing N N 219 LYS CG HG2 sing N N 220 LYS CG HG3 sing N N 221 LYS CD CE sing N N 222 LYS CD HD2 sing N N 223 LYS CD HD3 sing N N 224 LYS CE NZ sing N N 225 LYS CE HE2 sing N N 226 LYS CE HE3 sing N N 227 LYS NZ HZ1 sing N N 228 LYS NZ HZ2 sing N N 229 LYS NZ HZ3 sing N N 230 LYS OXT HXT sing N N 231 MET N CA sing N N 232 MET N H sing N N 233 MET N H2 sing N N 234 MET CA C sing N N 235 MET CA CB sing N N 236 MET CA HA sing N N 237 MET C O doub N N 238 MET C OXT sing N N 239 MET CB CG sing N N 240 MET CB HB2 sing N N 241 MET CB HB3 sing N N 242 MET CG SD sing N N 243 MET CG HG2 sing N N 244 MET CG HG3 sing N N 245 MET SD CE sing N N 246 MET CE HE1 sing N N 247 MET CE HE2 sing N N 248 MET CE HE3 sing N N 249 MET OXT HXT sing N N 250 PHE N CA sing N N 251 PHE N H sing N N 252 PHE N H2 sing N N 253 PHE CA C sing N N 254 PHE CA CB sing N N 255 PHE CA HA sing N N 256 PHE C O doub N N 257 PHE C OXT sing N N 258 PHE CB CG sing N N 259 PHE CB HB2 sing N N 260 PHE CB HB3 sing N N 261 PHE CG CD1 doub Y N 262 PHE CG CD2 sing Y N 263 PHE CD1 CE1 sing Y N 264 PHE CD1 HD1 sing N N 265 PHE CD2 CE2 doub Y N 266 PHE CD2 HD2 sing N N 267 PHE CE1 CZ doub Y N 268 PHE CE1 HE1 sing N N 269 PHE CE2 CZ sing Y N 270 PHE CE2 HE2 sing N N 271 PHE CZ HZ sing N N 272 PHE OXT HXT sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SER N CA sing N N 291 SER N H sing N N 292 SER N H2 sing N N 293 SER CA C sing N N 294 SER CA CB sing N N 295 SER CA HA sing N N 296 SER C O doub N N 297 SER C OXT sing N N 298 SER CB OG sing N N 299 SER CB HB2 sing N N 300 SER CB HB3 sing N N 301 SER OG HG sing N N 302 SER OXT HXT sing N N 303 SNC N CA sing N N 304 SNC N H sing N N 305 SNC N H2 sing N N 306 SNC CA CB sing N N 307 SNC CA C sing N N 308 SNC CA HA sing N N 309 SNC CB SG sing N N 310 SNC CB HB2 sing N N 311 SNC CB HB3 sing N N 312 SNC SG ND sing N N 313 SNC ND OE doub N N 314 SNC C O doub N N 315 SNC C OXT sing N N 316 SNC OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5HBL _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5HBO _atom_sites.fract_transf_matrix[1][1] 0.022892 _atom_sites.fract_transf_matrix[1][2] 0.013217 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026434 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019078 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_