data_5HCK # _entry.id 5HCK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HCK WWPDB D_1000179722 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4HCK _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5HCK _pdbx_database_status.recvd_initial_deposition_date 1998-03-09 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Horita, D.A.' 1 'Baldisseri, D.M.' 2 'Zhang, W.' 3 'Altieri, A.S.' 4 'Smithgall, T.E.' 5 'Gmeiner, W.H.' 6 'Byrd, R.A.' 7 # _citation.id primary _citation.title 'Solution structure of the human Hck SH3 domain and identification of its ligand binding site.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 278 _citation.page_first 253 _citation.page_last 265 _citation.year 1998 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9571048 _citation.pdbx_database_id_DOI 10.1006/jmbi.1998.1690 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Horita, D.A.' 1 primary 'Baldisseri, D.M.' 2 primary 'Zhang, W.' 3 primary 'Altieri, A.S.' 4 primary 'Smithgall, T.E.' 5 primary 'Gmeiner, W.H.' 6 primary 'Byrd, R.A.' 7 # _cell.entry_id 5HCK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HCK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HEMATOPOIETIC CELL KINASE' _entity.formula_weight 8240.034 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.10.2 _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name HCK # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE _entity_poly.pdbx_seq_one_letter_code_can GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 ARG n 1 4 GLU n 1 5 ALA n 1 6 GLY n 1 7 SER n 1 8 GLU n 1 9 ASP n 1 10 ILE n 1 11 ILE n 1 12 VAL n 1 13 VAL n 1 14 ALA n 1 15 LEU n 1 16 TYR n 1 17 ASP n 1 18 TYR n 1 19 GLU n 1 20 ALA n 1 21 ILE n 1 22 HIS n 1 23 HIS n 1 24 GLU n 1 25 ASP n 1 26 LEU n 1 27 SER n 1 28 PHE n 1 29 GLN n 1 30 LYS n 1 31 GLY n 1 32 ASP n 1 33 GLN n 1 34 MET n 1 35 VAL n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 GLU n 1 40 SER n 1 41 GLY n 1 42 GLU n 1 43 TRP n 1 44 TRP n 1 45 LYS n 1 46 ALA n 1 47 ARG n 1 48 SER n 1 49 LEU n 1 50 ALA n 1 51 THR n 1 52 ARG n 1 53 LYS n 1 54 GLU n 1 55 GLY n 1 56 TYR n 1 57 ILE n 1 58 PRO n 1 59 SER n 1 60 ASN n 1 61 TYR n 1 62 VAL n 1 63 ALA n 1 64 ARG n 1 65 VAL n 1 66 ASP n 1 67 SER n 1 68 LEU n 1 69 GLU n 1 70 THR n 1 71 GLU n 1 72 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RESIDUES G72-E143 OF HUMAN HCK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'RESIDUES G72-E143 OF HUMAN HCK' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-14B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HCK_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P08631 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGGRSSCEDPGCPRDEERAPRMGSMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSED IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLA PGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKL HAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADF GLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HCK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08631 _struct_ref_seq.db_align_beg 72 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 143 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 72 _struct_ref_seq.pdbx_auth_seq_align_end 143 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'SEE JRNL ARTICLE' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.25 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 UNITYPLUS Varian 500 ? 2 UNITYPLUS Varian 600 ? # _pdbx_nmr_refine.entry_id 5HCK _pdbx_nmr_refine.method 'DG, SA' _pdbx_nmr_refine.details 'PRESENTED ENSEMBLE WAS CALCULATED USING NOE/DIHEDRAL AND 1H AND 13C CHEMICAL SHIFT RESTRAINTS.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5HCK _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMIZED AVERAGE STRUCTURE' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.851 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 5HCK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 5HCK _struct.title 'HUMAN HCK SH3 DOMAIN, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_descriptor 'HEMATOPOIETIC CELL KINASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5HCK _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'SH3, PROTEIN TYROSINE KINASE, SIGNAL TRANSDUCTION, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 59 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 61 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 130 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 132 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 32 ? GLU A 38 ? ASP A 103 GLU A 109 A 2 ILE A 11 ? ALA A 14 ? ILE A 82 ALA A 85 A 3 VAL A 62 ? VAL A 65 ? VAL A 133 VAL A 136 B 1 TRP A 43 ? SER A 48 ? TRP A 114 SER A 119 B 2 LYS A 53 ? PRO A 58 ? LYS A 124 PRO A 129 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O MET A 34 ? O MET A 105 N VAL A 12 ? N VAL A 83 A 2 3 O ILE A 11 ? O ILE A 82 N VAL A 65 ? N VAL A 136 B 1 2 O TRP A 44 ? O TRP A 115 N ILE A 57 ? N ILE A 128 # _database_PDB_matrix.entry_id 5HCK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5HCK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 72 ? ? ? A . n A 1 2 ILE 2 73 ? ? ? A . n A 1 3 ARG 3 74 ? ? ? A . n A 1 4 GLU 4 75 ? ? ? A . n A 1 5 ALA 5 76 ? ? ? A . n A 1 6 GLY 6 77 ? ? ? A . n A 1 7 SER 7 78 78 SER SER A . n A 1 8 GLU 8 79 79 GLU GLU A . n A 1 9 ASP 9 80 80 ASP ASP A . n A 1 10 ILE 10 81 81 ILE ILE A . n A 1 11 ILE 11 82 82 ILE ILE A . n A 1 12 VAL 12 83 83 VAL VAL A . n A 1 13 VAL 13 84 84 VAL VAL A . n A 1 14 ALA 14 85 85 ALA ALA A . n A 1 15 LEU 15 86 86 LEU LEU A . n A 1 16 TYR 16 87 87 TYR TYR A . n A 1 17 ASP 17 88 88 ASP ASP A . n A 1 18 TYR 18 89 89 TYR TYR A . n A 1 19 GLU 19 90 90 GLU GLU A . n A 1 20 ALA 20 91 91 ALA ALA A . n A 1 21 ILE 21 92 92 ILE ILE A . n A 1 22 HIS 22 93 93 HIS HIS A . n A 1 23 HIS 23 94 94 HIS HIS A . n A 1 24 GLU 24 95 95 GLU GLU A . n A 1 25 ASP 25 96 96 ASP ASP A . n A 1 26 LEU 26 97 97 LEU LEU A . n A 1 27 SER 27 98 98 SER SER A . n A 1 28 PHE 28 99 99 PHE PHE A . n A 1 29 GLN 29 100 100 GLN GLN A . n A 1 30 LYS 30 101 101 LYS LYS A . n A 1 31 GLY 31 102 102 GLY GLY A . n A 1 32 ASP 32 103 103 ASP ASP A . n A 1 33 GLN 33 104 104 GLN GLN A . n A 1 34 MET 34 105 105 MET MET A . n A 1 35 VAL 35 106 106 VAL VAL A . n A 1 36 VAL 36 107 107 VAL VAL A . n A 1 37 LEU 37 108 108 LEU LEU A . n A 1 38 GLU 38 109 109 GLU GLU A . n A 1 39 GLU 39 110 110 GLU GLU A . n A 1 40 SER 40 111 111 SER SER A . n A 1 41 GLY 41 112 112 GLY GLY A . n A 1 42 GLU 42 113 113 GLU GLU A . n A 1 43 TRP 43 114 114 TRP TRP A . n A 1 44 TRP 44 115 115 TRP TRP A . n A 1 45 LYS 45 116 116 LYS LYS A . n A 1 46 ALA 46 117 117 ALA ALA A . n A 1 47 ARG 47 118 118 ARG ARG A . n A 1 48 SER 48 119 119 SER SER A . n A 1 49 LEU 49 120 120 LEU LEU A . n A 1 50 ALA 50 121 121 ALA ALA A . n A 1 51 THR 51 122 122 THR THR A . n A 1 52 ARG 52 123 123 ARG ARG A . n A 1 53 LYS 53 124 124 LYS LYS A . n A 1 54 GLU 54 125 125 GLU GLU A . n A 1 55 GLY 55 126 126 GLY GLY A . n A 1 56 TYR 56 127 127 TYR TYR A . n A 1 57 ILE 57 128 128 ILE ILE A . n A 1 58 PRO 58 129 129 PRO PRO A . n A 1 59 SER 59 130 130 SER SER A . n A 1 60 ASN 60 131 131 ASN ASN A . n A 1 61 TYR 61 132 132 TYR TYR A . n A 1 62 VAL 62 133 133 VAL VAL A . n A 1 63 ALA 63 134 134 ALA ALA A . n A 1 64 ARG 64 135 135 ARG ARG A . n A 1 65 VAL 65 136 136 VAL VAL A . n A 1 66 ASP 66 137 137 ASP ASP A . n A 1 67 SER 67 138 138 SER SER A . n A 1 68 LEU 68 139 ? ? ? A . n A 1 69 GLU 69 140 ? ? ? A . n A 1 70 THR 70 141 ? ? ? A . n A 1 71 GLU 71 142 ? ? ? A . n A 1 72 GLU 72 143 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.851 ? 1 X-PLOR refinement 3.851 ? 2 X-PLOR phasing 3.851 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 92 ? ? -140.82 -57.16 2 1 HIS A 93 ? ? -79.11 -167.58 3 1 HIS A 94 ? ? -66.55 -77.09 4 1 SER A 111 ? ? -110.00 -73.42 5 1 THR A 122 ? ? -140.49 12.99 6 1 ASP A 137 ? ? -113.64 68.49 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 72 ? A GLY 1 2 1 Y 1 A ILE 73 ? A ILE 2 3 1 Y 1 A ARG 74 ? A ARG 3 4 1 Y 1 A GLU 75 ? A GLU 4 5 1 Y 1 A ALA 76 ? A ALA 5 6 1 Y 1 A GLY 77 ? A GLY 6 7 1 Y 1 A LEU 139 ? A LEU 68 8 1 Y 1 A GLU 140 ? A GLU 69 9 1 Y 1 A THR 141 ? A THR 70 10 1 Y 1 A GLU 142 ? A GLU 71 11 1 Y 1 A GLU 143 ? A GLU 72 #