data_5HG9 # _entry.id 5HG9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HG9 WWPDB D_1000216989 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5HG7 unspecified PDB . 5HG5 unspecified PDB . 5HG8 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HG9 _pdbx_database_status.recvd_initial_deposition_date 2016-01-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Gajiwala, K.S.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 2005 _citation.page_last 2024 _citation.title ;Discovery of 1-{(3R,4R)-3-[({5-Chloro-2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-methoxypyrrolidin-1-yl}prop-2-en-1-one (PF-06459988), a Potent, WT Sparing, Irreversible Inhibitor of T790M-Containing EGFR Mutants. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5b01633 _citation.pdbx_database_id_PubMed 26756222 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cheng, H.' 1 primary 'Nair, S.K.' 2 primary 'Murray, B.W.' 3 primary 'Almaden, C.' 4 primary 'Bailey, S.' 5 primary 'Baxi, S.' 6 primary 'Behenna, D.' 7 primary 'Cho-Schultz, S.' 8 primary 'Dalvie, D.' 9 primary 'Dinh, D.M.' 10 primary 'Edwards, M.P.' 11 primary 'Feng, J.L.' 12 primary 'Ferre, R.A.' 13 primary 'Gajiwala, K.S.' 14 primary 'Hemkens, M.D.' 15 primary 'Jackson-Fisher, A.' 16 primary 'Jalaie, M.' 17 primary 'Johnson, T.O.' 18 primary 'Kania, R.S.' 19 primary 'Kephart, S.' 20 primary 'Lafontaine, J.' 21 primary 'Lunney, B.' 22 primary 'Liu, K.K.' 23 primary 'Liu, Z.' 24 primary 'Matthews, J.' 25 primary 'Nagata, A.' 26 primary 'Niessen, S.' 27 primary 'Ornelas, M.A.' 28 primary 'Orr, S.T.' 29 primary 'Pairish, M.' 30 primary 'Planken, S.' 31 primary 'Ren, S.' 32 primary 'Richter, D.' 33 primary 'Ryan, K.' 34 primary 'Sach, N.' 35 primary 'Shen, H.' 36 primary 'Smeal, T.' 37 primary 'Solowiej, J.' 38 primary 'Sutton, S.' 39 primary 'Tran, K.' 40 primary 'Tseng, E.' 41 primary 'Vernier, W.' 42 primary 'Walls, M.' 43 primary 'Wang, S.' 44 primary 'Weinrich, S.L.' 45 primary 'Xin, S.' 46 primary 'Xu, H.' 47 primary 'Yin, M.J.' 48 primary 'Zientek, M.' 49 primary 'Zhou, R.' 50 primary 'Kath, J.C.' 51 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5HG9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.205 _cell.length_a_esd ? _cell.length_b 69.879 _cell.length_b_esd ? _cell.length_c 113.554 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HG9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37580.453 1 2.7.10.1 'L858R, T790M, V948R' 'UNP residues 695-1022' ? 2 non-polymer syn ;1-[(3R,4R)-3-[({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-(trifluoromethyl)pyrrolidin-1-yl]propan-1-one ; 437.419 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 5 water nat water 18.015 136 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH VCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL PQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA DEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH VCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL PQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA DEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 GLU n 1 5 ALA n 1 6 PRO n 1 7 ASN n 1 8 GLN n 1 9 ALA n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 LEU n 1 15 LYS n 1 16 GLU n 1 17 THR n 1 18 GLU n 1 19 PHE n 1 20 LYS n 1 21 LYS n 1 22 ILE n 1 23 LYS n 1 24 VAL n 1 25 LEU n 1 26 GLY n 1 27 SER n 1 28 GLY n 1 29 ALA n 1 30 PHE n 1 31 GLY n 1 32 THR n 1 33 VAL n 1 34 TYR n 1 35 LYS n 1 36 GLY n 1 37 LEU n 1 38 TRP n 1 39 ILE n 1 40 PRO n 1 41 GLU n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 VAL n 1 46 LYS n 1 47 ILE n 1 48 PRO n 1 49 VAL n 1 50 ALA n 1 51 ILE n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 ARG n 1 56 GLU n 1 57 ALA n 1 58 THR n 1 59 SER n 1 60 PRO n 1 61 LYS n 1 62 ALA n 1 63 ASN n 1 64 LYS n 1 65 GLU n 1 66 ILE n 1 67 LEU n 1 68 ASP n 1 69 GLU n 1 70 ALA n 1 71 TYR n 1 72 VAL n 1 73 MET n 1 74 ALA n 1 75 SER n 1 76 VAL n 1 77 ASP n 1 78 ASN n 1 79 PRO n 1 80 HIS n 1 81 VAL n 1 82 CYS n 1 83 ARG n 1 84 LEU n 1 85 LEU n 1 86 GLY n 1 87 ILE n 1 88 CYS n 1 89 LEU n 1 90 THR n 1 91 SER n 1 92 THR n 1 93 VAL n 1 94 GLN n 1 95 LEU n 1 96 ILE n 1 97 MET n 1 98 GLN n 1 99 LEU n 1 100 MET n 1 101 PRO n 1 102 PHE n 1 103 GLY n 1 104 CYS n 1 105 LEU n 1 106 LEU n 1 107 ASP n 1 108 TYR n 1 109 VAL n 1 110 ARG n 1 111 GLU n 1 112 HIS n 1 113 LYS n 1 114 ASP n 1 115 ASN n 1 116 ILE n 1 117 GLY n 1 118 SER n 1 119 GLN n 1 120 TYR n 1 121 LEU n 1 122 LEU n 1 123 ASN n 1 124 TRP n 1 125 CYS n 1 126 VAL n 1 127 GLN n 1 128 ILE n 1 129 ALA n 1 130 LYS n 1 131 GLY n 1 132 MET n 1 133 ASN n 1 134 TYR n 1 135 LEU n 1 136 GLU n 1 137 ASP n 1 138 ARG n 1 139 ARG n 1 140 LEU n 1 141 VAL n 1 142 HIS n 1 143 ARG n 1 144 ASP n 1 145 LEU n 1 146 ALA n 1 147 ALA n 1 148 ARG n 1 149 ASN n 1 150 VAL n 1 151 LEU n 1 152 VAL n 1 153 LYS n 1 154 THR n 1 155 PRO n 1 156 GLN n 1 157 HIS n 1 158 VAL n 1 159 LYS n 1 160 ILE n 1 161 THR n 1 162 ASP n 1 163 PHE n 1 164 GLY n 1 165 ARG n 1 166 ALA n 1 167 LYS n 1 168 LEU n 1 169 LEU n 1 170 GLY n 1 171 ALA n 1 172 GLU n 1 173 GLU n 1 174 LYS n 1 175 GLU n 1 176 TYR n 1 177 HIS n 1 178 ALA n 1 179 GLU n 1 180 GLY n 1 181 GLY n 1 182 LYS n 1 183 VAL n 1 184 PRO n 1 185 ILE n 1 186 LYS n 1 187 TRP n 1 188 MET n 1 189 ALA n 1 190 LEU n 1 191 GLU n 1 192 SER n 1 193 ILE n 1 194 LEU n 1 195 HIS n 1 196 ARG n 1 197 ILE n 1 198 TYR n 1 199 THR n 1 200 HIS n 1 201 GLN n 1 202 SER n 1 203 ASP n 1 204 VAL n 1 205 TRP n 1 206 SER n 1 207 TYR n 1 208 GLY n 1 209 VAL n 1 210 THR n 1 211 VAL n 1 212 TRP n 1 213 GLU n 1 214 LEU n 1 215 MET n 1 216 THR n 1 217 PHE n 1 218 GLY n 1 219 SER n 1 220 LYS n 1 221 PRO n 1 222 TYR n 1 223 ASP n 1 224 GLY n 1 225 ILE n 1 226 PRO n 1 227 ALA n 1 228 SER n 1 229 GLU n 1 230 ILE n 1 231 SER n 1 232 SER n 1 233 ILE n 1 234 LEU n 1 235 GLU n 1 236 LYS n 1 237 GLY n 1 238 GLU n 1 239 ARG n 1 240 LEU n 1 241 PRO n 1 242 GLN n 1 243 PRO n 1 244 PRO n 1 245 ILE n 1 246 CYS n 1 247 THR n 1 248 ILE n 1 249 ASP n 1 250 VAL n 1 251 TYR n 1 252 MET n 1 253 ILE n 1 254 MET n 1 255 ARG n 1 256 LYS n 1 257 CYS n 1 258 TRP n 1 259 MET n 1 260 ILE n 1 261 ASP n 1 262 ALA n 1 263 ASP n 1 264 SER n 1 265 ARG n 1 266 PRO n 1 267 LYS n 1 268 PHE n 1 269 ARG n 1 270 GLU n 1 271 LEU n 1 272 ILE n 1 273 ILE n 1 274 GLU n 1 275 PHE n 1 276 SER n 1 277 LYS n 1 278 MET n 1 279 ALA n 1 280 ARG n 1 281 ASP n 1 282 PRO n 1 283 GLN n 1 284 ARG n 1 285 TYR n 1 286 LEU n 1 287 VAL n 1 288 ILE n 1 289 GLN n 1 290 GLY n 1 291 ASP n 1 292 GLU n 1 293 ARG n 1 294 MET n 1 295 HIS n 1 296 LEU n 1 297 PRO n 1 298 SER n 1 299 PRO n 1 300 THR n 1 301 ASP n 1 302 SER n 1 303 ASN n 1 304 PHE n 1 305 TYR n 1 306 ARG n 1 307 ALA n 1 308 LEU n 1 309 MET n 1 310 ASP n 1 311 GLU n 1 312 GLU n 1 313 ASP n 1 314 MET n 1 315 ASP n 1 316 ASP n 1 317 VAL n 1 318 VAL n 1 319 ASP n 1 320 ALA n 1 321 ASP n 1 322 GLU n 1 323 TYR n 1 324 LEU n 1 325 ILE n 1 326 PRO n 1 327 GLN n 1 328 GLN n 1 329 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 329 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code EGFR_HUMAN _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _struct_ref.pdbx_align_begin 695 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HG9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 329 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 695 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 695 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HG9 GLY A 1 ? UNP P00533 ? ? 'expression tag' 694 1 1 5HG9 MET A 97 ? UNP P00533 THR 790 'engineered mutation' 790 2 1 5HG9 ARG A 165 ? UNP P00533 LEU 858 'engineered mutation' 858 3 1 5HG9 ARG A 255 ? UNP P00533 VAL 948 'engineered mutation' 948 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 63A non-polymer . ;1-[(3R,4R)-3-[({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-(trifluoromethyl)pyrrolidin-1-yl]propan-1-one ; ;Bound form of 1-[(3R,4R)-3-[({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-(trifluoromethyl)pyrrolidin-1-yl]prop-2-en-1-one ; 'C19 H22 F3 N7 O2' 437.419 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HG9 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 286 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M (2.5 uL of stock 4.0 M) Ammonium sulfate, 20.0 %w/v (20.0 uL of stock 50.0 %w/v) PEG 8000, 0.1 M (5.0 uL of stock 1.0 M) HEPES (pH 7.50), 10.4545454545 %v/v (5.2272727272 uL of stock 100.0 %v/v) iso-propanol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 98 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 16.8 _reflns.entry_id 5HG9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.15 _reflns.d_resolution_low 25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15819 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.158 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.488 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 4.35 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -1.04 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -3.32 _refine.B_iso_max ? _refine.B_iso_mean 29.9 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HG9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.15 _refine.ls_d_res_low 24.80 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all 15918 _refine.ls_number_reflns_obs 15775 _refine.ls_number_reflns_R_free 799 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.1 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.191 _refine.ls_R_factor_R_free 0.241 _refine.ls_R_factor_R_free_error 0.009 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.188 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_bsol 51.8417 _refine.solvent_model_param_ksol 0.379071 _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF 1293058.83 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5HG9 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free 0.28 _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_sigma_a_free 0.21 _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs 0.14 _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2347 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 136 _refine_hist.number_atoms_total 2511 _refine_hist.d_res_high 2.15 _refine_hist.d_res_low 24.80 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? ? ? c_bond_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_bond_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_bond_d_prot ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 0.8 ? ? ? c_angle_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_deg_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_deg_prot ? ? 'X-RAY DIFFRACTION' ? 19.2 ? ? ? c_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_dihedral_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_dihedral_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 0.58 ? ? ? c_improper_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_improper_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_improper_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 1.40 1.50 ? ? c_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.21 2.00 ? ? c_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.17 2.00 ? ? c_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.10 2.50 ? ? c_scangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.15 _refine_ls_shell.d_res_low 2.28 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 128 _refine_ls_shell.number_reflns_R_work 2360 _refine_ls_shell.percent_reflns_obs 96.0 _refine_ls_shell.percent_reflns_R_free 5.1 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.254 _refine_ls_shell.R_factor_R_free_error 0.022 _refine_ls_shell.R_factor_R_work 0.203 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 5HG9 _pdbx_refine.R_factor_all_no_cutoff 0.285 _pdbx_refine.R_factor_obs_no_cutoff 0.287 _pdbx_refine.free_R_factor_no_cutoff 0.263 _pdbx_refine.free_R_error_no_cutoff 0.009 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5.1 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 804 _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 protein_rep-edited.param protein-edited.top 'X-RAY DIFFRACTION' 2 ACCELRYS_CNX:libraries/toppar/dna-rna_rep.para ACCELRYS_CNX:libraries/toppar/dna-rna.top 'X-RAY DIFFRACTION' 3 ACCELRYS_CNX:libraries/toppar/water_rep.param ACCELRYS_CNX:libraries/toppar/water.top 'X-RAY DIFFRACTION' 4 ACCELRYS_CNX:libraries/toppar/ion.param ACCELRYS_CNX:libraries/toppar/ion.top # _struct.entry_id 5HG9 _struct.title ;EGFR (L858R, T790M, V948R) in complex with 1-[(3R,4R)-3-[({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-(trifluoromethyl)pyrrolidin-1-yl]prop-2-en-1-one ; _struct.pdbx_descriptor 'Epidermal growth factor receptor (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HG9 _struct_keywords.text 'EGFR, Kinase, Inhibitor, Lung Cancer, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 15 ? THR A 17 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 ALA A 62 ? VAL A 76 ? ALA A 755 VAL A 769 1 ? 15 HELX_P HELX_P3 AA3 CYS A 104 ? LYS A 113 ? CYS A 797 LYS A 806 1 ? 10 HELX_P HELX_P4 AA4 GLY A 117 ? ARG A 138 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P5 AA5 ALA A 146 ? ARG A 148 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P6 AA6 PRO A 184 ? MET A 188 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P7 AA7 ALA A 189 ? ARG A 196 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P8 AA8 THR A 199 ? THR A 216 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P9 AA9 PRO A 226 ? SER A 228 ? PRO A 919 SER A 921 5 ? 3 HELX_P HELX_P10 AB1 GLU A 229 ? LYS A 236 ? GLU A 922 LYS A 929 1 ? 8 HELX_P HELX_P11 AB2 THR A 247 ? TRP A 258 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P12 AB3 ASP A 261 ? ARG A 265 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P13 AB4 LYS A 267 ? ALA A 279 ? LYS A 960 ALA A 972 1 ? 13 HELX_P HELX_P14 AB5 ARG A 280 ? TYR A 285 ? ARG A 973 TYR A 978 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 104 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 63A _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C12 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 797 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 63A _struct_conn.ptnr2_auth_seq_id 9001 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.808 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 291 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 984 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLU _struct_mon_prot_cis.pdbx_label_seq_id_2 292 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLU _struct_mon_prot_cis.pdbx_auth_seq_id_2 985 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 12 ? ILE A 13 ? ARG A 705 ILE A 706 AA1 2 LEU A 84 ? LEU A 89 ? LEU A 777 LEU A 782 AA1 3 VAL A 93 ? GLN A 98 ? VAL A 786 GLN A 791 AA1 4 ILE A 47 ? LEU A 54 ? ILE A 740 LEU A 747 AA1 5 GLY A 31 ? TRP A 38 ? GLY A 724 TRP A 731 AA1 6 PHE A 19 ? GLY A 28 ? PHE A 712 GLY A 721 AA2 1 LEU A 140 ? VAL A 141 ? LEU A 833 VAL A 834 AA2 2 LYS A 167 ? LEU A 168 ? LYS A 860 LEU A 861 AA3 1 VAL A 150 ? THR A 154 ? VAL A 843 THR A 847 AA3 2 HIS A 157 ? ILE A 160 ? HIS A 850 ILE A 853 AA4 1 TYR A 176 ? HIS A 177 ? TYR A 869 HIS A 870 AA4 2 ILE A 197 ? TYR A 198 ? ILE A 890 TYR A 891 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 12 ? N ARG A 705 O ILE A 87 ? O ILE A 780 AA1 2 3 N LEU A 85 ? N LEU A 778 O ILE A 96 ? O ILE A 789 AA1 3 4 O LEU A 95 ? O LEU A 788 N LYS A 52 ? N LYS A 745 AA1 4 5 O ILE A 51 ? O ILE A 744 N TYR A 34 ? N TYR A 727 AA1 5 6 O LYS A 35 ? O LYS A 728 N ILE A 22 ? N ILE A 715 AA2 1 2 N VAL A 141 ? N VAL A 834 O LYS A 167 ? O LYS A 860 AA3 1 2 N LEU A 151 ? N LEU A 844 O LYS A 159 ? O LYS A 852 AA4 1 2 N TYR A 176 ? N TYR A 869 O TYR A 198 ? O TYR A 891 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 63A 9001 ? 15 'binding site for residue 63A A 9001' AC2 Software A SO4 9002 ? 6 'binding site for residue SO4 A 9002' AC3 Software A SO4 9003 ? 4 'binding site for residue SO4 A 9003' AC4 Software A GOL 9004 ? 7 'binding site for residue GOL A 9004' AC5 Software A GOL 9005 ? 5 'binding site for residue GOL A 9005' AC6 Software A GOL 9006 ? 6 'binding site for residue GOL A 9006' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 LEU A 25 ? LEU A 718 . ? 1_555 ? 2 AC1 15 GLY A 26 ? GLY A 719 . ? 1_555 ? 3 AC1 15 SER A 27 ? SER A 720 . ? 1_555 ? 4 AC1 15 PHE A 30 ? PHE A 723 . ? 1_555 ? 5 AC1 15 VAL A 33 ? VAL A 726 . ? 1_555 ? 6 AC1 15 ALA A 50 ? ALA A 743 . ? 1_555 ? 7 AC1 15 GLN A 98 ? GLN A 791 . ? 1_555 ? 8 AC1 15 MET A 100 ? MET A 793 . ? 1_555 ? 9 AC1 15 PRO A 101 ? PRO A 794 . ? 1_555 ? 10 AC1 15 GLY A 103 ? GLY A 796 . ? 1_555 ? 11 AC1 15 CYS A 104 ? CYS A 797 . ? 1_555 ? 12 AC1 15 ASP A 107 ? ASP A 800 . ? 1_555 ? 13 AC1 15 ARG A 148 ? ARG A 841 . ? 1_555 ? 14 AC1 15 LEU A 151 ? LEU A 844 . ? 1_555 ? 15 AC1 15 PHE A 163 ? PHE A 856 . ? 1_555 ? 16 AC2 6 ARG A 143 ? ARG A 836 . ? 1_555 ? 17 AC2 6 TYR A 176 ? TYR A 869 . ? 1_555 ? 18 AC2 6 ALA A 178 ? ALA A 871 . ? 1_555 ? 19 AC2 6 GLU A 179 ? GLU A 872 . ? 1_555 ? 20 AC2 6 GLY A 180 ? GLY A 873 . ? 1_555 ? 21 AC2 6 GLY A 181 ? GLY A 874 . ? 1_555 ? 22 AC3 4 ARG A 110 ? ARG A 803 . ? 1_555 ? 23 AC3 4 LYS A 220 ? LYS A 913 . ? 1_555 ? 24 AC3 4 GLU A 270 ? GLU A 963 . ? 1_455 ? 25 AC3 4 HOH H . ? HOH A 9107 . ? 1_555 ? 26 AC4 7 THR A 216 ? THR A 909 . ? 4_555 ? 27 AC4 7 PHE A 217 ? PHE A 910 . ? 4_555 ? 28 AC4 7 PRO A 244 ? PRO A 937 . ? 4_555 ? 29 AC4 7 MET A 252 ? MET A 945 . ? 1_555 ? 30 AC4 7 ARG A 255 ? ARG A 948 . ? 1_555 ? 31 AC4 7 HOH H . ? HOH A 9124 . ? 4_555 ? 32 AC4 7 HOH H . ? HOH A 9203 . ? 1_555 ? 33 AC5 5 ARG A 239 ? ARG A 932 . ? 1_555 ? 34 AC5 5 PRO A 244 ? PRO A 937 . ? 4_555 ? 35 AC5 5 ARG A 255 ? ARG A 948 . ? 1_555 ? 36 AC5 5 TRP A 258 ? TRP A 951 . ? 1_555 ? 37 AC5 5 MET A 259 ? MET A 952 . ? 1_555 ? 38 AC6 6 ASP A 223 ? ASP A 916 . ? 1_555 ? 39 AC6 6 PRO A 244 ? PRO A 937 . ? 4_455 ? 40 AC6 6 CYS A 246 ? CYS A 939 . ? 4_455 ? 41 AC6 6 MET A 259 ? MET A 952 . ? 1_455 ? 42 AC6 6 SER A 264 ? SER A 957 . ? 1_455 ? 43 AC6 6 HOH H . ? HOH A 9128 . ? 1_455 ? # _database_PDB_matrix.entry_id 5HG9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5HG9 _atom_sites.fract_transf_matrix[1][1] 0.028405 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014310 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008806 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 694 ? ? ? A . n A 1 2 SER 2 695 ? ? ? A . n A 1 3 GLY 3 696 ? ? ? A . n A 1 4 GLU 4 697 ? ? ? A . n A 1 5 ALA 5 698 ? ? ? A . n A 1 6 PRO 6 699 ? ? ? A . n A 1 7 ASN 7 700 ? ? ? A . n A 1 8 GLN 8 701 ? ? ? A . n A 1 9 ALA 9 702 702 ALA ALA A . n A 1 10 LEU 10 703 703 LEU LEU A . n A 1 11 LEU 11 704 704 LEU LEU A . n A 1 12 ARG 12 705 705 ARG ARG A . n A 1 13 ILE 13 706 706 ILE ILE A . n A 1 14 LEU 14 707 707 LEU LEU A . n A 1 15 LYS 15 708 708 LYS LYS A . n A 1 16 GLU 16 709 709 GLU GLU A . n A 1 17 THR 17 710 710 THR THR A . n A 1 18 GLU 18 711 711 GLU GLU A . n A 1 19 PHE 19 712 712 PHE PHE A . n A 1 20 LYS 20 713 713 LYS LYS A . n A 1 21 LYS 21 714 714 LYS LYS A . n A 1 22 ILE 22 715 715 ILE ILE A . n A 1 23 LYS 23 716 716 LYS LYS A . n A 1 24 VAL 24 717 717 VAL VAL A . n A 1 25 LEU 25 718 718 LEU LEU A . n A 1 26 GLY 26 719 719 GLY GLY A . n A 1 27 SER 27 720 720 SER SER A . n A 1 28 GLY 28 721 721 GLY GLY A . n A 1 29 ALA 29 722 722 ALA ALA A . n A 1 30 PHE 30 723 723 PHE PHE A . n A 1 31 GLY 31 724 724 GLY GLY A . n A 1 32 THR 32 725 725 THR THR A . n A 1 33 VAL 33 726 726 VAL VAL A . n A 1 34 TYR 34 727 727 TYR TYR A . n A 1 35 LYS 35 728 728 LYS LYS A . n A 1 36 GLY 36 729 729 GLY GLY A . n A 1 37 LEU 37 730 730 LEU LEU A . n A 1 38 TRP 38 731 731 TRP TRP A . n A 1 39 ILE 39 732 732 ILE ILE A . n A 1 40 PRO 40 733 733 PRO PRO A . n A 1 41 GLU 41 734 734 GLU GLU A . n A 1 42 GLY 42 735 735 GLY GLY A . n A 1 43 GLU 43 736 736 GLU GLU A . n A 1 44 LYS 44 737 737 LYS LYS A . n A 1 45 VAL 45 738 738 VAL VAL A . n A 1 46 LYS 46 739 739 LYS LYS A . n A 1 47 ILE 47 740 740 ILE ILE A . n A 1 48 PRO 48 741 741 PRO PRO A . n A 1 49 VAL 49 742 742 VAL VAL A . n A 1 50 ALA 50 743 743 ALA ALA A . n A 1 51 ILE 51 744 744 ILE ILE A . n A 1 52 LYS 52 745 745 LYS LYS A . n A 1 53 GLU 53 746 746 GLU GLU A . n A 1 54 LEU 54 747 747 LEU LEU A . n A 1 55 ARG 55 748 748 ARG ARG A . n A 1 56 GLU 56 749 ? ? ? A . n A 1 57 ALA 57 750 ? ? ? A . n A 1 58 THR 58 751 ? ? ? A . n A 1 59 SER 59 752 ? ? ? A . n A 1 60 PRO 60 753 753 PRO PRO A . n A 1 61 LYS 61 754 754 LYS LYS A . n A 1 62 ALA 62 755 755 ALA ALA A . n A 1 63 ASN 63 756 756 ASN ASN A . n A 1 64 LYS 64 757 757 LYS LYS A . n A 1 65 GLU 65 758 758 GLU GLU A . n A 1 66 ILE 66 759 759 ILE ILE A . n A 1 67 LEU 67 760 760 LEU LEU A . n A 1 68 ASP 68 761 761 ASP ASP A . n A 1 69 GLU 69 762 762 GLU GLU A . n A 1 70 ALA 70 763 763 ALA ALA A . n A 1 71 TYR 71 764 764 TYR TYR A . n A 1 72 VAL 72 765 765 VAL VAL A . n A 1 73 MET 73 766 766 MET MET A . n A 1 74 ALA 74 767 767 ALA ALA A . n A 1 75 SER 75 768 768 SER SER A . n A 1 76 VAL 76 769 769 VAL VAL A . n A 1 77 ASP 77 770 770 ASP ASP A . n A 1 78 ASN 78 771 771 ASN ASN A . n A 1 79 PRO 79 772 772 PRO PRO A . n A 1 80 HIS 80 773 773 HIS HIS A . n A 1 81 VAL 81 774 774 VAL VAL A . n A 1 82 CYS 82 775 775 CYS CYS A . n A 1 83 ARG 83 776 776 ARG ARG A . n A 1 84 LEU 84 777 777 LEU LEU A . n A 1 85 LEU 85 778 778 LEU LEU A . n A 1 86 GLY 86 779 779 GLY GLY A . n A 1 87 ILE 87 780 780 ILE ILE A . n A 1 88 CYS 88 781 781 CYS CYS A . n A 1 89 LEU 89 782 782 LEU LEU A . n A 1 90 THR 90 783 783 THR THR A . n A 1 91 SER 91 784 784 SER SER A . n A 1 92 THR 92 785 785 THR THR A . n A 1 93 VAL 93 786 786 VAL VAL A . n A 1 94 GLN 94 787 787 GLN GLN A . n A 1 95 LEU 95 788 788 LEU LEU A . n A 1 96 ILE 96 789 789 ILE ILE A . n A 1 97 MET 97 790 790 MET MET A . n A 1 98 GLN 98 791 791 GLN GLN A . n A 1 99 LEU 99 792 792 LEU LEU A . n A 1 100 MET 100 793 793 MET MET A . n A 1 101 PRO 101 794 794 PRO PRO A . n A 1 102 PHE 102 795 795 PHE PHE A . n A 1 103 GLY 103 796 796 GLY GLY A . n A 1 104 CYS 104 797 797 CYS CYS A . n A 1 105 LEU 105 798 798 LEU LEU A . n A 1 106 LEU 106 799 799 LEU LEU A . n A 1 107 ASP 107 800 800 ASP ASP A . n A 1 108 TYR 108 801 801 TYR TYR A . n A 1 109 VAL 109 802 802 VAL VAL A . n A 1 110 ARG 110 803 803 ARG ARG A . n A 1 111 GLU 111 804 804 GLU GLU A . n A 1 112 HIS 112 805 805 HIS HIS A . n A 1 113 LYS 113 806 806 LYS LYS A . n A 1 114 ASP 114 807 807 ASP ASP A . n A 1 115 ASN 115 808 808 ASN ASN A . n A 1 116 ILE 116 809 809 ILE ILE A . n A 1 117 GLY 117 810 810 GLY GLY A . n A 1 118 SER 118 811 811 SER SER A . n A 1 119 GLN 119 812 812 GLN GLN A . n A 1 120 TYR 120 813 813 TYR TYR A . n A 1 121 LEU 121 814 814 LEU LEU A . n A 1 122 LEU 122 815 815 LEU LEU A . n A 1 123 ASN 123 816 816 ASN ASN A . n A 1 124 TRP 124 817 817 TRP TRP A . n A 1 125 CYS 125 818 818 CYS CYS A . n A 1 126 VAL 126 819 819 VAL VAL A . n A 1 127 GLN 127 820 820 GLN GLN A . n A 1 128 ILE 128 821 821 ILE ILE A . n A 1 129 ALA 129 822 822 ALA ALA A . n A 1 130 LYS 130 823 823 LYS LYS A . n A 1 131 GLY 131 824 824 GLY GLY A . n A 1 132 MET 132 825 825 MET MET A . n A 1 133 ASN 133 826 826 ASN ASN A . n A 1 134 TYR 134 827 827 TYR TYR A . n A 1 135 LEU 135 828 828 LEU LEU A . n A 1 136 GLU 136 829 829 GLU GLU A . n A 1 137 ASP 137 830 830 ASP ASP A . n A 1 138 ARG 138 831 831 ARG ARG A . n A 1 139 ARG 139 832 832 ARG ARG A . n A 1 140 LEU 140 833 833 LEU LEU A . n A 1 141 VAL 141 834 834 VAL VAL A . n A 1 142 HIS 142 835 835 HIS HIS A . n A 1 143 ARG 143 836 836 ARG ARG A . n A 1 144 ASP 144 837 837 ASP ASP A . n A 1 145 LEU 145 838 838 LEU LEU A . n A 1 146 ALA 146 839 839 ALA ALA A . n A 1 147 ALA 147 840 840 ALA ALA A . n A 1 148 ARG 148 841 841 ARG ARG A . n A 1 149 ASN 149 842 842 ASN ASN A . n A 1 150 VAL 150 843 843 VAL VAL A . n A 1 151 LEU 151 844 844 LEU LEU A . n A 1 152 VAL 152 845 845 VAL VAL A . n A 1 153 LYS 153 846 846 LYS LYS A . n A 1 154 THR 154 847 847 THR THR A . n A 1 155 PRO 155 848 848 PRO PRO A . n A 1 156 GLN 156 849 849 GLN GLN A . n A 1 157 HIS 157 850 850 HIS HIS A . n A 1 158 VAL 158 851 851 VAL VAL A . n A 1 159 LYS 159 852 852 LYS LYS A . n A 1 160 ILE 160 853 853 ILE ILE A . n A 1 161 THR 161 854 854 THR THR A . n A 1 162 ASP 162 855 855 ASP ASP A . n A 1 163 PHE 163 856 856 PHE PHE A . n A 1 164 GLY 164 857 857 GLY GLY A . n A 1 165 ARG 165 858 858 ARG ARG A . n A 1 166 ALA 166 859 859 ALA ALA A . n A 1 167 LYS 167 860 860 LYS LYS A . n A 1 168 LEU 168 861 861 LEU LEU A . n A 1 169 LEU 169 862 862 LEU LEU A . n A 1 170 GLY 170 863 863 GLY GLY A . n A 1 171 ALA 171 864 864 ALA ALA A . n A 1 172 GLU 172 865 865 GLU GLU A . n A 1 173 GLU 173 866 866 GLU GLU A . n A 1 174 LYS 174 867 867 LYS LYS A . n A 1 175 GLU 175 868 868 GLU GLU A . n A 1 176 TYR 176 869 869 TYR TYR A . n A 1 177 HIS 177 870 870 HIS HIS A . n A 1 178 ALA 178 871 871 ALA ALA A . n A 1 179 GLU 179 872 872 GLU GLU A . n A 1 180 GLY 180 873 873 GLY GLY A . n A 1 181 GLY 181 874 874 GLY GLY A . n A 1 182 LYS 182 875 875 LYS LYS A . n A 1 183 VAL 183 876 876 VAL VAL A . n A 1 184 PRO 184 877 877 PRO PRO A . n A 1 185 ILE 185 878 878 ILE ILE A . n A 1 186 LYS 186 879 879 LYS LYS A . n A 1 187 TRP 187 880 880 TRP TRP A . n A 1 188 MET 188 881 881 MET MET A . n A 1 189 ALA 189 882 882 ALA ALA A . n A 1 190 LEU 190 883 883 LEU LEU A . n A 1 191 GLU 191 884 884 GLU GLU A . n A 1 192 SER 192 885 885 SER SER A . n A 1 193 ILE 193 886 886 ILE ILE A . n A 1 194 LEU 194 887 887 LEU LEU A . n A 1 195 HIS 195 888 888 HIS HIS A . n A 1 196 ARG 196 889 889 ARG ARG A . n A 1 197 ILE 197 890 890 ILE ILE A . n A 1 198 TYR 198 891 891 TYR TYR A . n A 1 199 THR 199 892 892 THR THR A . n A 1 200 HIS 200 893 893 HIS HIS A . n A 1 201 GLN 201 894 894 GLN GLN A . n A 1 202 SER 202 895 895 SER SER A . n A 1 203 ASP 203 896 896 ASP ASP A . n A 1 204 VAL 204 897 897 VAL VAL A . n A 1 205 TRP 205 898 898 TRP TRP A . n A 1 206 SER 206 899 899 SER SER A . n A 1 207 TYR 207 900 900 TYR TYR A . n A 1 208 GLY 208 901 901 GLY GLY A . n A 1 209 VAL 209 902 902 VAL VAL A . n A 1 210 THR 210 903 903 THR THR A . n A 1 211 VAL 211 904 904 VAL VAL A . n A 1 212 TRP 212 905 905 TRP TRP A . n A 1 213 GLU 213 906 906 GLU GLU A . n A 1 214 LEU 214 907 907 LEU LEU A . n A 1 215 MET 215 908 908 MET MET A . n A 1 216 THR 216 909 909 THR THR A . n A 1 217 PHE 217 910 910 PHE PHE A . n A 1 218 GLY 218 911 911 GLY GLY A . n A 1 219 SER 219 912 912 SER SER A . n A 1 220 LYS 220 913 913 LYS LYS A . n A 1 221 PRO 221 914 914 PRO PRO A . n A 1 222 TYR 222 915 915 TYR TYR A . n A 1 223 ASP 223 916 916 ASP ASP A . n A 1 224 GLY 224 917 917 GLY GLY A . n A 1 225 ILE 225 918 918 ILE ILE A . n A 1 226 PRO 226 919 919 PRO PRO A . n A 1 227 ALA 227 920 920 ALA ALA A . n A 1 228 SER 228 921 921 SER SER A . n A 1 229 GLU 229 922 922 GLU GLU A . n A 1 230 ILE 230 923 923 ILE ILE A . n A 1 231 SER 231 924 924 SER SER A . n A 1 232 SER 232 925 925 SER SER A . n A 1 233 ILE 233 926 926 ILE ILE A . n A 1 234 LEU 234 927 927 LEU LEU A . n A 1 235 GLU 235 928 928 GLU GLU A . n A 1 236 LYS 236 929 929 LYS LYS A . n A 1 237 GLY 237 930 930 GLY GLY A . n A 1 238 GLU 238 931 931 GLU GLU A . n A 1 239 ARG 239 932 932 ARG ARG A . n A 1 240 LEU 240 933 933 LEU LEU A . n A 1 241 PRO 241 934 934 PRO PRO A . n A 1 242 GLN 242 935 935 GLN GLN A . n A 1 243 PRO 243 936 936 PRO PRO A . n A 1 244 PRO 244 937 937 PRO PRO A . n A 1 245 ILE 245 938 938 ILE ILE A . n A 1 246 CYS 246 939 939 CYS CYS A . n A 1 247 THR 247 940 940 THR THR A . n A 1 248 ILE 248 941 941 ILE ILE A . n A 1 249 ASP 249 942 942 ASP ASP A . n A 1 250 VAL 250 943 943 VAL VAL A . n A 1 251 TYR 251 944 944 TYR TYR A . n A 1 252 MET 252 945 945 MET MET A . n A 1 253 ILE 253 946 946 ILE ILE A . n A 1 254 MET 254 947 947 MET MET A . n A 1 255 ARG 255 948 948 ARG ARG A . n A 1 256 LYS 256 949 949 LYS LYS A . n A 1 257 CYS 257 950 950 CYS CYS A . n A 1 258 TRP 258 951 951 TRP TRP A . n A 1 259 MET 259 952 952 MET MET A . n A 1 260 ILE 260 953 953 ILE ILE A . n A 1 261 ASP 261 954 954 ASP ASP A . n A 1 262 ALA 262 955 955 ALA ALA A . n A 1 263 ASP 263 956 956 ASP ASP A . n A 1 264 SER 264 957 957 SER SER A . n A 1 265 ARG 265 958 958 ARG ARG A . n A 1 266 PRO 266 959 959 PRO PRO A . n A 1 267 LYS 267 960 960 LYS LYS A . n A 1 268 PHE 268 961 961 PHE PHE A . n A 1 269 ARG 269 962 962 ARG ARG A . n A 1 270 GLU 270 963 963 GLU GLU A . n A 1 271 LEU 271 964 964 LEU LEU A . n A 1 272 ILE 272 965 965 ILE ILE A . n A 1 273 ILE 273 966 966 ILE ILE A . n A 1 274 GLU 274 967 967 GLU GLU A . n A 1 275 PHE 275 968 968 PHE PHE A . n A 1 276 SER 276 969 969 SER SER A . n A 1 277 LYS 277 970 970 LYS LYS A . n A 1 278 MET 278 971 971 MET MET A . n A 1 279 ALA 279 972 972 ALA ALA A . n A 1 280 ARG 280 973 973 ARG ARG A . n A 1 281 ASP 281 974 974 ASP ASP A . n A 1 282 PRO 282 975 975 PRO PRO A . n A 1 283 GLN 283 976 976 GLN GLN A . n A 1 284 ARG 284 977 977 ARG ARG A . n A 1 285 TYR 285 978 978 TYR TYR A . n A 1 286 LEU 286 979 979 LEU LEU A . n A 1 287 VAL 287 980 980 VAL VAL A . n A 1 288 ILE 288 981 981 ILE ILE A . n A 1 289 GLN 289 982 982 GLN GLN A . n A 1 290 GLY 290 983 983 GLY GLY A . n A 1 291 ASP 291 984 984 ASP ASP A . n A 1 292 GLU 292 985 985 GLU GLU A . n A 1 293 ARG 293 986 ? ? ? A . n A 1 294 MET 294 987 ? ? ? A . n A 1 295 HIS 295 988 ? ? ? A . n A 1 296 LEU 296 989 ? ? ? A . n A 1 297 PRO 297 990 ? ? ? A . n A 1 298 SER 298 991 ? ? ? A . n A 1 299 PRO 299 992 ? ? ? A . n A 1 300 THR 300 993 ? ? ? A . n A 1 301 ASP 301 994 ? ? ? A . n A 1 302 SER 302 995 ? ? ? A . n A 1 303 ASN 303 996 ? ? ? A . n A 1 304 PHE 304 997 ? ? ? A . n A 1 305 TYR 305 998 ? ? ? A . n A 1 306 ARG 306 999 ? ? ? A . n A 1 307 ALA 307 1000 ? ? ? A . n A 1 308 LEU 308 1001 ? ? ? A . n A 1 309 MET 309 1002 ? ? ? A . n A 1 310 ASP 310 1003 ? ? ? A . n A 1 311 GLU 311 1004 ? ? ? A . n A 1 312 GLU 312 1005 ? ? ? A . n A 1 313 ASP 313 1006 ? ? ? A . n A 1 314 MET 314 1007 ? ? ? A . n A 1 315 ASP 315 1008 ? ? ? A . n A 1 316 ASP 316 1009 ? ? ? A . n A 1 317 VAL 317 1010 ? ? ? A . n A 1 318 VAL 318 1011 ? ? ? A . n A 1 319 ASP 319 1012 ? ? ? A . n A 1 320 ALA 320 1013 ? ? ? A . n A 1 321 ASP 321 1014 ? ? ? A . n A 1 322 GLU 322 1015 ? ? ? A . n A 1 323 TYR 323 1016 ? ? ? A . n A 1 324 LEU 324 1017 ? ? ? A . n A 1 325 ILE 325 1018 ? ? ? A . n A 1 326 PRO 326 1019 ? ? ? A . n A 1 327 GLN 327 1020 ? ? ? A . n A 1 328 GLN 328 1021 ? ? ? A . n A 1 329 GLY 329 1022 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 63A 1 9001 9001 63A LIG A . C 3 SO4 1 9002 9002 SO4 SO4 A . D 3 SO4 1 9003 9003 SO4 SO4 A . E 4 GOL 1 9004 9004 GOL GOL A . F 4 GOL 1 9005 9005 GOL GOL A . G 4 GOL 1 9006 9006 GOL GOL A . H 5 HOH 1 9101 82 HOH WAT A . H 5 HOH 2 9102 43 HOH WAT A . H 5 HOH 3 9103 42 HOH WAT A . H 5 HOH 4 9104 32 HOH WAT A . H 5 HOH 5 9105 30 HOH WAT A . H 5 HOH 6 9106 122 HOH WAT A . H 5 HOH 7 9107 34 HOH WAT A . H 5 HOH 8 9108 14 HOH WAT A . H 5 HOH 9 9109 91 HOH WAT A . H 5 HOH 10 9110 72 HOH WAT A . H 5 HOH 11 9111 101 HOH WAT A . H 5 HOH 12 9112 2 HOH WAT A . H 5 HOH 13 9113 73 HOH WAT A . H 5 HOH 14 9114 61 HOH WAT A . H 5 HOH 15 9115 127 HOH WAT A . H 5 HOH 16 9116 20 HOH WAT A . H 5 HOH 17 9117 55 HOH WAT A . H 5 HOH 18 9118 48 HOH WAT A . H 5 HOH 19 9119 105 HOH WAT A . H 5 HOH 20 9120 23 HOH WAT A . H 5 HOH 21 9121 117 HOH WAT A . H 5 HOH 22 9122 120 HOH WAT A . H 5 HOH 23 9123 123 HOH WAT A . H 5 HOH 24 9124 56 HOH WAT A . H 5 HOH 25 9125 106 HOH WAT A . H 5 HOH 26 9126 45 HOH WAT A . H 5 HOH 27 9127 68 HOH WAT A . H 5 HOH 28 9128 84 HOH WAT A . H 5 HOH 29 9129 11 HOH WAT A . H 5 HOH 30 9130 69 HOH WAT A . H 5 HOH 31 9131 39 HOH WAT A . H 5 HOH 32 9132 29 HOH WAT A . H 5 HOH 33 9133 124 HOH WAT A . H 5 HOH 34 9134 6 HOH WAT A . H 5 HOH 35 9135 67 HOH WAT A . H 5 HOH 36 9136 17 HOH WAT A . H 5 HOH 37 9137 64 HOH WAT A . H 5 HOH 38 9138 35 HOH WAT A . H 5 HOH 39 9139 24 HOH WAT A . H 5 HOH 40 9140 104 HOH WAT A . H 5 HOH 41 9141 12 HOH WAT A . H 5 HOH 42 9142 46 HOH WAT A . H 5 HOH 43 9143 74 HOH WAT A . H 5 HOH 44 9144 3 HOH WAT A . H 5 HOH 45 9145 41 HOH WAT A . H 5 HOH 46 9146 121 HOH WAT A . H 5 HOH 47 9147 33 HOH WAT A . H 5 HOH 48 9148 109 HOH WAT A . H 5 HOH 49 9149 97 HOH WAT A . H 5 HOH 50 9150 5 HOH WAT A . H 5 HOH 51 9151 95 HOH WAT A . H 5 HOH 52 9152 1 HOH WAT A . H 5 HOH 53 9153 125 HOH WAT A . H 5 HOH 54 9154 21 HOH WAT A . H 5 HOH 55 9155 47 HOH WAT A . H 5 HOH 56 9156 7 HOH WAT A . H 5 HOH 57 9157 19 HOH WAT A . H 5 HOH 58 9158 66 HOH WAT A . H 5 HOH 59 9159 25 HOH WAT A . H 5 HOH 60 9160 128 HOH WAT A . H 5 HOH 61 9161 40 HOH WAT A . H 5 HOH 62 9162 103 HOH WAT A . H 5 HOH 63 9163 54 HOH WAT A . H 5 HOH 64 9164 38 HOH WAT A . H 5 HOH 65 9165 94 HOH WAT A . H 5 HOH 66 9166 102 HOH WAT A . H 5 HOH 67 9167 75 HOH WAT A . H 5 HOH 68 9168 93 HOH WAT A . H 5 HOH 69 9169 62 HOH WAT A . H 5 HOH 70 9170 108 HOH WAT A . H 5 HOH 71 9171 15 HOH WAT A . H 5 HOH 72 9172 65 HOH WAT A . H 5 HOH 73 9173 80 HOH WAT A . H 5 HOH 74 9174 52 HOH WAT A . H 5 HOH 75 9175 60 HOH WAT A . H 5 HOH 76 9176 76 HOH WAT A . H 5 HOH 77 9177 9 HOH WAT A . H 5 HOH 78 9178 26 HOH WAT A . H 5 HOH 79 9179 50 HOH WAT A . H 5 HOH 80 9180 31 HOH WAT A . H 5 HOH 81 9181 53 HOH WAT A . H 5 HOH 82 9182 44 HOH WAT A . H 5 HOH 83 9183 136 HOH WAT A . H 5 HOH 84 9184 13 HOH WAT A . H 5 HOH 85 9185 77 HOH WAT A . H 5 HOH 86 9186 99 HOH WAT A . H 5 HOH 87 9187 51 HOH WAT A . H 5 HOH 88 9188 81 HOH WAT A . H 5 HOH 89 9189 87 HOH WAT A . H 5 HOH 90 9190 131 HOH WAT A . H 5 HOH 91 9191 10 HOH WAT A . H 5 HOH 92 9192 71 HOH WAT A . H 5 HOH 93 9193 119 HOH WAT A . H 5 HOH 94 9194 16 HOH WAT A . H 5 HOH 95 9195 8 HOH WAT A . H 5 HOH 96 9196 37 HOH WAT A . H 5 HOH 97 9197 92 HOH WAT A . H 5 HOH 98 9198 59 HOH WAT A . H 5 HOH 99 9199 134 HOH WAT A . H 5 HOH 100 9200 129 HOH WAT A . H 5 HOH 101 9201 57 HOH WAT A . H 5 HOH 102 9202 4 HOH WAT A . H 5 HOH 103 9203 22 HOH WAT A . H 5 HOH 104 9204 28 HOH WAT A . H 5 HOH 105 9205 98 HOH WAT A . H 5 HOH 106 9206 18 HOH WAT A . H 5 HOH 107 9207 58 HOH WAT A . H 5 HOH 108 9208 27 HOH WAT A . H 5 HOH 109 9209 89 HOH WAT A . H 5 HOH 110 9210 36 HOH WAT A . H 5 HOH 111 9211 88 HOH WAT A . H 5 HOH 112 9212 63 HOH WAT A . H 5 HOH 113 9213 86 HOH WAT A . H 5 HOH 114 9214 114 HOH WAT A . H 5 HOH 115 9215 133 HOH WAT A . H 5 HOH 116 9216 100 HOH WAT A . H 5 HOH 117 9217 79 HOH WAT A . H 5 HOH 118 9218 112 HOH WAT A . H 5 HOH 119 9219 118 HOH WAT A . H 5 HOH 120 9220 70 HOH WAT A . H 5 HOH 121 9221 96 HOH WAT A . H 5 HOH 122 9222 90 HOH WAT A . H 5 HOH 123 9223 78 HOH WAT A . H 5 HOH 124 9224 132 HOH WAT A . H 5 HOH 125 9225 85 HOH WAT A . H 5 HOH 126 9226 83 HOH WAT A . H 5 HOH 127 9227 126 HOH WAT A . H 5 HOH 128 9228 110 HOH WAT A . H 5 HOH 129 9229 49 HOH WAT A . H 5 HOH 130 9230 130 HOH WAT A . H 5 HOH 131 9231 111 HOH WAT A . H 5 HOH 132 9232 115 HOH WAT A . H 5 HOH 133 9233 116 HOH WAT A . H 5 HOH 134 9234 113 HOH WAT A . H 5 HOH 135 9235 135 HOH WAT A . H 5 HOH 136 9236 107 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-02-03 2 'Structure model' 1 1 2016-02-10 3 'Structure model' 1 2 2016-03-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? CNX ? ? ? 2005 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 # _pdbx_entry_details.entry_id 5HG9 _pdbx_entry_details.nonpolymer_details ;The 63A ligand represent bound form of 1-[(3R,4R)-3-[({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-(trifluoromethyl)pyrrolidin-1-yl]prop-2-en-1-one which has a double bond between C11 and C12 atom group. ; _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 783 ? ? -127.94 -135.72 2 1 ASP A 837 ? ? -147.42 34.09 3 1 GLU A 872 ? ? -106.43 -130.73 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 694 ? A GLY 1 2 1 Y 1 A SER 695 ? A SER 2 3 1 Y 1 A GLY 696 ? A GLY 3 4 1 Y 1 A GLU 697 ? A GLU 4 5 1 Y 1 A ALA 698 ? A ALA 5 6 1 Y 1 A PRO 699 ? A PRO 6 7 1 Y 1 A ASN 700 ? A ASN 7 8 1 Y 1 A GLN 701 ? A GLN 8 9 1 Y 1 A GLU 749 ? A GLU 56 10 1 Y 1 A ALA 750 ? A ALA 57 11 1 Y 1 A THR 751 ? A THR 58 12 1 Y 1 A SER 752 ? A SER 59 13 1 Y 1 A ARG 986 ? A ARG 293 14 1 Y 1 A MET 987 ? A MET 294 15 1 Y 1 A HIS 988 ? A HIS 295 16 1 Y 1 A LEU 989 ? A LEU 296 17 1 Y 1 A PRO 990 ? A PRO 297 18 1 Y 1 A SER 991 ? A SER 298 19 1 Y 1 A PRO 992 ? A PRO 299 20 1 Y 1 A THR 993 ? A THR 300 21 1 Y 1 A ASP 994 ? A ASP 301 22 1 Y 1 A SER 995 ? A SER 302 23 1 Y 1 A ASN 996 ? A ASN 303 24 1 Y 1 A PHE 997 ? A PHE 304 25 1 Y 1 A TYR 998 ? A TYR 305 26 1 Y 1 A ARG 999 ? A ARG 306 27 1 Y 1 A ALA 1000 ? A ALA 307 28 1 Y 1 A LEU 1001 ? A LEU 308 29 1 Y 1 A MET 1002 ? A MET 309 30 1 Y 1 A ASP 1003 ? A ASP 310 31 1 Y 1 A GLU 1004 ? A GLU 311 32 1 Y 1 A GLU 1005 ? A GLU 312 33 1 Y 1 A ASP 1006 ? A ASP 313 34 1 Y 1 A MET 1007 ? A MET 314 35 1 Y 1 A ASP 1008 ? A ASP 315 36 1 Y 1 A ASP 1009 ? A ASP 316 37 1 Y 1 A VAL 1010 ? A VAL 317 38 1 Y 1 A VAL 1011 ? A VAL 318 39 1 Y 1 A ASP 1012 ? A ASP 319 40 1 Y 1 A ALA 1013 ? A ALA 320 41 1 Y 1 A ASP 1014 ? A ASP 321 42 1 Y 1 A GLU 1015 ? A GLU 322 43 1 Y 1 A TYR 1016 ? A TYR 323 44 1 Y 1 A LEU 1017 ? A LEU 324 45 1 Y 1 A ILE 1018 ? A ILE 325 46 1 Y 1 A PRO 1019 ? A PRO 326 47 1 Y 1 A GLN 1020 ? A GLN 327 48 1 Y 1 A GLN 1021 ? A GLN 328 49 1 Y 1 A GLY 1022 ? A GLY 329 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-[(3R,4R)-3-[({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-(trifluoromethyl)pyrrolidin-1-yl]propan-1-one ; 63A 3 'SULFATE ION' SO4 4 GLYCEROL GOL 5 water HOH #