data_5HJC
# 
_entry.id   5HJC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5HJC         pdb_00005hjc 10.2210/pdb5hjc/pdb 
WWPDB D_1000217128 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-04-20 
2 'Structure model' 1 1 2016-05-04 
3 'Structure model' 1 2 2023-11-08 
4 'Structure model' 1 3 2023-11-15 
5 'Structure model' 1 4 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Derived calculations'   
5 3 'Structure model' 'Refinement description' 
6 4 'Structure model' 'Data collection'        
7 5 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' chem_comp_atom                
2  3 'Structure model' chem_comp_bond                
3  3 'Structure model' citation                      
4  3 'Structure model' database_2                    
5  3 'Structure model' pdbx_initial_refinement_model 
6  3 'Structure model' pdbx_struct_oper_list         
7  4 'Structure model' chem_comp_atom                
8  4 'Structure model' chem_comp_bond                
9  5 'Structure model' pdbx_entry_details            
10 5 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.journal_id_CSD'                  
2 3 'Structure model' '_database_2.pdbx_DOI'                      
3 3 'Structure model' '_database_2.pdbx_database_accession'       
4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
5 4 'Structure model' '_chem_comp_atom.atom_id'                   
6 4 'Structure model' '_chem_comp_bond.atom_id_2'                 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HJC 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5HJB PDB . 
unspecified 5HJD PDB . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, Y.Y.'   1 
'Zhao, D.'   2 
'Guan, H.P.' 3 
'Li, H.T.'   4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            62 
_citation.language                  ? 
_citation.page_first                181 
_citation.page_last                 193 
_citation.title                     'Molecular Coupling of Histone Crotonylation and Active Transcription by AF9 YEATS Domain' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2016.03.028 
_citation.pdbx_database_id_PubMed   27105114 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, Y.Y.'      1  ? 
primary 'Sabari, B.R.'  2  ? 
primary 'Panchenko, T.' 3  ? 
primary 'Wen, H.'       4  ? 
primary 'Zhao, D.'      5  ? 
primary 'Guan, H.P.'    6  ? 
primary 'Wan, L.'       7  ? 
primary 'Huang, H.'     8  ? 
primary 'Tang, Z.'      9  ? 
primary 'Zhao, Y.'      10 ? 
primary 'Roeder, R.G.'  11 ? 
primary 'Shi, X.'       12 ? 
primary 'Allis, C.D.'   13 ? 
primary 'Li, H.T.'      14 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bromodomain-containing protein 3' 13032.073 1  ? ? 'second bromodomain, UNP residues 307-416' ? 
2 polymer     syn 'peptide of Histone H3.1'          1056.258  1  ? ? ?                                          ? 
3 non-polymer syn 1,2-ETHANEDIOL                     62.068    1  ? ? ?                                          ? 
4 non-polymer syn 'CHLORIDE ION'                     35.453    1  ? ? ?                                          ? 
5 water       nat water                              18.015    52 ? ? ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RING3-like protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSN
CYKYNPPDHEVVAMARKLQDVFEMRFAKMP
;
;KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSN
CYKYNPPDHEVVAMARKLQDVFEMRFAKMP
;
A ? 
2 'polypeptide(L)' no yes 'APR(ALY)QLATK' APRKQLATK B ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 1,2-ETHANEDIOL EDO 
4 'CHLORIDE ION' CL  
5 water          HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   LEU n 
1 3   SER n 
1 4   GLU n 
1 5   HIS n 
1 6   LEU n 
1 7   ARG n 
1 8   TYR n 
1 9   CYS n 
1 10  ASP n 
1 11  SER n 
1 12  ILE n 
1 13  LEU n 
1 14  ARG n 
1 15  GLU n 
1 16  MET n 
1 17  LEU n 
1 18  SER n 
1 19  LYS n 
1 20  LYS n 
1 21  HIS n 
1 22  ALA n 
1 23  ALA n 
1 24  TYR n 
1 25  ALA n 
1 26  TRP n 
1 27  PRO n 
1 28  PHE n 
1 29  TYR n 
1 30  LYS n 
1 31  PRO n 
1 32  VAL n 
1 33  ASP n 
1 34  ALA n 
1 35  GLU n 
1 36  ALA n 
1 37  LEU n 
1 38  GLU n 
1 39  LEU n 
1 40  HIS n 
1 41  ASP n 
1 42  TYR n 
1 43  HIS n 
1 44  ASP n 
1 45  ILE n 
1 46  ILE n 
1 47  LYS n 
1 48  HIS n 
1 49  PRO n 
1 50  MET n 
1 51  ASP n 
1 52  LEU n 
1 53  SER n 
1 54  THR n 
1 55  VAL n 
1 56  LYS n 
1 57  ARG n 
1 58  LYS n 
1 59  MET n 
1 60  ASP n 
1 61  GLY n 
1 62  ARG n 
1 63  GLU n 
1 64  TYR n 
1 65  PRO n 
1 66  ASP n 
1 67  ALA n 
1 68  GLN n 
1 69  GLY n 
1 70  PHE n 
1 71  ALA n 
1 72  ALA n 
1 73  ASP n 
1 74  VAL n 
1 75  ARG n 
1 76  LEU n 
1 77  MET n 
1 78  PHE n 
1 79  SER n 
1 80  ASN n 
1 81  CYS n 
1 82  TYR n 
1 83  LYS n 
1 84  TYR n 
1 85  ASN n 
1 86  PRO n 
1 87  PRO n 
1 88  ASP n 
1 89  HIS n 
1 90  GLU n 
1 91  VAL n 
1 92  VAL n 
1 93  ALA n 
1 94  MET n 
1 95  ALA n 
1 96  ARG n 
1 97  LYS n 
1 98  LEU n 
1 99  GLN n 
1 100 ASP n 
1 101 VAL n 
1 102 PHE n 
1 103 GLU n 
1 104 MET n 
1 105 ARG n 
1 106 PHE n 
1 107 ALA n 
1 108 LYS n 
1 109 MET n 
1 110 PRO n 
2 1   ALA n 
2 2   PRO n 
2 3   ARG n 
2 4   ALY n 
2 5   GLN n 
2 6   LEU n 
2 7   ALA n 
2 8   THR n 
2 9   LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   110 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BRD3, KIAA0043, RING3L' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       9 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ?                 'C3 H7 N O2'     89.093  
ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ?                 'C8 H16 N2 O3'   188.224 
ARG 'L-peptide linking' y ARGININE            ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'      ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE            ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL      'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE           ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER               ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE          ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE       ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ?                 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   307 307 LYS LYS A . n 
A 1 2   LEU 2   308 308 LEU LEU A . n 
A 1 3   SER 3   309 309 SER SER A . n 
A 1 4   GLU 4   310 310 GLU GLU A . n 
A 1 5   HIS 5   311 311 HIS HIS A . n 
A 1 6   LEU 6   312 312 LEU LEU A . n 
A 1 7   ARG 7   313 313 ARG ARG A . n 
A 1 8   TYR 8   314 314 TYR TYR A . n 
A 1 9   CYS 9   315 315 CYS CYS A . n 
A 1 10  ASP 10  316 316 ASP ASP A . n 
A 1 11  SER 11  317 317 SER SER A . n 
A 1 12  ILE 12  318 318 ILE ILE A . n 
A 1 13  LEU 13  319 319 LEU LEU A . n 
A 1 14  ARG 14  320 320 ARG ARG A . n 
A 1 15  GLU 15  321 321 GLU GLU A . n 
A 1 16  MET 16  322 322 MET MET A . n 
A 1 17  LEU 17  323 323 LEU LEU A . n 
A 1 18  SER 18  324 324 SER SER A . n 
A 1 19  LYS 19  325 325 LYS LYS A . n 
A 1 20  LYS 20  326 326 LYS LYS A . n 
A 1 21  HIS 21  327 327 HIS HIS A . n 
A 1 22  ALA 22  328 328 ALA ALA A . n 
A 1 23  ALA 23  329 329 ALA ALA A . n 
A 1 24  TYR 24  330 330 TYR TYR A . n 
A 1 25  ALA 25  331 331 ALA ALA A . n 
A 1 26  TRP 26  332 332 TRP TRP A . n 
A 1 27  PRO 27  333 333 PRO PRO A . n 
A 1 28  PHE 28  334 334 PHE PHE A . n 
A 1 29  TYR 29  335 335 TYR TYR A . n 
A 1 30  LYS 30  336 336 LYS LYS A . n 
A 1 31  PRO 31  337 337 PRO PRO A . n 
A 1 32  VAL 32  338 338 VAL VAL A . n 
A 1 33  ASP 33  339 339 ASP ASP A . n 
A 1 34  ALA 34  340 340 ALA ALA A . n 
A 1 35  GLU 35  341 341 GLU GLU A . n 
A 1 36  ALA 36  342 342 ALA ALA A . n 
A 1 37  LEU 37  343 343 LEU LEU A . n 
A 1 38  GLU 38  344 344 GLU GLU A . n 
A 1 39  LEU 39  345 345 LEU LEU A . n 
A 1 40  HIS 40  346 346 HIS HIS A . n 
A 1 41  ASP 41  347 347 ASP ASP A . n 
A 1 42  TYR 42  348 348 TYR TYR A . n 
A 1 43  HIS 43  349 349 HIS HIS A . n 
A 1 44  ASP 44  350 350 ASP ASP A . n 
A 1 45  ILE 45  351 351 ILE ILE A . n 
A 1 46  ILE 46  352 352 ILE ILE A . n 
A 1 47  LYS 47  353 353 LYS LYS A . n 
A 1 48  HIS 48  354 354 HIS HIS A . n 
A 1 49  PRO 49  355 355 PRO PRO A . n 
A 1 50  MET 50  356 356 MET MET A . n 
A 1 51  ASP 51  357 357 ASP ASP A . n 
A 1 52  LEU 52  358 358 LEU LEU A . n 
A 1 53  SER 53  359 359 SER SER A . n 
A 1 54  THR 54  360 360 THR THR A . n 
A 1 55  VAL 55  361 361 VAL VAL A . n 
A 1 56  LYS 56  362 362 LYS LYS A . n 
A 1 57  ARG 57  363 363 ARG ARG A . n 
A 1 58  LYS 58  364 364 LYS LYS A . n 
A 1 59  MET 59  365 365 MET MET A . n 
A 1 60  ASP 60  366 366 ASP ASP A . n 
A 1 61  GLY 61  367 367 GLY GLY A . n 
A 1 62  ARG 62  368 368 ARG ARG A . n 
A 1 63  GLU 63  369 369 GLU GLU A . n 
A 1 64  TYR 64  370 370 TYR TYR A . n 
A 1 65  PRO 65  371 371 PRO PRO A . n 
A 1 66  ASP 66  372 372 ASP ASP A . n 
A 1 67  ALA 67  373 373 ALA ALA A . n 
A 1 68  GLN 68  374 374 GLN GLN A . n 
A 1 69  GLY 69  375 375 GLY GLY A . n 
A 1 70  PHE 70  376 376 PHE PHE A . n 
A 1 71  ALA 71  377 377 ALA ALA A . n 
A 1 72  ALA 72  378 378 ALA ALA A . n 
A 1 73  ASP 73  379 379 ASP ASP A . n 
A 1 74  VAL 74  380 380 VAL VAL A . n 
A 1 75  ARG 75  381 381 ARG ARG A . n 
A 1 76  LEU 76  382 382 LEU LEU A . n 
A 1 77  MET 77  383 383 MET MET A . n 
A 1 78  PHE 78  384 384 PHE PHE A . n 
A 1 79  SER 79  385 385 SER SER A . n 
A 1 80  ASN 80  386 386 ASN ASN A . n 
A 1 81  CYS 81  387 387 CYS CYS A . n 
A 1 82  TYR 82  388 388 TYR TYR A . n 
A 1 83  LYS 83  389 389 LYS LYS A . n 
A 1 84  TYR 84  390 390 TYR TYR A . n 
A 1 85  ASN 85  391 391 ASN ASN A . n 
A 1 86  PRO 86  392 392 PRO PRO A . n 
A 1 87  PRO 87  393 393 PRO PRO A . n 
A 1 88  ASP 88  394 394 ASP ASP A . n 
A 1 89  HIS 89  395 395 HIS HIS A . n 
A 1 90  GLU 90  396 396 GLU GLU A . n 
A 1 91  VAL 91  397 397 VAL VAL A . n 
A 1 92  VAL 92  398 398 VAL VAL A . n 
A 1 93  ALA 93  399 399 ALA ALA A . n 
A 1 94  MET 94  400 400 MET MET A . n 
A 1 95  ALA 95  401 401 ALA ALA A . n 
A 1 96  ARG 96  402 402 ARG ARG A . n 
A 1 97  LYS 97  403 403 LYS LYS A . n 
A 1 98  LEU 98  404 404 LEU LEU A . n 
A 1 99  GLN 99  405 405 GLN GLN A . n 
A 1 100 ASP 100 406 406 ASP ASP A . n 
A 1 101 VAL 101 407 407 VAL VAL A . n 
A 1 102 PHE 102 408 408 PHE PHE A . n 
A 1 103 GLU 103 409 409 GLU GLU A . n 
A 1 104 MET 104 410 410 MET MET A . n 
A 1 105 ARG 105 411 411 ARG ARG A . n 
A 1 106 PHE 106 412 412 PHE PHE A . n 
A 1 107 ALA 107 413 413 ALA ALA A . n 
A 1 108 LYS 108 414 414 LYS LYS A . n 
A 1 109 MET 109 415 415 MET MET A . n 
A 1 110 PRO 110 416 416 PRO PRO A . n 
B 2 1   ALA 1   15  15  ALA ALA B . n 
B 2 2   PRO 2   16  16  PRO PRO B . n 
B 2 3   ARG 3   17  17  ARG ARG B . n 
B 2 4   ALY 4   18  18  ALY ALY B . n 
B 2 5   GLN 5   19  19  GLN GLN B . n 
B 2 6   LEU 6   20  20  LEU LEU B . n 
B 2 7   ALA 7   21  21  ALA ALA B . n 
B 2 8   THR 8   22  22  THR THR B . n 
B 2 9   LYS 9   23  23  LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 EDO 1  501 1  EDO EDO A . 
D 4 CL  1  502 1  CL  CL  A . 
E 5 HOH 1  601 47 HOH HOH A . 
E 5 HOH 2  602 48 HOH HOH A . 
E 5 HOH 3  603 44 HOH HOH A . 
E 5 HOH 4  604 2  HOH HOH A . 
E 5 HOH 5  605 11 HOH HOH A . 
E 5 HOH 6  606 55 HOH HOH A . 
E 5 HOH 7  607 54 HOH HOH A . 
E 5 HOH 8  608 20 HOH HOH A . 
E 5 HOH 9  609 10 HOH HOH A . 
E 5 HOH 10 610 5  HOH HOH A . 
E 5 HOH 11 611 29 HOH HOH A . 
E 5 HOH 12 612 18 HOH HOH A . 
E 5 HOH 13 613 3  HOH HOH A . 
E 5 HOH 14 614 4  HOH HOH A . 
E 5 HOH 15 615 33 HOH HOH A . 
E 5 HOH 16 616 32 HOH HOH A . 
E 5 HOH 17 617 12 HOH HOH A . 
E 5 HOH 18 618 50 HOH HOH A . 
E 5 HOH 19 619 22 HOH HOH A . 
E 5 HOH 20 620 17 HOH HOH A . 
E 5 HOH 21 621 28 HOH HOH A . 
E 5 HOH 22 622 8  HOH HOH A . 
E 5 HOH 23 623 15 HOH HOH A . 
E 5 HOH 24 624 24 HOH HOH A . 
E 5 HOH 25 625 16 HOH HOH A . 
E 5 HOH 26 626 23 HOH HOH A . 
E 5 HOH 27 627 31 HOH HOH A . 
E 5 HOH 28 628 26 HOH HOH A . 
E 5 HOH 29 629 21 HOH HOH A . 
E 5 HOH 30 630 30 HOH HOH A . 
E 5 HOH 31 631 19 HOH HOH A . 
E 5 HOH 32 632 13 HOH HOH A . 
E 5 HOH 33 633 25 HOH HOH A . 
E 5 HOH 34 634 27 HOH HOH A . 
E 5 HOH 35 635 7  HOH HOH A . 
E 5 HOH 36 636 9  HOH HOH A . 
E 5 HOH 37 637 36 HOH HOH A . 
E 5 HOH 38 638 56 HOH HOH A . 
E 5 HOH 39 639 43 HOH HOH A . 
E 5 HOH 40 640 57 HOH HOH A . 
E 5 HOH 41 641 49 HOH HOH A . 
E 5 HOH 42 642 59 HOH HOH A . 
E 5 HOH 43 643 52 HOH HOH A . 
E 5 HOH 44 644 34 HOH HOH A . 
E 5 HOH 45 645 60 HOH HOH A . 
E 5 HOH 46 646 58 HOH HOH A . 
E 5 HOH 47 647 53 HOH HOH A . 
F 5 HOH 1  101 1  HOH HOH B . 
F 5 HOH 2  102 14 HOH HOH B . 
F 5 HOH 3  103 51 HOH HOH B . 
F 5 HOH 4  104 41 HOH HOH B . 
F 5 HOH 5  105 6  HOH HOH B . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .        1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HJC 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     79.768 
_cell.length_a_esd                 ? 
_cell.length_b                     79.768 
_cell.length_b_esd                 ? 
_cell.length_c                     95.262 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HJC 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HJC 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.36 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.39 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'30%(w/v) polyethylene glycol methyl ether 5000, 0.2 M ammonium sulfate, 0.1 M MES, 0.1 M guanidine hydrochloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MARRESEARCH 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9791 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9791 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            33.200 
_reflns.entry_id                         5HJC 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.600 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       5939 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.500 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.700 
_reflns.pdbx_Rmerge_I_obs                0.186 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         16.805 
_reflns.pdbx_netI_over_sigmaI            7.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.600 2.640  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.796 ? ? ? ? ? ? ? ? 7.100 ? ? ? ? ? ? ? 1  1 ? ? 
2.640 2.690  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.756 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? ? 2  1 ? ? 
2.690 2.740  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.631 ? ? ? ? ? ? ? ? 7.000 ? ? ? ? ? ? ? 3  1 ? ? 
2.740 2.800  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.476 ? ? ? ? ? ? ? ? 7.000 ? ? ? ? ? ? ? 4  1 ? ? 
2.800 2.860  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.469 ? ? ? ? ? ? ? ? 7.000 ? ? ? ? ? ? ? 5  1 ? ? 
2.860 2.930  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.407 ? ? ? ? ? ? ? ? 7.000 ? ? ? ? ? ? ? 6  1 ? ? 
2.930 3.000  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.347 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? ? 7  1 ? ? 
3.000 3.080  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.290 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? ? 8  1 ? ? 
3.080 3.170  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.275 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? ? 9  1 ? ? 
3.170 3.280  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.215 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? ? 10 1 ? ? 
3.280 3.390  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.207 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? ? ? ? 11 1 ? ? 
3.390 3.530  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? ? ? ? 12 1 ? ? 
3.530 3.690  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 6.600 ? ? ? ? ? ? ? 13 1 ? ? 
3.690 3.880  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 6.700 ? ? ? ? ? ? ? 14 1 ? ? 
3.880 4.130  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 15 1 ? ? 
4.130 4.450  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 6.400 ? ? ? ? ? ? ? 16 1 ? ? 
4.450 4.890  ? ? ? ? ? ? ? 99.700  ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 6.500 ? ? ? ? ? ? ? 17 1 ? ? 
4.890 5.600  ? ? ? ? ? ? ? 99.400  ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 18 1 ? ? 
5.600 7.050  ? ? ? ? ? ? ? 98.800  ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 6.400 ? ? ? ? ? ? ? 19 1 ? ? 
7.050 50.000 ? ? ? ? ? ? ? 94.500  ? ? ? ? 0.106 ? ? ? ? ? ? ? ? 5.800 ? ? ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                75.140 
_refine.B_iso_mean                               31.2308 
_refine.B_iso_min                                13.770 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HJC 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.600 
_refine.ls_d_res_low                             28.8520 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     5923 
_refine.ls_number_reflns_R_free                  291 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8700 
_refine.ls_percent_reflns_R_free                 4.9100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2195 
_refine.ls_R_factor_R_free                       0.2691 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2171 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2OO1 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.4000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFRACTION' 
_refine_hist.d_res_high                       2.600 
_refine_hist.d_res_low                        28.8520 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             52 
_refine_hist.number_atoms_total               1043 
_refine_hist.pdbx_number_residues_total       119 
_refine_hist.pdbx_B_iso_mean_ligand           41.24 
_refine_hist.pdbx_B_iso_mean_solvent          29.59 
_refine_hist.pdbx_number_atoms_protein        986 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 1015 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.637  ? 1363 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.027  ? 138  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 176  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.010 ? 393  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5974 3.2717  2882 . 148 2734 100.0000 . . . 0.3365 . 0.2529 . . . . . . 2 . . . 
'X-RAY DIFFRACTION' 3.2717 28.8537 3041 . 143 2898 100.0000 . . . 0.2337 . 0.2008 . . . . . . 2 . . . 
# 
_struct.entry_id                     5HJC 
_struct.title                        'BRD3 second bromodomain in complex with histone H3 acetylation at K18' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HJC 
_struct_keywords.text            
'Complex, BRD3, Bromodomain, histone peptide, acetyllysine, H3K18, SIGNALING PROTEIN-PEPTIDE complex' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/PEPTIDE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP BRD3_HUMAN Q15059 ? 1 
;KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSN
CYKYNPPDHEVVAMARKLQDVFEMRFAKMP
;
307 
2 UNP H31_HUMAN  P68431 ? 2 APRKQLATK 16  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HJC A 1 ? 110 ? Q15059 307 ? 416 ? 307 416 
2 2 5HJC B 1 ? 9   ? P68431 16  ? 24  ? 15  23  
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1320 ? 
1 MORE         -8   ? 
1 'SSA (A^2)'  7260 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 3  ? LEU A 17  ? SER A 309 LEU A 323 1 ? 15 
HELX_P HELX_P2 AA2 SER A 18 ? LYS A 20  ? SER A 324 LYS A 326 5 ? 3  
HELX_P HELX_P3 AA3 HIS A 21 ? TRP A 26  ? HIS A 327 TRP A 332 1 ? 6  
HELX_P HELX_P4 AA4 PRO A 27 ? TYR A 29  ? PRO A 333 TYR A 335 5 ? 3  
HELX_P HELX_P5 AA5 ASP A 41 ? ILE A 46  ? ASP A 347 ILE A 352 1 ? 6  
HELX_P HELX_P6 AA6 ASP A 51 ? GLY A 61  ? ASP A 357 GLY A 367 1 ? 11 
HELX_P HELX_P7 AA7 ASP A 66 ? ASN A 85  ? ASP A 372 ASN A 391 1 ? 20 
HELX_P HELX_P8 AA8 HIS A 89 ? LYS A 108 ? HIS A 395 LYS A 414 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? B ARG 3 C ? ? ? 1_555 B ALY 4 N ? ? B ARG 17 B ALY 18 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale2 covale both ? B ALY 4 C ? ? ? 1_555 B GLN 5 N ? ? B ALY 18 B GLN 19 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      ALY 
_pdbx_modification_feature.label_asym_id                      B 
_pdbx_modification_feature.label_seq_id                       4 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     . 
_pdbx_modification_feature.modified_residue_label_asym_id     . 
_pdbx_modification_feature.modified_residue_label_seq_id      . 
_pdbx_modification_feature.modified_residue_label_alt_id      . 
_pdbx_modification_feature.auth_comp_id                       ALY 
_pdbx_modification_feature.auth_asym_id                       B 
_pdbx_modification_feature.auth_seq_id                        18 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      . 
_pdbx_modification_feature.modified_residue_auth_asym_id      . 
_pdbx_modification_feature.modified_residue_auth_seq_id       . 
_pdbx_modification_feature.modified_residue_PDB_ins_code      . 
_pdbx_modification_feature.modified_residue_symmetry          . 
_pdbx_modification_feature.comp_id_linking_atom               . 
_pdbx_modification_feature.modified_residue_id_linking_atom   . 
_pdbx_modification_feature.modified_residue_id                LYS 
_pdbx_modification_feature.ref_pcm_id                         1 
_pdbx_modification_feature.ref_comp_id                        ALY 
_pdbx_modification_feature.type                               Acetylation 
_pdbx_modification_feature.category                           'Named protein modification' 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    EDO 
_struct_site.pdbx_auth_seq_id     501 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'binding site for residue EDO A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 5  ? HIS A 311 . ? 1_555 ? 
2 AC1 4 ASP A 66 ? ASP A 372 . ? 1_555 ? 
3 AC1 4 ALA A 67 ? ALA A 373 . ? 1_555 ? 
4 AC1 4 GLN A 68 ? GLN A 374 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   5HJC 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    ALY 
_pdbx_struct_mod_residue.label_seq_id     4 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     ALY 
_pdbx_struct_mod_residue.auth_seq_id      18 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   LYS 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ALY OH   O  N N 14  
ALY CH   C  N N 15  
ALY CH3  C  N N 16  
ALY NZ   N  N N 17  
ALY CE   C  N N 18  
ALY CD   C  N N 19  
ALY CG   C  N N 20  
ALY CB   C  N N 21  
ALY CA   C  N S 22  
ALY N    N  N N 23  
ALY C    C  N N 24  
ALY O    O  N N 25  
ALY OXT  O  N N 26  
ALY HH31 H  N N 27  
ALY HH32 H  N N 28  
ALY HH33 H  N N 29  
ALY HZ   H  N N 30  
ALY HE3  H  N N 31  
ALY HE2  H  N N 32  
ALY HD3  H  N N 33  
ALY HD2  H  N N 34  
ALY HG3  H  N N 35  
ALY HG2  H  N N 36  
ALY HB3  H  N N 37  
ALY HB2  H  N N 38  
ALY HA   H  N N 39  
ALY H    H  N N 40  
ALY H2   H  N N 41  
ALY HXT  H  N N 42  
ARG N    N  N N 43  
ARG CA   C  N S 44  
ARG C    C  N N 45  
ARG O    O  N N 46  
ARG CB   C  N N 47  
ARG CG   C  N N 48  
ARG CD   C  N N 49  
ARG NE   N  N N 50  
ARG CZ   C  N N 51  
ARG NH1  N  N N 52  
ARG NH2  N  N N 53  
ARG OXT  O  N N 54  
ARG H    H  N N 55  
ARG H2   H  N N 56  
ARG HA   H  N N 57  
ARG HB2  H  N N 58  
ARG HB3  H  N N 59  
ARG HG2  H  N N 60  
ARG HG3  H  N N 61  
ARG HD2  H  N N 62  
ARG HD3  H  N N 63  
ARG HE   H  N N 64  
ARG HH11 H  N N 65  
ARG HH12 H  N N 66  
ARG HH21 H  N N 67  
ARG HH22 H  N N 68  
ARG HXT  H  N N 69  
ASN N    N  N N 70  
ASN CA   C  N S 71  
ASN C    C  N N 72  
ASN O    O  N N 73  
ASN CB   C  N N 74  
ASN CG   C  N N 75  
ASN OD1  O  N N 76  
ASN ND2  N  N N 77  
ASN OXT  O  N N 78  
ASN H    H  N N 79  
ASN H2   H  N N 80  
ASN HA   H  N N 81  
ASN HB2  H  N N 82  
ASN HB3  H  N N 83  
ASN HD21 H  N N 84  
ASN HD22 H  N N 85  
ASN HXT  H  N N 86  
ASP N    N  N N 87  
ASP CA   C  N S 88  
ASP C    C  N N 89  
ASP O    O  N N 90  
ASP CB   C  N N 91  
ASP CG   C  N N 92  
ASP OD1  O  N N 93  
ASP OD2  O  N N 94  
ASP OXT  O  N N 95  
ASP H    H  N N 96  
ASP H2   H  N N 97  
ASP HA   H  N N 98  
ASP HB2  H  N N 99  
ASP HB3  H  N N 100 
ASP HD2  H  N N 101 
ASP HXT  H  N N 102 
CL  CL   CL N N 103 
CYS N    N  N N 104 
CYS CA   C  N R 105 
CYS C    C  N N 106 
CYS O    O  N N 107 
CYS CB   C  N N 108 
CYS SG   S  N N 109 
CYS OXT  O  N N 110 
CYS H    H  N N 111 
CYS H2   H  N N 112 
CYS HA   H  N N 113 
CYS HB2  H  N N 114 
CYS HB3  H  N N 115 
CYS HG   H  N N 116 
CYS HXT  H  N N 117 
EDO C1   C  N N 118 
EDO O1   O  N N 119 
EDO C2   C  N N 120 
EDO O2   O  N N 121 
EDO H11  H  N N 122 
EDO H12  H  N N 123 
EDO HO1  H  N N 124 
EDO H21  H  N N 125 
EDO H22  H  N N 126 
EDO HO2  H  N N 127 
GLN N    N  N N 128 
GLN CA   C  N S 129 
GLN C    C  N N 130 
GLN O    O  N N 131 
GLN CB   C  N N 132 
GLN CG   C  N N 133 
GLN CD   C  N N 134 
GLN OE1  O  N N 135 
GLN NE2  N  N N 136 
GLN OXT  O  N N 137 
GLN H    H  N N 138 
GLN H2   H  N N 139 
GLN HA   H  N N 140 
GLN HB2  H  N N 141 
GLN HB3  H  N N 142 
GLN HG2  H  N N 143 
GLN HG3  H  N N 144 
GLN HE21 H  N N 145 
GLN HE22 H  N N 146 
GLN HXT  H  N N 147 
GLU N    N  N N 148 
GLU CA   C  N S 149 
GLU C    C  N N 150 
GLU O    O  N N 151 
GLU CB   C  N N 152 
GLU CG   C  N N 153 
GLU CD   C  N N 154 
GLU OE1  O  N N 155 
GLU OE2  O  N N 156 
GLU OXT  O  N N 157 
GLU H    H  N N 158 
GLU H2   H  N N 159 
GLU HA   H  N N 160 
GLU HB2  H  N N 161 
GLU HB3  H  N N 162 
GLU HG2  H  N N 163 
GLU HG3  H  N N 164 
GLU HE2  H  N N 165 
GLU HXT  H  N N 166 
GLY N    N  N N 167 
GLY CA   C  N N 168 
GLY C    C  N N 169 
GLY O    O  N N 170 
GLY OXT  O  N N 171 
GLY H    H  N N 172 
GLY H2   H  N N 173 
GLY HA2  H  N N 174 
GLY HA3  H  N N 175 
GLY HXT  H  N N 176 
HIS N    N  N N 177 
HIS CA   C  N S 178 
HIS C    C  N N 179 
HIS O    O  N N 180 
HIS CB   C  N N 181 
HIS CG   C  Y N 182 
HIS ND1  N  Y N 183 
HIS CD2  C  Y N 184 
HIS CE1  C  Y N 185 
HIS NE2  N  Y N 186 
HIS OXT  O  N N 187 
HIS H    H  N N 188 
HIS H2   H  N N 189 
HIS HA   H  N N 190 
HIS HB2  H  N N 191 
HIS HB3  H  N N 192 
HIS HD1  H  N N 193 
HIS HD2  H  N N 194 
HIS HE1  H  N N 195 
HIS HE2  H  N N 196 
HIS HXT  H  N N 197 
HOH O    O  N N 198 
HOH H1   H  N N 199 
HOH H2   H  N N 200 
ILE N    N  N N 201 
ILE CA   C  N S 202 
ILE C    C  N N 203 
ILE O    O  N N 204 
ILE CB   C  N S 205 
ILE CG1  C  N N 206 
ILE CG2  C  N N 207 
ILE CD1  C  N N 208 
ILE OXT  O  N N 209 
ILE H    H  N N 210 
ILE H2   H  N N 211 
ILE HA   H  N N 212 
ILE HB   H  N N 213 
ILE HG12 H  N N 214 
ILE HG13 H  N N 215 
ILE HG21 H  N N 216 
ILE HG22 H  N N 217 
ILE HG23 H  N N 218 
ILE HD11 H  N N 219 
ILE HD12 H  N N 220 
ILE HD13 H  N N 221 
ILE HXT  H  N N 222 
LEU N    N  N N 223 
LEU CA   C  N S 224 
LEU C    C  N N 225 
LEU O    O  N N 226 
LEU CB   C  N N 227 
LEU CG   C  N N 228 
LEU CD1  C  N N 229 
LEU CD2  C  N N 230 
LEU OXT  O  N N 231 
LEU H    H  N N 232 
LEU H2   H  N N 233 
LEU HA   H  N N 234 
LEU HB2  H  N N 235 
LEU HB3  H  N N 236 
LEU HG   H  N N 237 
LEU HD11 H  N N 238 
LEU HD12 H  N N 239 
LEU HD13 H  N N 240 
LEU HD21 H  N N 241 
LEU HD22 H  N N 242 
LEU HD23 H  N N 243 
LEU HXT  H  N N 244 
LYS N    N  N N 245 
LYS CA   C  N S 246 
LYS C    C  N N 247 
LYS O    O  N N 248 
LYS CB   C  N N 249 
LYS CG   C  N N 250 
LYS CD   C  N N 251 
LYS CE   C  N N 252 
LYS NZ   N  N N 253 
LYS OXT  O  N N 254 
LYS H    H  N N 255 
LYS H2   H  N N 256 
LYS HA   H  N N 257 
LYS HB2  H  N N 258 
LYS HB3  H  N N 259 
LYS HG2  H  N N 260 
LYS HG3  H  N N 261 
LYS HD2  H  N N 262 
LYS HD3  H  N N 263 
LYS HE2  H  N N 264 
LYS HE3  H  N N 265 
LYS HZ1  H  N N 266 
LYS HZ2  H  N N 267 
LYS HZ3  H  N N 268 
LYS HXT  H  N N 269 
MET N    N  N N 270 
MET CA   C  N S 271 
MET C    C  N N 272 
MET O    O  N N 273 
MET CB   C  N N 274 
MET CG   C  N N 275 
MET SD   S  N N 276 
MET CE   C  N N 277 
MET OXT  O  N N 278 
MET H    H  N N 279 
MET H2   H  N N 280 
MET HA   H  N N 281 
MET HB2  H  N N 282 
MET HB3  H  N N 283 
MET HG2  H  N N 284 
MET HG3  H  N N 285 
MET HE1  H  N N 286 
MET HE2  H  N N 287 
MET HE3  H  N N 288 
MET HXT  H  N N 289 
PHE N    N  N N 290 
PHE CA   C  N S 291 
PHE C    C  N N 292 
PHE O    O  N N 293 
PHE CB   C  N N 294 
PHE CG   C  Y N 295 
PHE CD1  C  Y N 296 
PHE CD2  C  Y N 297 
PHE CE1  C  Y N 298 
PHE CE2  C  Y N 299 
PHE CZ   C  Y N 300 
PHE OXT  O  N N 301 
PHE H    H  N N 302 
PHE H2   H  N N 303 
PHE HA   H  N N 304 
PHE HB2  H  N N 305 
PHE HB3  H  N N 306 
PHE HD1  H  N N 307 
PHE HD2  H  N N 308 
PHE HE1  H  N N 309 
PHE HE2  H  N N 310 
PHE HZ   H  N N 311 
PHE HXT  H  N N 312 
PRO N    N  N N 313 
PRO CA   C  N S 314 
PRO C    C  N N 315 
PRO O    O  N N 316 
PRO CB   C  N N 317 
PRO CG   C  N N 318 
PRO CD   C  N N 319 
PRO OXT  O  N N 320 
PRO H    H  N N 321 
PRO HA   H  N N 322 
PRO HB2  H  N N 323 
PRO HB3  H  N N 324 
PRO HG2  H  N N 325 
PRO HG3  H  N N 326 
PRO HD2  H  N N 327 
PRO HD3  H  N N 328 
PRO HXT  H  N N 329 
SER N    N  N N 330 
SER CA   C  N S 331 
SER C    C  N N 332 
SER O    O  N N 333 
SER CB   C  N N 334 
SER OG   O  N N 335 
SER OXT  O  N N 336 
SER H    H  N N 337 
SER H2   H  N N 338 
SER HA   H  N N 339 
SER HB2  H  N N 340 
SER HB3  H  N N 341 
SER HG   H  N N 342 
SER HXT  H  N N 343 
THR N    N  N N 344 
THR CA   C  N S 345 
THR C    C  N N 346 
THR O    O  N N 347 
THR CB   C  N R 348 
THR OG1  O  N N 349 
THR CG2  C  N N 350 
THR OXT  O  N N 351 
THR H    H  N N 352 
THR H2   H  N N 353 
THR HA   H  N N 354 
THR HB   H  N N 355 
THR HG1  H  N N 356 
THR HG21 H  N N 357 
THR HG22 H  N N 358 
THR HG23 H  N N 359 
THR HXT  H  N N 360 
TRP N    N  N N 361 
TRP CA   C  N S 362 
TRP C    C  N N 363 
TRP O    O  N N 364 
TRP CB   C  N N 365 
TRP CG   C  Y N 366 
TRP CD1  C  Y N 367 
TRP CD2  C  Y N 368 
TRP NE1  N  Y N 369 
TRP CE2  C  Y N 370 
TRP CE3  C  Y N 371 
TRP CZ2  C  Y N 372 
TRP CZ3  C  Y N 373 
TRP CH2  C  Y N 374 
TRP OXT  O  N N 375 
TRP H    H  N N 376 
TRP H2   H  N N 377 
TRP HA   H  N N 378 
TRP HB2  H  N N 379 
TRP HB3  H  N N 380 
TRP HD1  H  N N 381 
TRP HE1  H  N N 382 
TRP HE3  H  N N 383 
TRP HZ2  H  N N 384 
TRP HZ3  H  N N 385 
TRP HH2  H  N N 386 
TRP HXT  H  N N 387 
TYR N    N  N N 388 
TYR CA   C  N S 389 
TYR C    C  N N 390 
TYR O    O  N N 391 
TYR CB   C  N N 392 
TYR CG   C  Y N 393 
TYR CD1  C  Y N 394 
TYR CD2  C  Y N 395 
TYR CE1  C  Y N 396 
TYR CE2  C  Y N 397 
TYR CZ   C  Y N 398 
TYR OH   O  N N 399 
TYR OXT  O  N N 400 
TYR H    H  N N 401 
TYR H2   H  N N 402 
TYR HA   H  N N 403 
TYR HB2  H  N N 404 
TYR HB3  H  N N 405 
TYR HD1  H  N N 406 
TYR HD2  H  N N 407 
TYR HE1  H  N N 408 
TYR HE2  H  N N 409 
TYR HH   H  N N 410 
TYR HXT  H  N N 411 
VAL N    N  N N 412 
VAL CA   C  N S 413 
VAL C    C  N N 414 
VAL O    O  N N 415 
VAL CB   C  N N 416 
VAL CG1  C  N N 417 
VAL CG2  C  N N 418 
VAL OXT  O  N N 419 
VAL H    H  N N 420 
VAL H2   H  N N 421 
VAL HA   H  N N 422 
VAL HB   H  N N 423 
VAL HG11 H  N N 424 
VAL HG12 H  N N 425 
VAL HG13 H  N N 426 
VAL HG21 H  N N 427 
VAL HG22 H  N N 428 
VAL HG23 H  N N 429 
VAL HXT  H  N N 430 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ALY OH  CH   doub N N 13  
ALY CH  CH3  sing N N 14  
ALY CH  NZ   sing N N 15  
ALY CH3 HH31 sing N N 16  
ALY CH3 HH32 sing N N 17  
ALY CH3 HH33 sing N N 18  
ALY NZ  CE   sing N N 19  
ALY NZ  HZ   sing N N 20  
ALY CE  CD   sing N N 21  
ALY CE  HE3  sing N N 22  
ALY CE  HE2  sing N N 23  
ALY CD  CG   sing N N 24  
ALY CD  HD3  sing N N 25  
ALY CD  HD2  sing N N 26  
ALY CG  CB   sing N N 27  
ALY CG  HG3  sing N N 28  
ALY CG  HG2  sing N N 29  
ALY CB  CA   sing N N 30  
ALY CB  HB3  sing N N 31  
ALY CB  HB2  sing N N 32  
ALY CA  N    sing N N 33  
ALY CA  C    sing N N 34  
ALY CA  HA   sing N N 35  
ALY N   H    sing N N 36  
ALY N   H2   sing N N 37  
ALY C   O    doub N N 38  
ALY C   OXT  sing N N 39  
ALY OXT HXT  sing N N 40  
ARG N   CA   sing N N 41  
ARG N   H    sing N N 42  
ARG N   H2   sing N N 43  
ARG CA  C    sing N N 44  
ARG CA  CB   sing N N 45  
ARG CA  HA   sing N N 46  
ARG C   O    doub N N 47  
ARG C   OXT  sing N N 48  
ARG CB  CG   sing N N 49  
ARG CB  HB2  sing N N 50  
ARG CB  HB3  sing N N 51  
ARG CG  CD   sing N N 52  
ARG CG  HG2  sing N N 53  
ARG CG  HG3  sing N N 54  
ARG CD  NE   sing N N 55  
ARG CD  HD2  sing N N 56  
ARG CD  HD3  sing N N 57  
ARG NE  CZ   sing N N 58  
ARG NE  HE   sing N N 59  
ARG CZ  NH1  sing N N 60  
ARG CZ  NH2  doub N N 61  
ARG NH1 HH11 sing N N 62  
ARG NH1 HH12 sing N N 63  
ARG NH2 HH21 sing N N 64  
ARG NH2 HH22 sing N N 65  
ARG OXT HXT  sing N N 66  
ASN N   CA   sing N N 67  
ASN N   H    sing N N 68  
ASN N   H2   sing N N 69  
ASN CA  C    sing N N 70  
ASN CA  CB   sing N N 71  
ASN CA  HA   sing N N 72  
ASN C   O    doub N N 73  
ASN C   OXT  sing N N 74  
ASN CB  CG   sing N N 75  
ASN CB  HB2  sing N N 76  
ASN CB  HB3  sing N N 77  
ASN CG  OD1  doub N N 78  
ASN CG  ND2  sing N N 79  
ASN ND2 HD21 sing N N 80  
ASN ND2 HD22 sing N N 81  
ASN OXT HXT  sing N N 82  
ASP N   CA   sing N N 83  
ASP N   H    sing N N 84  
ASP N   H2   sing N N 85  
ASP CA  C    sing N N 86  
ASP CA  CB   sing N N 87  
ASP CA  HA   sing N N 88  
ASP C   O    doub N N 89  
ASP C   OXT  sing N N 90  
ASP CB  CG   sing N N 91  
ASP CB  HB2  sing N N 92  
ASP CB  HB3  sing N N 93  
ASP CG  OD1  doub N N 94  
ASP CG  OD2  sing N N 95  
ASP OD2 HD2  sing N N 96  
ASP OXT HXT  sing N N 97  
CYS N   CA   sing N N 98  
CYS N   H    sing N N 99  
CYS N   H2   sing N N 100 
CYS CA  C    sing N N 101 
CYS CA  CB   sing N N 102 
CYS CA  HA   sing N N 103 
CYS C   O    doub N N 104 
CYS C   OXT  sing N N 105 
CYS CB  SG   sing N N 106 
CYS CB  HB2  sing N N 107 
CYS CB  HB3  sing N N 108 
CYS SG  HG   sing N N 109 
CYS OXT HXT  sing N N 110 
EDO C1  O1   sing N N 111 
EDO C1  C2   sing N N 112 
EDO C1  H11  sing N N 113 
EDO C1  H12  sing N N 114 
EDO O1  HO1  sing N N 115 
EDO C2  O2   sing N N 116 
EDO C2  H21  sing N N 117 
EDO C2  H22  sing N N 118 
EDO O2  HO2  sing N N 119 
GLN N   CA   sing N N 120 
GLN N   H    sing N N 121 
GLN N   H2   sing N N 122 
GLN CA  C    sing N N 123 
GLN CA  CB   sing N N 124 
GLN CA  HA   sing N N 125 
GLN C   O    doub N N 126 
GLN C   OXT  sing N N 127 
GLN CB  CG   sing N N 128 
GLN CB  HB2  sing N N 129 
GLN CB  HB3  sing N N 130 
GLN CG  CD   sing N N 131 
GLN CG  HG2  sing N N 132 
GLN CG  HG3  sing N N 133 
GLN CD  OE1  doub N N 134 
GLN CD  NE2  sing N N 135 
GLN NE2 HE21 sing N N 136 
GLN NE2 HE22 sing N N 137 
GLN OXT HXT  sing N N 138 
GLU N   CA   sing N N 139 
GLU N   H    sing N N 140 
GLU N   H2   sing N N 141 
GLU CA  C    sing N N 142 
GLU CA  CB   sing N N 143 
GLU CA  HA   sing N N 144 
GLU C   O    doub N N 145 
GLU C   OXT  sing N N 146 
GLU CB  CG   sing N N 147 
GLU CB  HB2  sing N N 148 
GLU CB  HB3  sing N N 149 
GLU CG  CD   sing N N 150 
GLU CG  HG2  sing N N 151 
GLU CG  HG3  sing N N 152 
GLU CD  OE1  doub N N 153 
GLU CD  OE2  sing N N 154 
GLU OE2 HE2  sing N N 155 
GLU OXT HXT  sing N N 156 
GLY N   CA   sing N N 157 
GLY N   H    sing N N 158 
GLY N   H2   sing N N 159 
GLY CA  C    sing N N 160 
GLY CA  HA2  sing N N 161 
GLY CA  HA3  sing N N 162 
GLY C   O    doub N N 163 
GLY C   OXT  sing N N 164 
GLY OXT HXT  sing N N 165 
HIS N   CA   sing N N 166 
HIS N   H    sing N N 167 
HIS N   H2   sing N N 168 
HIS CA  C    sing N N 169 
HIS CA  CB   sing N N 170 
HIS CA  HA   sing N N 171 
HIS C   O    doub N N 172 
HIS C   OXT  sing N N 173 
HIS CB  CG   sing N N 174 
HIS CB  HB2  sing N N 175 
HIS CB  HB3  sing N N 176 
HIS CG  ND1  sing Y N 177 
HIS CG  CD2  doub Y N 178 
HIS ND1 CE1  doub Y N 179 
HIS ND1 HD1  sing N N 180 
HIS CD2 NE2  sing Y N 181 
HIS CD2 HD2  sing N N 182 
HIS CE1 NE2  sing Y N 183 
HIS CE1 HE1  sing N N 184 
HIS NE2 HE2  sing N N 185 
HIS OXT HXT  sing N N 186 
HOH O   H1   sing N N 187 
HOH O   H2   sing N N 188 
ILE N   CA   sing N N 189 
ILE N   H    sing N N 190 
ILE N   H2   sing N N 191 
ILE CA  C    sing N N 192 
ILE CA  CB   sing N N 193 
ILE CA  HA   sing N N 194 
ILE C   O    doub N N 195 
ILE C   OXT  sing N N 196 
ILE CB  CG1  sing N N 197 
ILE CB  CG2  sing N N 198 
ILE CB  HB   sing N N 199 
ILE CG1 CD1  sing N N 200 
ILE CG1 HG12 sing N N 201 
ILE CG1 HG13 sing N N 202 
ILE CG2 HG21 sing N N 203 
ILE CG2 HG22 sing N N 204 
ILE CG2 HG23 sing N N 205 
ILE CD1 HD11 sing N N 206 
ILE CD1 HD12 sing N N 207 
ILE CD1 HD13 sing N N 208 
ILE OXT HXT  sing N N 209 
LEU N   CA   sing N N 210 
LEU N   H    sing N N 211 
LEU N   H2   sing N N 212 
LEU CA  C    sing N N 213 
LEU CA  CB   sing N N 214 
LEU CA  HA   sing N N 215 
LEU C   O    doub N N 216 
LEU C   OXT  sing N N 217 
LEU CB  CG   sing N N 218 
LEU CB  HB2  sing N N 219 
LEU CB  HB3  sing N N 220 
LEU CG  CD1  sing N N 221 
LEU CG  CD2  sing N N 222 
LEU CG  HG   sing N N 223 
LEU CD1 HD11 sing N N 224 
LEU CD1 HD12 sing N N 225 
LEU CD1 HD13 sing N N 226 
LEU CD2 HD21 sing N N 227 
LEU CD2 HD22 sing N N 228 
LEU CD2 HD23 sing N N 229 
LEU OXT HXT  sing N N 230 
LYS N   CA   sing N N 231 
LYS N   H    sing N N 232 
LYS N   H2   sing N N 233 
LYS CA  C    sing N N 234 
LYS CA  CB   sing N N 235 
LYS CA  HA   sing N N 236 
LYS C   O    doub N N 237 
LYS C   OXT  sing N N 238 
LYS CB  CG   sing N N 239 
LYS CB  HB2  sing N N 240 
LYS CB  HB3  sing N N 241 
LYS CG  CD   sing N N 242 
LYS CG  HG2  sing N N 243 
LYS CG  HG3  sing N N 244 
LYS CD  CE   sing N N 245 
LYS CD  HD2  sing N N 246 
LYS CD  HD3  sing N N 247 
LYS CE  NZ   sing N N 248 
LYS CE  HE2  sing N N 249 
LYS CE  HE3  sing N N 250 
LYS NZ  HZ1  sing N N 251 
LYS NZ  HZ2  sing N N 252 
LYS NZ  HZ3  sing N N 253 
LYS OXT HXT  sing N N 254 
MET N   CA   sing N N 255 
MET N   H    sing N N 256 
MET N   H2   sing N N 257 
MET CA  C    sing N N 258 
MET CA  CB   sing N N 259 
MET CA  HA   sing N N 260 
MET C   O    doub N N 261 
MET C   OXT  sing N N 262 
MET CB  CG   sing N N 263 
MET CB  HB2  sing N N 264 
MET CB  HB3  sing N N 265 
MET CG  SD   sing N N 266 
MET CG  HG2  sing N N 267 
MET CG  HG3  sing N N 268 
MET SD  CE   sing N N 269 
MET CE  HE1  sing N N 270 
MET CE  HE2  sing N N 271 
MET CE  HE3  sing N N 272 
MET OXT HXT  sing N N 273 
PHE N   CA   sing N N 274 
PHE N   H    sing N N 275 
PHE N   H2   sing N N 276 
PHE CA  C    sing N N 277 
PHE CA  CB   sing N N 278 
PHE CA  HA   sing N N 279 
PHE C   O    doub N N 280 
PHE C   OXT  sing N N 281 
PHE CB  CG   sing N N 282 
PHE CB  HB2  sing N N 283 
PHE CB  HB3  sing N N 284 
PHE CG  CD1  doub Y N 285 
PHE CG  CD2  sing Y N 286 
PHE CD1 CE1  sing Y N 287 
PHE CD1 HD1  sing N N 288 
PHE CD2 CE2  doub Y N 289 
PHE CD2 HD2  sing N N 290 
PHE CE1 CZ   doub Y N 291 
PHE CE1 HE1  sing N N 292 
PHE CE2 CZ   sing Y N 293 
PHE CE2 HE2  sing N N 294 
PHE CZ  HZ   sing N N 295 
PHE OXT HXT  sing N N 296 
PRO N   CA   sing N N 297 
PRO N   CD   sing N N 298 
PRO N   H    sing N N 299 
PRO CA  C    sing N N 300 
PRO CA  CB   sing N N 301 
PRO CA  HA   sing N N 302 
PRO C   O    doub N N 303 
PRO C   OXT  sing N N 304 
PRO CB  CG   sing N N 305 
PRO CB  HB2  sing N N 306 
PRO CB  HB3  sing N N 307 
PRO CG  CD   sing N N 308 
PRO CG  HG2  sing N N 309 
PRO CG  HG3  sing N N 310 
PRO CD  HD2  sing N N 311 
PRO CD  HD3  sing N N 312 
PRO OXT HXT  sing N N 313 
SER N   CA   sing N N 314 
SER N   H    sing N N 315 
SER N   H2   sing N N 316 
SER CA  C    sing N N 317 
SER CA  CB   sing N N 318 
SER CA  HA   sing N N 319 
SER C   O    doub N N 320 
SER C   OXT  sing N N 321 
SER CB  OG   sing N N 322 
SER CB  HB2  sing N N 323 
SER CB  HB3  sing N N 324 
SER OG  HG   sing N N 325 
SER OXT HXT  sing N N 326 
THR N   CA   sing N N 327 
THR N   H    sing N N 328 
THR N   H2   sing N N 329 
THR CA  C    sing N N 330 
THR CA  CB   sing N N 331 
THR CA  HA   sing N N 332 
THR C   O    doub N N 333 
THR C   OXT  sing N N 334 
THR CB  OG1  sing N N 335 
THR CB  CG2  sing N N 336 
THR CB  HB   sing N N 337 
THR OG1 HG1  sing N N 338 
THR CG2 HG21 sing N N 339 
THR CG2 HG22 sing N N 340 
THR CG2 HG23 sing N N 341 
THR OXT HXT  sing N N 342 
TRP N   CA   sing N N 343 
TRP N   H    sing N N 344 
TRP N   H2   sing N N 345 
TRP CA  C    sing N N 346 
TRP CA  CB   sing N N 347 
TRP CA  HA   sing N N 348 
TRP C   O    doub N N 349 
TRP C   OXT  sing N N 350 
TRP CB  CG   sing N N 351 
TRP CB  HB2  sing N N 352 
TRP CB  HB3  sing N N 353 
TRP CG  CD1  doub Y N 354 
TRP CG  CD2  sing Y N 355 
TRP CD1 NE1  sing Y N 356 
TRP CD1 HD1  sing N N 357 
TRP CD2 CE2  doub Y N 358 
TRP CD2 CE3  sing Y N 359 
TRP NE1 CE2  sing Y N 360 
TRP NE1 HE1  sing N N 361 
TRP CE2 CZ2  sing Y N 362 
TRP CE3 CZ3  doub Y N 363 
TRP CE3 HE3  sing N N 364 
TRP CZ2 CH2  doub Y N 365 
TRP CZ2 HZ2  sing N N 366 
TRP CZ3 CH2  sing Y N 367 
TRP CZ3 HZ3  sing N N 368 
TRP CH2 HH2  sing N N 369 
TRP OXT HXT  sing N N 370 
TYR N   CA   sing N N 371 
TYR N   H    sing N N 372 
TYR N   H2   sing N N 373 
TYR CA  C    sing N N 374 
TYR CA  CB   sing N N 375 
TYR CA  HA   sing N N 376 
TYR C   O    doub N N 377 
TYR C   OXT  sing N N 378 
TYR CB  CG   sing N N 379 
TYR CB  HB2  sing N N 380 
TYR CB  HB3  sing N N 381 
TYR CG  CD1  doub Y N 382 
TYR CG  CD2  sing Y N 383 
TYR CD1 CE1  sing Y N 384 
TYR CD1 HD1  sing N N 385 
TYR CD2 CE2  doub Y N 386 
TYR CD2 HD2  sing N N 387 
TYR CE1 CZ   doub Y N 388 
TYR CE1 HE1  sing N N 389 
TYR CE2 CZ   sing Y N 390 
TYR CE2 HE2  sing N N 391 
TYR CZ  OH   sing N N 392 
TYR OH  HH   sing N N 393 
TYR OXT HXT  sing N N 394 
VAL N   CA   sing N N 395 
VAL N   H    sing N N 396 
VAL N   H2   sing N N 397 
VAL CA  C    sing N N 398 
VAL CA  CB   sing N N 399 
VAL CA  HA   sing N N 400 
VAL C   O    doub N N 401 
VAL C   OXT  sing N N 402 
VAL CB  CG1  sing N N 403 
VAL CB  CG2  sing N N 404 
VAL CB  HB   sing N N 405 
VAL CG1 HG11 sing N N 406 
VAL CG1 HG12 sing N N 407 
VAL CG1 HG13 sing N N 408 
VAL CG2 HG21 sing N N 409 
VAL CG2 HG22 sing N N 410 
VAL CG2 HG23 sing N N 411 
VAL OXT HXT  sing N N 412 
# 
_pdbx_audit_support.funding_organization   'National Natural Science Foundation of China' 
_pdbx_audit_support.country                China 
_pdbx_audit_support.grant_number           91519304 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2OO1 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    5HJC 
_atom_sites.fract_transf_matrix[1][1]   0.012536 
_atom_sites.fract_transf_matrix[1][2]   0.007238 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014476 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010497 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_