data_5HKX # _entry.id 5HKX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HKX WWPDB D_1000217231 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5HL0 PDB . unspecified 5HKW PDB . unspecified 5HKZ PDB . unspecified 5HKY PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HKX _pdbx_database_status.recvd_initial_deposition_date 2016-01-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lovell, S.' 1 'Battaile, K.P.' 2 'Mehzabeen, N.' 3 'Zhang, N.' 4 'Cooper, A.' 5 'Gao, P.' 6 'Perez, R.P.' 7 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of c-Cbl TKBD-RING domains (Y371E mutant) Refined to 1.85 A Resolution' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, N.' 1 ? primary 'Ferris, D.' 2 ? primary 'Lovell, S.' 3 ? primary 'Smalter-Hall, A.' 4 ? primary 'Battaile, K.P.' 5 ? primary 'Anbanandam, A.' 6 ? primary 'Gao, P.' 7 ? primary 'Hanzlik, R.' 8 ? primary 'Perez, R.P.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 115.310 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5HKX _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.075 _cell.length_a_esd ? _cell.length_b 108.737 _cell.length_b_esd ? _cell.length_c 49.304 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HKX _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase CBL' 45166.898 1 6.3.2.- Y371E 'Tyrosine kinase binding and RING domains (TKBD-RING), residues 47-435' ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 235 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Casitas B-lineage lymphoma proto-oncogene,Proto-oncogene c-Cbl,RING finger protein 55,Signal transduction protein CBL' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLM KKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWK SFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQK FIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKV TQEQYELECEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLM KKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWK SFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQK FIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKV TQEQYELECEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 PRO n 1 5 PRO n 1 6 GLY n 1 7 THR n 1 8 VAL n 1 9 ASP n 1 10 LYS n 1 11 LYS n 1 12 MET n 1 13 VAL n 1 14 GLU n 1 15 LYS n 1 16 CYS n 1 17 TRP n 1 18 LYS n 1 19 LEU n 1 20 MET n 1 21 ASP n 1 22 LYS n 1 23 VAL n 1 24 VAL n 1 25 ARG n 1 26 LEU n 1 27 CYS n 1 28 GLN n 1 29 ASN n 1 30 PRO n 1 31 LYS n 1 32 LEU n 1 33 ALA n 1 34 LEU n 1 35 LYS n 1 36 ASN n 1 37 SER n 1 38 PRO n 1 39 PRO n 1 40 TYR n 1 41 ILE n 1 42 LEU n 1 43 ASP n 1 44 LEU n 1 45 LEU n 1 46 PRO n 1 47 ASP n 1 48 THR n 1 49 TYR n 1 50 GLN n 1 51 HIS n 1 52 LEU n 1 53 ARG n 1 54 THR n 1 55 ILE n 1 56 LEU n 1 57 SER n 1 58 ARG n 1 59 TYR n 1 60 GLU n 1 61 GLY n 1 62 LYS n 1 63 MET n 1 64 GLU n 1 65 THR n 1 66 LEU n 1 67 GLY n 1 68 GLU n 1 69 ASN n 1 70 GLU n 1 71 TYR n 1 72 PHE n 1 73 ARG n 1 74 VAL n 1 75 PHE n 1 76 MET n 1 77 GLU n 1 78 ASN n 1 79 LEU n 1 80 MET n 1 81 LYS n 1 82 LYS n 1 83 THR n 1 84 LYS n 1 85 GLN n 1 86 THR n 1 87 ILE n 1 88 SER n 1 89 LEU n 1 90 PHE n 1 91 LYS n 1 92 GLU n 1 93 GLY n 1 94 LYS n 1 95 GLU n 1 96 ARG n 1 97 MET n 1 98 TYR n 1 99 GLU n 1 100 GLU n 1 101 ASN n 1 102 SER n 1 103 GLN n 1 104 PRO n 1 105 ARG n 1 106 ARG n 1 107 ASN n 1 108 LEU n 1 109 THR n 1 110 LYS n 1 111 LEU n 1 112 SER n 1 113 LEU n 1 114 ILE n 1 115 PHE n 1 116 SER n 1 117 HIS n 1 118 MET n 1 119 LEU n 1 120 ALA n 1 121 GLU n 1 122 LEU n 1 123 LYS n 1 124 GLY n 1 125 ILE n 1 126 PHE n 1 127 PRO n 1 128 SER n 1 129 GLY n 1 130 LEU n 1 131 PHE n 1 132 GLN n 1 133 GLY n 1 134 ASP n 1 135 THR n 1 136 PHE n 1 137 ARG n 1 138 ILE n 1 139 THR n 1 140 LYS n 1 141 ALA n 1 142 ASP n 1 143 ALA n 1 144 ALA n 1 145 GLU n 1 146 PHE n 1 147 TRP n 1 148 ARG n 1 149 LYS n 1 150 ALA n 1 151 PHE n 1 152 GLY n 1 153 GLU n 1 154 LYS n 1 155 THR n 1 156 ILE n 1 157 VAL n 1 158 PRO n 1 159 TRP n 1 160 LYS n 1 161 SER n 1 162 PHE n 1 163 ARG n 1 164 GLN n 1 165 ALA n 1 166 LEU n 1 167 HIS n 1 168 GLU n 1 169 VAL n 1 170 HIS n 1 171 PRO n 1 172 ILE n 1 173 SER n 1 174 SER n 1 175 GLY n 1 176 LEU n 1 177 GLU n 1 178 ALA n 1 179 MET n 1 180 ALA n 1 181 LEU n 1 182 LYS n 1 183 SER n 1 184 THR n 1 185 ILE n 1 186 ASP n 1 187 LEU n 1 188 THR n 1 189 CYS n 1 190 ASN n 1 191 ASP n 1 192 TYR n 1 193 ILE n 1 194 SER n 1 195 VAL n 1 196 PHE n 1 197 GLU n 1 198 PHE n 1 199 ASP n 1 200 ILE n 1 201 PHE n 1 202 THR n 1 203 ARG n 1 204 LEU n 1 205 PHE n 1 206 GLN n 1 207 PRO n 1 208 TRP n 1 209 SER n 1 210 SER n 1 211 LEU n 1 212 LEU n 1 213 ARG n 1 214 ASN n 1 215 TRP n 1 216 ASN n 1 217 SER n 1 218 LEU n 1 219 ALA n 1 220 VAL n 1 221 THR n 1 222 HIS n 1 223 PRO n 1 224 GLY n 1 225 TYR n 1 226 MET n 1 227 ALA n 1 228 PHE n 1 229 LEU n 1 230 THR n 1 231 TYR n 1 232 ASP n 1 233 GLU n 1 234 VAL n 1 235 LYS n 1 236 ALA n 1 237 ARG n 1 238 LEU n 1 239 GLN n 1 240 LYS n 1 241 PHE n 1 242 ILE n 1 243 HIS n 1 244 LYS n 1 245 PRO n 1 246 GLY n 1 247 SER n 1 248 TYR n 1 249 ILE n 1 250 PHE n 1 251 ARG n 1 252 LEU n 1 253 SER n 1 254 CYS n 1 255 THR n 1 256 ARG n 1 257 LEU n 1 258 GLY n 1 259 GLN n 1 260 TRP n 1 261 ALA n 1 262 ILE n 1 263 GLY n 1 264 TYR n 1 265 VAL n 1 266 THR n 1 267 ALA n 1 268 ASP n 1 269 GLY n 1 270 ASN n 1 271 ILE n 1 272 LEU n 1 273 GLN n 1 274 THR n 1 275 ILE n 1 276 PRO n 1 277 HIS n 1 278 ASN n 1 279 LYS n 1 280 PRO n 1 281 LEU n 1 282 PHE n 1 283 GLN n 1 284 ALA n 1 285 LEU n 1 286 ILE n 1 287 ASP n 1 288 GLY n 1 289 PHE n 1 290 ARG n 1 291 GLU n 1 292 GLY n 1 293 PHE n 1 294 TYR n 1 295 LEU n 1 296 PHE n 1 297 PRO n 1 298 ASP n 1 299 GLY n 1 300 ARG n 1 301 ASN n 1 302 GLN n 1 303 ASN n 1 304 PRO n 1 305 ASP n 1 306 LEU n 1 307 THR n 1 308 GLY n 1 309 LEU n 1 310 CYS n 1 311 GLU n 1 312 PRO n 1 313 THR n 1 314 PRO n 1 315 GLN n 1 316 ASP n 1 317 HIS n 1 318 ILE n 1 319 LYS n 1 320 VAL n 1 321 THR n 1 322 GLN n 1 323 GLU n 1 324 GLN n 1 325 TYR n 1 326 GLU n 1 327 LEU n 1 328 GLU n 1 329 CYS n 1 330 GLU n 1 331 MET n 1 332 GLY n 1 333 SER n 1 334 THR n 1 335 PHE n 1 336 GLN n 1 337 LEU n 1 338 CYS n 1 339 LYS n 1 340 ILE n 1 341 CYS n 1 342 ALA n 1 343 GLU n 1 344 ASN n 1 345 ASP n 1 346 LYS n 1 347 ASP n 1 348 VAL n 1 349 LYS n 1 350 ILE n 1 351 GLU n 1 352 PRO n 1 353 CYS n 1 354 GLY n 1 355 HIS n 1 356 LEU n 1 357 MET n 1 358 CYS n 1 359 THR n 1 360 SER n 1 361 CYS n 1 362 LEU n 1 363 THR n 1 364 SER n 1 365 TRP n 1 366 GLN n 1 367 GLU n 1 368 SER n 1 369 GLU n 1 370 GLY n 1 371 GLN n 1 372 GLY n 1 373 CYS n 1 374 PRO n 1 375 PHE n 1 376 CYS n 1 377 ARG n 1 378 CYS n 1 379 GLU n 1 380 ILE n 1 381 LYS n 1 382 GLY n 1 383 THR n 1 384 GLU n 1 385 PRO n 1 386 ILE n 1 387 VAL n 1 388 VAL n 1 389 ASP n 1 390 PRO n 1 391 PHE n 1 392 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 392 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CBL, CBL2, RNF55' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) pLyseS-RARE' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTBSG _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBL_HUMAN _struct_ref.pdbx_db_accession P22681 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKT KQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFR QALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIH KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQE QYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD ; _struct_ref.pdbx_align_begin 47 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HKX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 392 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22681 _struct_ref_seq.db_align_beg 47 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 435 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 47 _struct_ref_seq.pdbx_auth_seq_align_end 435 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HKX SER A 1 ? UNP P22681 ? ? 'expression tag' 44 1 1 5HKX ASN A 2 ? UNP P22681 ? ? 'expression tag' 45 2 1 5HKX ALA A 3 ? UNP P22681 ? ? 'expression tag' 46 3 1 5HKX GLU A 328 ? UNP P22681 TYR 371 'engineered mutation' 371 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HKX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% (w/v) PEG 5000 MME, 0.1M MES, 12% (v/v) 1-propanol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-04-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 23.380 _reflns.entry_id 5HKX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.850 _reflns.d_resolution_low 41.240 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35622 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.400 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 120005 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.850 1.890 ? 1.900 6963 ? ? 2179 ? 99.500 ? ? ? ? 0.613 ? ? ? ? ? ? ? ? 3.200 ? ? ? ? ? ? 0 1 1 0.706 ? 9.060 41.240 ? 43.500 1092 ? ? 311 ? 96.500 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 3.500 ? ? ? ? ? ? 0 2 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 80.050 _refine.B_iso_mean 28.3180 _refine.B_iso_min 11.970 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HKX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8500 _refine.ls_d_res_low 34.4680 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35589 _refine.ls_number_reflns_R_free 1756 _refine.ls_number_reflns_R_work 33833 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4800 _refine.ls_percent_reflns_R_free 4.9300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1690 _refine.ls_R_factor_R_free 0.2136 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1667 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.030 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3BUM _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.0200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8500 _refine_hist.d_res_low 34.4680 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 235 _refine_hist.number_atoms_total 3199 _refine_hist.pdbx_number_residues_total 374 _refine_hist.pdbx_B_iso_mean_ligand 24.26 _refine_hist.pdbx_B_iso_mean_solvent 35.18 _refine_hist.pdbx_number_atoms_protein 2957 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 3059 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.013 ? 4148 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 454 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 531 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.262 ? 1125 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8500 1.9001 2742 . 135 2607 99.0000 . . . 0.3039 . 0.2383 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.9001 1.9560 2709 . 136 2573 100.0000 . . . 0.3069 . 0.2353 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 1.9560 2.0191 2757 . 138 2619 100.0000 . . . 0.2934 . 0.2031 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.0191 2.0912 2723 . 135 2588 100.0000 . . . 0.2429 . 0.1865 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.0912 2.1750 2747 . 127 2620 100.0000 . . . 0.2176 . 0.1694 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.1750 2.2739 2717 . 126 2591 100.0000 . . . 0.2245 . 0.1673 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.2739 2.3938 2744 . 147 2597 100.0000 . . . 0.2097 . 0.1661 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.3938 2.5437 2741 . 134 2607 100.0000 . . . 0.2246 . 0.1641 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.5437 2.7400 2745 . 136 2609 100.0000 . . . 0.2165 . 0.1668 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 2.7400 3.0156 2725 . 131 2594 99.0000 . . . 0.2283 . 0.1748 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.0156 3.4517 2736 . 143 2593 99.0000 . . . 0.2245 . 0.1695 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.4517 4.3474 2740 . 146 2594 99.0000 . . . 0.1817 . 0.1412 . . . . . . 13 . . . 'X-RAY DIFFRACTION' 4.3474 34.4742 2763 . 122 2641 99.0000 . . . 0.1750 . 0.1536 . . . . . . 13 . . . # _struct.entry_id 5HKX _struct.title 'Crystal Structure of c-Cbl TKBD-RING domains (Y371E mutant) Refined to 1.85 A Resolution' _struct.pdbx_descriptor 'E3 ubiquitin-protein ligase CBL (E.C.6.3.2.-)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HKX _struct_keywords.text 'SPRY2, Cbl, Protein-protein interaction, anticancer target, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 9 ? GLN A 28 ? ASP A 52 GLN A 71 1 ? 20 HELX_P HELX_P2 AA2 ASN A 29 ? ALA A 33 ? ASN A 72 ALA A 76 5 ? 5 HELX_P HELX_P3 AA3 TYR A 40 ? TYR A 59 ? TYR A 83 TYR A 102 1 ? 20 HELX_P HELX_P4 AA4 LYS A 62 ? ASN A 69 ? LYS A 105 ASN A 112 1 ? 8 HELX_P HELX_P5 AA5 ASN A 69 ? LYS A 94 ? ASN A 112 LYS A 137 1 ? 26 HELX_P HELX_P6 AA6 GLU A 95 ? GLU A 99 ? GLU A 138 GLU A 142 5 ? 5 HELX_P HELX_P7 AA7 SER A 102 ? PHE A 126 ? SER A 145 PHE A 169 1 ? 25 HELX_P HELX_P8 AA8 PRO A 127 ? LEU A 130 ? PRO A 170 LEU A 173 5 ? 4 HELX_P HELX_P9 AA9 GLN A 132 ? PHE A 136 ? GLN A 175 PHE A 179 5 ? 5 HELX_P HELX_P10 AB1 LYS A 140 ? GLY A 152 ? LYS A 183 GLY A 195 1 ? 13 HELX_P HELX_P11 AB2 TRP A 159 ? GLU A 168 ? TRP A 202 GLU A 211 1 ? 10 HELX_P HELX_P12 AB3 SER A 174 ? ASP A 186 ? SER A 217 ASP A 229 1 ? 13 HELX_P HELX_P13 AB4 VAL A 195 ? PHE A 205 ? VAL A 238 PHE A 248 1 ? 11 HELX_P HELX_P14 AB5 PRO A 207 ? SER A 209 ? PRO A 250 SER A 252 5 ? 3 HELX_P HELX_P15 AB6 SER A 210 ? VAL A 220 ? SER A 253 VAL A 263 1 ? 11 HELX_P HELX_P16 AB7 THR A 230 ? LYS A 240 ? THR A 273 LYS A 283 1 ? 11 HELX_P HELX_P17 AB8 PRO A 280 ? GLU A 291 ? PRO A 323 GLU A 334 1 ? 12 HELX_P HELX_P18 AB9 LEU A 306 ? CYS A 310 ? LEU A 349 CYS A 353 5 ? 5 HELX_P HELX_P19 AC1 THR A 321 ? GLN A 336 ? THR A 364 GLN A 379 1 ? 16 HELX_P HELX_P20 AC2 CYS A 358 ? SER A 368 ? CYS A 401 SER A 411 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 186 OD1 ? ? ? 1_555 E NA . NA ? ? A ASP 229 A NA 504 1_555 ? ? ? ? ? ? ? 2.267 ? metalc2 metalc ? ? A THR 188 OG1 ? ? ? 1_555 E NA . NA ? ? A THR 231 A NA 504 1_555 ? ? ? ? ? ? ? 2.545 ? metalc3 metalc ? ? A ASN 190 OD1 ? ? ? 1_555 E NA . NA ? ? A ASN 233 A NA 504 1_555 ? ? ? ? ? ? ? 2.463 ? metalc4 metalc ? ? A TYR 192 O ? ? ? 1_555 E NA . NA ? ? A TYR 235 A NA 504 1_555 ? ? ? ? ? ? ? 2.407 ? metalc5 metalc ? ? A GLU 197 OE1 ? ? ? 1_555 E NA . NA ? ? A GLU 240 A NA 504 1_555 ? ? ? ? ? ? ? 2.862 ? metalc6 metalc ? ? A GLU 197 OE2 ? ? ? 1_555 E NA . NA ? ? A GLU 240 A NA 504 1_555 ? ? ? ? ? ? ? 2.536 ? metalc7 metalc ? ? A CYS 338 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 381 A ZN 503 1_555 ? ? ? ? ? ? ? 2.342 ? metalc8 metalc ? ? A CYS 341 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 384 A ZN 503 1_555 ? ? ? ? ? ? ? 2.360 ? metalc9 metalc ? ? A CYS 353 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 396 A ZN 502 1_555 ? ? ? ? ? ? ? 2.272 ? metalc10 metalc ? ? A HIS 355 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 398 A ZN 502 1_555 ? ? ? ? ? ? ? 2.013 ? metalc11 metalc ? ? A CYS 358 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 401 A ZN 503 1_555 ? ? ? ? ? ? ? 2.310 ? metalc12 metalc ? ? A CYS 361 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 404 A ZN 503 1_555 ? ? ? ? ? ? ? 2.340 ? metalc13 metalc ? ? A CYS 373 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 416 A ZN 502 1_555 ? ? ? ? ? ? ? 2.350 ? metalc14 metalc ? ? A CYS 376 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 419 A ZN 502 1_555 ? ? ? ? ? ? ? 2.447 ? metalc15 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 504 A HOH 667 1_555 ? ? ? ? ? ? ? 2.569 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 38 A . ? PRO 81 A PRO 39 A ? PRO 82 A 1 -2.58 2 GLN 206 A . ? GLN 249 A PRO 207 A ? PRO 250 A 1 1.36 3 GLU 351 A . ? GLU 394 A PRO 352 A ? PRO 395 A 1 9.76 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 3 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 156 ? PRO A 158 ? ILE A 199 PRO A 201 AA1 2 TYR A 192 ? SER A 194 ? TYR A 235 SER A 237 AA2 1 TYR A 225 ? PHE A 228 ? TYR A 268 PHE A 271 AA2 2 SER A 247 ? LEU A 252 ? SER A 290 LEU A 295 AA2 3 TRP A 260 ? VAL A 265 ? TRP A 303 VAL A 308 AA2 4 ILE A 271 ? THR A 274 ? ILE A 314 THR A 317 AA3 1 TYR A 225 ? PHE A 228 ? TYR A 268 PHE A 271 AA3 2 SER A 247 ? LEU A 252 ? SER A 290 LEU A 295 AA3 3 PHE A 296 ? PRO A 297 ? PHE A 339 PRO A 340 AA4 1 LEU A 356 ? MET A 357 ? LEU A 399 MET A 400 AA4 2 VAL A 348 ? GLU A 351 ? VAL A 391 GLU A 394 AA4 3 GLY A 382 ? PRO A 385 ? GLY A 425 PRO A 428 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 157 ? N VAL A 200 O ILE A 193 ? O ILE A 236 AA2 1 2 N ALA A 227 ? N ALA A 270 O LEU A 252 ? O LEU A 295 AA2 2 3 N ILE A 249 ? N ILE A 292 O GLY A 263 ? O GLY A 306 AA2 3 4 N ILE A 262 ? N ILE A 305 O THR A 274 ? O THR A 317 AA3 1 2 N ALA A 227 ? N ALA A 270 O LEU A 252 ? O LEU A 295 AA3 2 3 N TYR A 248 ? N TYR A 291 O PHE A 296 ? O PHE A 339 AA4 1 2 O MET A 357 ? O MET A 400 N VAL A 348 ? N VAL A 391 AA4 2 3 N GLU A 351 ? N GLU A 394 O GLY A 382 ? O GLY A 425 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 501 ? 6 'binding site for residue EDO A 501' AC2 Software A ZN 502 ? 4 'binding site for residue ZN A 502' AC3 Software A ZN 503 ? 4 'binding site for residue ZN A 503' AC4 Software A NA 504 ? 6 'binding site for residue NA A 504' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LEU A 285 ? LEU A 328 . ? 1_555 ? 2 AC1 6 ASN A 303 ? ASN A 346 . ? 1_555 ? 3 AC1 6 PRO A 304 ? PRO A 347 . ? 1_555 ? 4 AC1 6 ASP A 305 ? ASP A 348 . ? 1_555 ? 5 AC1 6 LEU A 306 ? LEU A 349 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 635 . ? 1_555 ? 7 AC2 4 CYS A 353 ? CYS A 396 . ? 1_555 ? 8 AC2 4 HIS A 355 ? HIS A 398 . ? 1_555 ? 9 AC2 4 CYS A 373 ? CYS A 416 . ? 1_555 ? 10 AC2 4 CYS A 376 ? CYS A 419 . ? 1_555 ? 11 AC3 4 CYS A 338 ? CYS A 381 . ? 1_555 ? 12 AC3 4 CYS A 341 ? CYS A 384 . ? 1_555 ? 13 AC3 4 CYS A 358 ? CYS A 401 . ? 1_555 ? 14 AC3 4 CYS A 361 ? CYS A 404 . ? 1_555 ? 15 AC4 6 ASP A 186 ? ASP A 229 . ? 1_555 ? 16 AC4 6 THR A 188 ? THR A 231 . ? 1_555 ? 17 AC4 6 ASN A 190 ? ASN A 233 . ? 1_555 ? 18 AC4 6 TYR A 192 ? TYR A 235 . ? 1_555 ? 19 AC4 6 GLU A 197 ? GLU A 240 . ? 1_555 ? 20 AC4 6 HOH F . ? HOH A 667 . ? 1_555 ? # _atom_sites.entry_id 5HKX _atom_sites.fract_transf_matrix[1][1] 0.022689 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.010732 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009197 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022437 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N NA O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 44 ? ? ? A . n A 1 2 ASN 2 45 ? ? ? A . n A 1 3 ALA 3 46 ? ? ? A . n A 1 4 PRO 4 47 ? ? ? A . n A 1 5 PRO 5 48 48 PRO PRO A . n A 1 6 GLY 6 49 49 GLY GLY A . n A 1 7 THR 7 50 50 THR THR A . n A 1 8 VAL 8 51 51 VAL VAL A . n A 1 9 ASP 9 52 52 ASP ASP A . n A 1 10 LYS 10 53 53 LYS LYS A . n A 1 11 LYS 11 54 54 LYS LYS A . n A 1 12 MET 12 55 55 MET MET A . n A 1 13 VAL 13 56 56 VAL VAL A . n A 1 14 GLU 14 57 57 GLU GLU A . n A 1 15 LYS 15 58 58 LYS LYS A . n A 1 16 CYS 16 59 59 CYS CYS A . n A 1 17 TRP 17 60 60 TRP TRP A . n A 1 18 LYS 18 61 61 LYS LYS A . n A 1 19 LEU 19 62 62 LEU LEU A . n A 1 20 MET 20 63 63 MET MET A . n A 1 21 ASP 21 64 64 ASP ASP A . n A 1 22 LYS 22 65 65 LYS LYS A . n A 1 23 VAL 23 66 66 VAL VAL A . n A 1 24 VAL 24 67 67 VAL VAL A . n A 1 25 ARG 25 68 68 ARG ARG A . n A 1 26 LEU 26 69 69 LEU LEU A . n A 1 27 CYS 27 70 70 CYS CYS A . n A 1 28 GLN 28 71 71 GLN GLN A . n A 1 29 ASN 29 72 72 ASN ASN A . n A 1 30 PRO 30 73 73 PRO PRO A . n A 1 31 LYS 31 74 74 LYS LYS A . n A 1 32 LEU 32 75 75 LEU LEU A . n A 1 33 ALA 33 76 76 ALA ALA A . n A 1 34 LEU 34 77 77 LEU LEU A . n A 1 35 LYS 35 78 78 LYS LYS A . n A 1 36 ASN 36 79 79 ASN ASN A . n A 1 37 SER 37 80 80 SER SER A . n A 1 38 PRO 38 81 81 PRO PRO A . n A 1 39 PRO 39 82 82 PRO PRO A . n A 1 40 TYR 40 83 83 TYR TYR A . n A 1 41 ILE 41 84 84 ILE ILE A . n A 1 42 LEU 42 85 85 LEU LEU A . n A 1 43 ASP 43 86 86 ASP ASP A . n A 1 44 LEU 44 87 87 LEU LEU A . n A 1 45 LEU 45 88 88 LEU LEU A . n A 1 46 PRO 46 89 89 PRO PRO A . n A 1 47 ASP 47 90 90 ASP ASP A . n A 1 48 THR 48 91 91 THR THR A . n A 1 49 TYR 49 92 92 TYR TYR A . n A 1 50 GLN 50 93 93 GLN GLN A . n A 1 51 HIS 51 94 94 HIS HIS A . n A 1 52 LEU 52 95 95 LEU LEU A . n A 1 53 ARG 53 96 96 ARG ARG A . n A 1 54 THR 54 97 97 THR THR A . n A 1 55 ILE 55 98 98 ILE ILE A . n A 1 56 LEU 56 99 99 LEU LEU A . n A 1 57 SER 57 100 100 SER SER A . n A 1 58 ARG 58 101 101 ARG ARG A . n A 1 59 TYR 59 102 102 TYR TYR A . n A 1 60 GLU 60 103 103 GLU GLU A . n A 1 61 GLY 61 104 104 GLY GLY A . n A 1 62 LYS 62 105 105 LYS LYS A . n A 1 63 MET 63 106 106 MET MET A . n A 1 64 GLU 64 107 107 GLU GLU A . n A 1 65 THR 65 108 108 THR THR A . n A 1 66 LEU 66 109 109 LEU LEU A . n A 1 67 GLY 67 110 110 GLY GLY A . n A 1 68 GLU 68 111 111 GLU GLU A . n A 1 69 ASN 69 112 112 ASN ASN A . n A 1 70 GLU 70 113 113 GLU GLU A . n A 1 71 TYR 71 114 114 TYR TYR A . n A 1 72 PHE 72 115 115 PHE PHE A . n A 1 73 ARG 73 116 116 ARG ARG A . n A 1 74 VAL 74 117 117 VAL VAL A . n A 1 75 PHE 75 118 118 PHE PHE A . n A 1 76 MET 76 119 119 MET MET A . n A 1 77 GLU 77 120 120 GLU GLU A . n A 1 78 ASN 78 121 121 ASN ASN A . n A 1 79 LEU 79 122 122 LEU LEU A . n A 1 80 MET 80 123 123 MET MET A . n A 1 81 LYS 81 124 124 LYS LYS A . n A 1 82 LYS 82 125 125 LYS LYS A . n A 1 83 THR 83 126 126 THR THR A . n A 1 84 LYS 84 127 127 LYS LYS A . n A 1 85 GLN 85 128 128 GLN GLN A . n A 1 86 THR 86 129 129 THR THR A . n A 1 87 ILE 87 130 130 ILE ILE A . n A 1 88 SER 88 131 131 SER SER A . n A 1 89 LEU 89 132 132 LEU LEU A . n A 1 90 PHE 90 133 133 PHE PHE A . n A 1 91 LYS 91 134 134 LYS LYS A . n A 1 92 GLU 92 135 135 GLU GLU A . n A 1 93 GLY 93 136 136 GLY GLY A . n A 1 94 LYS 94 137 137 LYS LYS A . n A 1 95 GLU 95 138 138 GLU GLU A . n A 1 96 ARG 96 139 139 ARG ARG A . n A 1 97 MET 97 140 140 MET MET A . n A 1 98 TYR 98 141 141 TYR TYR A . n A 1 99 GLU 99 142 142 GLU GLU A . n A 1 100 GLU 100 143 143 GLU GLU A . n A 1 101 ASN 101 144 144 ASN ASN A . n A 1 102 SER 102 145 145 SER SER A . n A 1 103 GLN 103 146 146 GLN GLN A . n A 1 104 PRO 104 147 147 PRO PRO A . n A 1 105 ARG 105 148 148 ARG ARG A . n A 1 106 ARG 106 149 149 ARG ARG A . n A 1 107 ASN 107 150 150 ASN ASN A . n A 1 108 LEU 108 151 151 LEU LEU A . n A 1 109 THR 109 152 152 THR THR A . n A 1 110 LYS 110 153 153 LYS LYS A . n A 1 111 LEU 111 154 154 LEU LEU A . n A 1 112 SER 112 155 155 SER SER A . n A 1 113 LEU 113 156 156 LEU LEU A . n A 1 114 ILE 114 157 157 ILE ILE A . n A 1 115 PHE 115 158 158 PHE PHE A . n A 1 116 SER 116 159 159 SER SER A . n A 1 117 HIS 117 160 160 HIS HIS A . n A 1 118 MET 118 161 161 MET MET A . n A 1 119 LEU 119 162 162 LEU LEU A . n A 1 120 ALA 120 163 163 ALA ALA A . n A 1 121 GLU 121 164 164 GLU GLU A . n A 1 122 LEU 122 165 165 LEU LEU A . n A 1 123 LYS 123 166 166 LYS LYS A . n A 1 124 GLY 124 167 167 GLY GLY A . n A 1 125 ILE 125 168 168 ILE ILE A . n A 1 126 PHE 126 169 169 PHE PHE A . n A 1 127 PRO 127 170 170 PRO PRO A . n A 1 128 SER 128 171 171 SER SER A . n A 1 129 GLY 129 172 172 GLY GLY A . n A 1 130 LEU 130 173 173 LEU LEU A . n A 1 131 PHE 131 174 174 PHE PHE A . n A 1 132 GLN 132 175 175 GLN GLN A . n A 1 133 GLY 133 176 176 GLY GLY A . n A 1 134 ASP 134 177 177 ASP ASP A . n A 1 135 THR 135 178 178 THR THR A . n A 1 136 PHE 136 179 179 PHE PHE A . n A 1 137 ARG 137 180 180 ARG ARG A . n A 1 138 ILE 138 181 181 ILE ILE A . n A 1 139 THR 139 182 182 THR THR A . n A 1 140 LYS 140 183 183 LYS LYS A . n A 1 141 ALA 141 184 184 ALA ALA A . n A 1 142 ASP 142 185 185 ASP ASP A . n A 1 143 ALA 143 186 186 ALA ALA A . n A 1 144 ALA 144 187 187 ALA ALA A . n A 1 145 GLU 145 188 188 GLU GLU A . n A 1 146 PHE 146 189 189 PHE PHE A . n A 1 147 TRP 147 190 190 TRP TRP A . n A 1 148 ARG 148 191 191 ARG ARG A . n A 1 149 LYS 149 192 192 LYS LYS A . n A 1 150 ALA 150 193 193 ALA ALA A . n A 1 151 PHE 151 194 194 PHE PHE A . n A 1 152 GLY 152 195 195 GLY GLY A . n A 1 153 GLU 153 196 196 GLU GLU A . n A 1 154 LYS 154 197 197 LYS LYS A . n A 1 155 THR 155 198 198 THR THR A . n A 1 156 ILE 156 199 199 ILE ILE A . n A 1 157 VAL 157 200 200 VAL VAL A . n A 1 158 PRO 158 201 201 PRO PRO A . n A 1 159 TRP 159 202 202 TRP TRP A . n A 1 160 LYS 160 203 203 LYS LYS A . n A 1 161 SER 161 204 204 SER SER A . n A 1 162 PHE 162 205 205 PHE PHE A . n A 1 163 ARG 163 206 206 ARG ARG A . n A 1 164 GLN 164 207 207 GLN GLN A . n A 1 165 ALA 165 208 208 ALA ALA A . n A 1 166 LEU 166 209 209 LEU LEU A . n A 1 167 HIS 167 210 210 HIS HIS A . n A 1 168 GLU 168 211 211 GLU GLU A . n A 1 169 VAL 169 212 212 VAL VAL A . n A 1 170 HIS 170 213 213 HIS HIS A . n A 1 171 PRO 171 214 214 PRO PRO A . n A 1 172 ILE 172 215 215 ILE ILE A . n A 1 173 SER 173 216 216 SER SER A . n A 1 174 SER 174 217 217 SER SER A . n A 1 175 GLY 175 218 218 GLY GLY A . n A 1 176 LEU 176 219 219 LEU LEU A . n A 1 177 GLU 177 220 220 GLU GLU A . n A 1 178 ALA 178 221 221 ALA ALA A . n A 1 179 MET 179 222 222 MET MET A . n A 1 180 ALA 180 223 223 ALA ALA A . n A 1 181 LEU 181 224 224 LEU LEU A . n A 1 182 LYS 182 225 225 LYS LYS A . n A 1 183 SER 183 226 226 SER SER A . n A 1 184 THR 184 227 227 THR THR A . n A 1 185 ILE 185 228 228 ILE ILE A . n A 1 186 ASP 186 229 229 ASP ASP A . n A 1 187 LEU 187 230 230 LEU LEU A . n A 1 188 THR 188 231 231 THR THR A . n A 1 189 CYS 189 232 232 CYS CYS A . n A 1 190 ASN 190 233 233 ASN ASN A . n A 1 191 ASP 191 234 234 ASP ASP A . n A 1 192 TYR 192 235 235 TYR TYR A . n A 1 193 ILE 193 236 236 ILE ILE A . n A 1 194 SER 194 237 237 SER SER A . n A 1 195 VAL 195 238 238 VAL VAL A . n A 1 196 PHE 196 239 239 PHE PHE A . n A 1 197 GLU 197 240 240 GLU GLU A . n A 1 198 PHE 198 241 241 PHE PHE A . n A 1 199 ASP 199 242 242 ASP ASP A . n A 1 200 ILE 200 243 243 ILE ILE A . n A 1 201 PHE 201 244 244 PHE PHE A . n A 1 202 THR 202 245 245 THR THR A . n A 1 203 ARG 203 246 246 ARG ARG A . n A 1 204 LEU 204 247 247 LEU LEU A . n A 1 205 PHE 205 248 248 PHE PHE A . n A 1 206 GLN 206 249 249 GLN GLN A . n A 1 207 PRO 207 250 250 PRO PRO A . n A 1 208 TRP 208 251 251 TRP TRP A . n A 1 209 SER 209 252 252 SER SER A . n A 1 210 SER 210 253 253 SER SER A . n A 1 211 LEU 211 254 254 LEU LEU A . n A 1 212 LEU 212 255 255 LEU LEU A . n A 1 213 ARG 213 256 256 ARG ARG A . n A 1 214 ASN 214 257 257 ASN ASN A . n A 1 215 TRP 215 258 258 TRP TRP A . n A 1 216 ASN 216 259 259 ASN ASN A . n A 1 217 SER 217 260 260 SER SER A . n A 1 218 LEU 218 261 261 LEU LEU A . n A 1 219 ALA 219 262 262 ALA ALA A . n A 1 220 VAL 220 263 263 VAL VAL A . n A 1 221 THR 221 264 264 THR THR A . n A 1 222 HIS 222 265 265 HIS HIS A . n A 1 223 PRO 223 266 266 PRO PRO A . n A 1 224 GLY 224 267 267 GLY GLY A . n A 1 225 TYR 225 268 268 TYR TYR A . n A 1 226 MET 226 269 269 MET MET A . n A 1 227 ALA 227 270 270 ALA ALA A . n A 1 228 PHE 228 271 271 PHE PHE A . n A 1 229 LEU 229 272 272 LEU LEU A . n A 1 230 THR 230 273 273 THR THR A . n A 1 231 TYR 231 274 274 TYR TYR A . n A 1 232 ASP 232 275 275 ASP ASP A . n A 1 233 GLU 233 276 276 GLU GLU A . n A 1 234 VAL 234 277 277 VAL VAL A . n A 1 235 LYS 235 278 278 LYS LYS A . n A 1 236 ALA 236 279 279 ALA ALA A . n A 1 237 ARG 237 280 280 ARG ARG A . n A 1 238 LEU 238 281 281 LEU LEU A . n A 1 239 GLN 239 282 282 GLN GLN A . n A 1 240 LYS 240 283 283 LYS LYS A . n A 1 241 PHE 241 284 284 PHE PHE A . n A 1 242 ILE 242 285 285 ILE ILE A . n A 1 243 HIS 243 286 286 HIS HIS A . n A 1 244 LYS 244 287 287 LYS LYS A . n A 1 245 PRO 245 288 288 PRO PRO A . n A 1 246 GLY 246 289 289 GLY GLY A . n A 1 247 SER 247 290 290 SER SER A . n A 1 248 TYR 248 291 291 TYR TYR A . n A 1 249 ILE 249 292 292 ILE ILE A . n A 1 250 PHE 250 293 293 PHE PHE A . n A 1 251 ARG 251 294 294 ARG ARG A . n A 1 252 LEU 252 295 295 LEU LEU A . n A 1 253 SER 253 296 296 SER SER A . n A 1 254 CYS 254 297 297 CYS CYS A . n A 1 255 THR 255 298 298 THR THR A . n A 1 256 ARG 256 299 299 ARG ARG A . n A 1 257 LEU 257 300 300 LEU LEU A . n A 1 258 GLY 258 301 301 GLY GLY A . n A 1 259 GLN 259 302 302 GLN GLN A . n A 1 260 TRP 260 303 303 TRP TRP A . n A 1 261 ALA 261 304 304 ALA ALA A . n A 1 262 ILE 262 305 305 ILE ILE A . n A 1 263 GLY 263 306 306 GLY GLY A . n A 1 264 TYR 264 307 307 TYR TYR A . n A 1 265 VAL 265 308 308 VAL VAL A . n A 1 266 THR 266 309 309 THR THR A . n A 1 267 ALA 267 310 310 ALA ALA A . n A 1 268 ASP 268 311 311 ASP ASP A . n A 1 269 GLY 269 312 312 GLY GLY A . n A 1 270 ASN 270 313 313 ASN ASN A . n A 1 271 ILE 271 314 314 ILE ILE A . n A 1 272 LEU 272 315 315 LEU LEU A . n A 1 273 GLN 273 316 316 GLN GLN A . n A 1 274 THR 274 317 317 THR THR A . n A 1 275 ILE 275 318 318 ILE ILE A . n A 1 276 PRO 276 319 319 PRO PRO A . n A 1 277 HIS 277 320 320 HIS HIS A . n A 1 278 ASN 278 321 321 ASN ASN A . n A 1 279 LYS 279 322 322 LYS LYS A . n A 1 280 PRO 280 323 323 PRO PRO A . n A 1 281 LEU 281 324 324 LEU LEU A . n A 1 282 PHE 282 325 325 PHE PHE A . n A 1 283 GLN 283 326 326 GLN GLN A . n A 1 284 ALA 284 327 327 ALA ALA A . n A 1 285 LEU 285 328 328 LEU LEU A . n A 1 286 ILE 286 329 329 ILE ILE A . n A 1 287 ASP 287 330 330 ASP ASP A . n A 1 288 GLY 288 331 331 GLY GLY A . n A 1 289 PHE 289 332 332 PHE PHE A . n A 1 290 ARG 290 333 333 ARG ARG A . n A 1 291 GLU 291 334 334 GLU GLU A . n A 1 292 GLY 292 335 335 GLY GLY A . n A 1 293 PHE 293 336 336 PHE PHE A . n A 1 294 TYR 294 337 337 TYR TYR A . n A 1 295 LEU 295 338 338 LEU LEU A . n A 1 296 PHE 296 339 339 PHE PHE A . n A 1 297 PRO 297 340 340 PRO PRO A . n A 1 298 ASP 298 341 341 ASP ASP A . n A 1 299 GLY 299 342 342 GLY GLY A . n A 1 300 ARG 300 343 343 ARG ARG A . n A 1 301 ASN 301 344 344 ASN ASN A . n A 1 302 GLN 302 345 345 GLN GLN A . n A 1 303 ASN 303 346 346 ASN ASN A . n A 1 304 PRO 304 347 347 PRO PRO A . n A 1 305 ASP 305 348 348 ASP ASP A . n A 1 306 LEU 306 349 349 LEU LEU A . n A 1 307 THR 307 350 350 THR THR A . n A 1 308 GLY 308 351 351 GLY GLY A . n A 1 309 LEU 309 352 352 LEU LEU A . n A 1 310 CYS 310 353 353 CYS CYS A . n A 1 311 GLU 311 354 354 GLU GLU A . n A 1 312 PRO 312 355 ? ? ? A . n A 1 313 THR 313 356 ? ? ? A . n A 1 314 PRO 314 357 ? ? ? A . n A 1 315 GLN 315 358 ? ? ? A . n A 1 316 ASP 316 359 ? ? ? A . n A 1 317 HIS 317 360 ? ? ? A . n A 1 318 ILE 318 361 ? ? ? A . n A 1 319 LYS 319 362 ? ? ? A . n A 1 320 VAL 320 363 363 VAL VAL A . n A 1 321 THR 321 364 364 THR THR A . n A 1 322 GLN 322 365 365 GLN GLN A . n A 1 323 GLU 323 366 366 GLU GLU A . n A 1 324 GLN 324 367 367 GLN GLN A . n A 1 325 TYR 325 368 368 TYR TYR A . n A 1 326 GLU 326 369 369 GLU GLU A . n A 1 327 LEU 327 370 370 LEU LEU A . n A 1 328 GLU 328 371 371 GLU GLU A . n A 1 329 CYS 329 372 372 CYS CYS A . n A 1 330 GLU 330 373 373 GLU GLU A . n A 1 331 MET 331 374 374 MET MET A . n A 1 332 GLY 332 375 375 GLY GLY A . n A 1 333 SER 333 376 376 SER SER A . n A 1 334 THR 334 377 377 THR THR A . n A 1 335 PHE 335 378 378 PHE PHE A . n A 1 336 GLN 336 379 379 GLN GLN A . n A 1 337 LEU 337 380 380 LEU LEU A . n A 1 338 CYS 338 381 381 CYS CYS A . n A 1 339 LYS 339 382 382 LYS LYS A . n A 1 340 ILE 340 383 383 ILE ILE A . n A 1 341 CYS 341 384 384 CYS CYS A . n A 1 342 ALA 342 385 385 ALA ALA A . n A 1 343 GLU 343 386 386 GLU GLU A . n A 1 344 ASN 344 387 387 ASN ASN A . n A 1 345 ASP 345 388 388 ASP ASP A . n A 1 346 LYS 346 389 389 LYS LYS A . n A 1 347 ASP 347 390 390 ASP ASP A . n A 1 348 VAL 348 391 391 VAL VAL A . n A 1 349 LYS 349 392 392 LYS LYS A . n A 1 350 ILE 350 393 393 ILE ILE A . n A 1 351 GLU 351 394 394 GLU GLU A . n A 1 352 PRO 352 395 395 PRO PRO A . n A 1 353 CYS 353 396 396 CYS CYS A . n A 1 354 GLY 354 397 397 GLY GLY A . n A 1 355 HIS 355 398 398 HIS HIS A . n A 1 356 LEU 356 399 399 LEU LEU A . n A 1 357 MET 357 400 400 MET MET A . n A 1 358 CYS 358 401 401 CYS CYS A . n A 1 359 THR 359 402 402 THR THR A . n A 1 360 SER 360 403 403 SER SER A . n A 1 361 CYS 361 404 404 CYS CYS A . n A 1 362 LEU 362 405 405 LEU LEU A . n A 1 363 THR 363 406 406 THR THR A . n A 1 364 SER 364 407 407 SER SER A . n A 1 365 TRP 365 408 408 TRP TRP A . n A 1 366 GLN 366 409 409 GLN GLN A . n A 1 367 GLU 367 410 410 GLU GLU A . n A 1 368 SER 368 411 411 SER SER A . n A 1 369 GLU 369 412 412 GLU GLU A . n A 1 370 GLY 370 413 413 GLY GLY A . n A 1 371 GLN 371 414 414 GLN GLN A . n A 1 372 GLY 372 415 415 GLY GLY A . n A 1 373 CYS 373 416 416 CYS CYS A . n A 1 374 PRO 374 417 417 PRO PRO A . n A 1 375 PHE 375 418 418 PHE PHE A . n A 1 376 CYS 376 419 419 CYS CYS A . n A 1 377 ARG 377 420 420 ARG ARG A . n A 1 378 CYS 378 421 421 CYS CYS A . n A 1 379 GLU 379 422 422 GLU GLU A . n A 1 380 ILE 380 423 423 ILE ILE A . n A 1 381 LYS 381 424 424 LYS LYS A . n A 1 382 GLY 382 425 425 GLY GLY A . n A 1 383 THR 383 426 426 THR THR A . n A 1 384 GLU 384 427 427 GLU GLU A . n A 1 385 PRO 385 428 428 PRO PRO A . n A 1 386 ILE 386 429 429 ILE ILE A . n A 1 387 VAL 387 430 ? ? ? A . n A 1 388 VAL 388 431 ? ? ? A . n A 1 389 ASP 389 432 ? ? ? A . n A 1 390 PRO 390 433 ? ? ? A . n A 1 391 PHE 391 434 ? ? ? A . n A 1 392 ASP 392 435 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 501 1 EDO EDO A . C 3 ZN 1 502 1 ZN ZN A . D 3 ZN 1 503 2 ZN ZN A . E 4 NA 1 504 1 NA NA A . F 5 HOH 1 601 193 HOH HOH A . F 5 HOH 2 602 232 HOH HOH A . F 5 HOH 3 603 201 HOH HOH A . F 5 HOH 4 604 195 HOH HOH A . F 5 HOH 5 605 99 HOH HOH A . F 5 HOH 6 606 125 HOH HOH A . F 5 HOH 7 607 137 HOH HOH A . F 5 HOH 8 608 230 HOH HOH A . F 5 HOH 9 609 10 HOH HOH A . F 5 HOH 10 610 214 HOH HOH A . F 5 HOH 11 611 169 HOH HOH A . F 5 HOH 12 612 209 HOH HOH A . F 5 HOH 13 613 157 HOH HOH A . F 5 HOH 14 614 160 HOH HOH A . F 5 HOH 15 615 152 HOH HOH A . F 5 HOH 16 616 147 HOH HOH A . F 5 HOH 17 617 139 HOH HOH A . F 5 HOH 18 618 67 HOH HOH A . F 5 HOH 19 619 145 HOH HOH A . F 5 HOH 20 620 72 HOH HOH A . F 5 HOH 21 621 5 HOH HOH A . F 5 HOH 22 622 39 HOH HOH A . F 5 HOH 23 623 194 HOH HOH A . F 5 HOH 24 624 59 HOH HOH A . F 5 HOH 25 625 28 HOH HOH A . F 5 HOH 26 626 190 HOH HOH A . F 5 HOH 27 627 71 HOH HOH A . F 5 HOH 28 628 128 HOH HOH A . F 5 HOH 29 629 89 HOH HOH A . F 5 HOH 30 630 24 HOH HOH A . F 5 HOH 31 631 84 HOH HOH A . F 5 HOH 32 632 181 HOH HOH A . F 5 HOH 33 633 178 HOH HOH A . F 5 HOH 34 634 82 HOH HOH A . F 5 HOH 35 635 32 HOH HOH A . F 5 HOH 36 636 171 HOH HOH A . F 5 HOH 37 637 136 HOH HOH A . F 5 HOH 38 638 80 HOH HOH A . F 5 HOH 39 639 35 HOH HOH A . F 5 HOH 40 640 180 HOH HOH A . F 5 HOH 41 641 49 HOH HOH A . F 5 HOH 42 642 108 HOH HOH A . F 5 HOH 43 643 53 HOH HOH A . F 5 HOH 44 644 120 HOH HOH A . F 5 HOH 45 645 4 HOH HOH A . F 5 HOH 46 646 188 HOH HOH A . F 5 HOH 47 647 76 HOH HOH A . F 5 HOH 48 648 7 HOH HOH A . F 5 HOH 49 649 12 HOH HOH A . F 5 HOH 50 650 204 HOH HOH A . F 5 HOH 51 651 69 HOH HOH A . F 5 HOH 52 652 121 HOH HOH A . F 5 HOH 53 653 192 HOH HOH A . F 5 HOH 54 654 111 HOH HOH A . F 5 HOH 55 655 189 HOH HOH A . F 5 HOH 56 656 98 HOH HOH A . F 5 HOH 57 657 149 HOH HOH A . F 5 HOH 58 658 113 HOH HOH A . F 5 HOH 59 659 94 HOH HOH A . F 5 HOH 60 660 109 HOH HOH A . F 5 HOH 61 661 115 HOH HOH A . F 5 HOH 62 662 144 HOH HOH A . F 5 HOH 63 663 21 HOH HOH A . F 5 HOH 64 664 148 HOH HOH A . F 5 HOH 65 665 119 HOH HOH A . F 5 HOH 66 666 191 HOH HOH A . F 5 HOH 67 667 6 HOH HOH A . F 5 HOH 68 668 179 HOH HOH A . F 5 HOH 69 669 77 HOH HOH A . F 5 HOH 70 670 37 HOH HOH A . F 5 HOH 71 671 146 HOH HOH A . F 5 HOH 72 672 13 HOH HOH A . F 5 HOH 73 673 3 HOH HOH A . F 5 HOH 74 674 86 HOH HOH A . F 5 HOH 75 675 36 HOH HOH A . F 5 HOH 76 676 208 HOH HOH A . F 5 HOH 77 677 186 HOH HOH A . F 5 HOH 78 678 43 HOH HOH A . F 5 HOH 79 679 133 HOH HOH A . F 5 HOH 80 680 15 HOH HOH A . F 5 HOH 81 681 40 HOH HOH A . F 5 HOH 82 682 153 HOH HOH A . F 5 HOH 83 683 58 HOH HOH A . F 5 HOH 84 684 138 HOH HOH A . F 5 HOH 85 685 74 HOH HOH A . F 5 HOH 86 686 31 HOH HOH A . F 5 HOH 87 687 134 HOH HOH A . F 5 HOH 88 688 17 HOH HOH A . F 5 HOH 89 689 16 HOH HOH A . F 5 HOH 90 690 65 HOH HOH A . F 5 HOH 91 691 41 HOH HOH A . F 5 HOH 92 692 131 HOH HOH A . F 5 HOH 93 693 38 HOH HOH A . F 5 HOH 94 694 42 HOH HOH A . F 5 HOH 95 695 2 HOH HOH A . F 5 HOH 96 696 101 HOH HOH A . F 5 HOH 97 697 229 HOH HOH A . F 5 HOH 98 698 158 HOH HOH A . F 5 HOH 99 699 141 HOH HOH A . F 5 HOH 100 700 18 HOH HOH A . F 5 HOH 101 701 23 HOH HOH A . F 5 HOH 102 702 14 HOH HOH A . F 5 HOH 103 703 63 HOH HOH A . F 5 HOH 104 704 57 HOH HOH A . F 5 HOH 105 705 123 HOH HOH A . F 5 HOH 106 706 87 HOH HOH A . F 5 HOH 107 707 132 HOH HOH A . F 5 HOH 108 708 19 HOH HOH A . F 5 HOH 109 709 26 HOH HOH A . F 5 HOH 110 710 129 HOH HOH A . F 5 HOH 111 711 73 HOH HOH A . F 5 HOH 112 712 212 HOH HOH A . F 5 HOH 113 713 45 HOH HOH A . F 5 HOH 114 714 81 HOH HOH A . F 5 HOH 115 715 166 HOH HOH A . F 5 HOH 116 716 83 HOH HOH A . F 5 HOH 117 717 34 HOH HOH A . F 5 HOH 118 718 85 HOH HOH A . F 5 HOH 119 719 210 HOH HOH A . F 5 HOH 120 720 235 HOH HOH A . F 5 HOH 121 721 162 HOH HOH A . F 5 HOH 122 722 68 HOH HOH A . F 5 HOH 123 723 70 HOH HOH A . F 5 HOH 124 724 9 HOH HOH A . F 5 HOH 125 725 93 HOH HOH A . F 5 HOH 126 726 225 HOH HOH A . F 5 HOH 127 727 91 HOH HOH A . F 5 HOH 128 728 46 HOH HOH A . F 5 HOH 129 729 102 HOH HOH A . F 5 HOH 130 730 100 HOH HOH A . F 5 HOH 131 731 161 HOH HOH A . F 5 HOH 132 732 233 HOH HOH A . F 5 HOH 133 733 127 HOH HOH A . F 5 HOH 134 734 185 HOH HOH A . F 5 HOH 135 735 164 HOH HOH A . F 5 HOH 136 736 176 HOH HOH A . F 5 HOH 137 737 54 HOH HOH A . F 5 HOH 138 738 50 HOH HOH A . F 5 HOH 139 739 182 HOH HOH A . F 5 HOH 140 740 103 HOH HOH A . F 5 HOH 141 741 231 HOH HOH A . F 5 HOH 142 742 142 HOH HOH A . F 5 HOH 143 743 112 HOH HOH A . F 5 HOH 144 744 90 HOH HOH A . F 5 HOH 145 745 20 HOH HOH A . F 5 HOH 146 746 11 HOH HOH A . F 5 HOH 147 747 150 HOH HOH A . F 5 HOH 148 748 27 HOH HOH A . F 5 HOH 149 749 78 HOH HOH A . F 5 HOH 150 750 33 HOH HOH A . F 5 HOH 151 751 30 HOH HOH A . F 5 HOH 152 752 197 HOH HOH A . F 5 HOH 153 753 44 HOH HOH A . F 5 HOH 154 754 143 HOH HOH A . F 5 HOH 155 755 124 HOH HOH A . F 5 HOH 156 756 118 HOH HOH A . F 5 HOH 157 757 110 HOH HOH A . F 5 HOH 158 758 107 HOH HOH A . F 5 HOH 159 759 1 HOH HOH A . F 5 HOH 160 760 173 HOH HOH A . F 5 HOH 161 761 170 HOH HOH A . F 5 HOH 162 762 79 HOH HOH A . F 5 HOH 163 763 47 HOH HOH A . F 5 HOH 164 764 203 HOH HOH A . F 5 HOH 165 765 177 HOH HOH A . F 5 HOH 166 766 22 HOH HOH A . F 5 HOH 167 767 88 HOH HOH A . F 5 HOH 168 768 183 HOH HOH A . F 5 HOH 169 769 207 HOH HOH A . F 5 HOH 170 770 206 HOH HOH A . F 5 HOH 171 771 8 HOH HOH A . F 5 HOH 172 772 151 HOH HOH A . F 5 HOH 173 773 130 HOH HOH A . F 5 HOH 174 774 75 HOH HOH A . F 5 HOH 175 775 66 HOH HOH A . F 5 HOH 176 776 52 HOH HOH A . F 5 HOH 177 777 117 HOH HOH A . F 5 HOH 178 778 200 HOH HOH A . F 5 HOH 179 779 196 HOH HOH A . F 5 HOH 180 780 92 HOH HOH A . F 5 HOH 181 781 226 HOH HOH A . F 5 HOH 182 782 29 HOH HOH A . F 5 HOH 183 783 61 HOH HOH A . F 5 HOH 184 784 202 HOH HOH A . F 5 HOH 185 785 51 HOH HOH A . F 5 HOH 186 786 211 HOH HOH A . F 5 HOH 187 787 64 HOH HOH A . F 5 HOH 188 788 96 HOH HOH A . F 5 HOH 189 789 228 HOH HOH A . F 5 HOH 190 790 156 HOH HOH A . F 5 HOH 191 791 198 HOH HOH A . F 5 HOH 192 792 205 HOH HOH A . F 5 HOH 193 793 60 HOH HOH A . F 5 HOH 194 794 56 HOH HOH A . F 5 HOH 195 795 184 HOH HOH A . F 5 HOH 196 796 48 HOH HOH A . F 5 HOH 197 797 159 HOH HOH A . F 5 HOH 198 798 95 HOH HOH A . F 5 HOH 199 799 140 HOH HOH A . F 5 HOH 200 800 97 HOH HOH A . F 5 HOH 201 801 168 HOH HOH A . F 5 HOH 202 802 154 HOH HOH A . F 5 HOH 203 803 218 HOH HOH A . F 5 HOH 204 804 104 HOH HOH A . F 5 HOH 205 805 163 HOH HOH A . F 5 HOH 206 806 116 HOH HOH A . F 5 HOH 207 807 174 HOH HOH A . F 5 HOH 208 808 55 HOH HOH A . F 5 HOH 209 809 62 HOH HOH A . F 5 HOH 210 810 234 HOH HOH A . F 5 HOH 211 811 167 HOH HOH A . F 5 HOH 212 812 227 HOH HOH A . F 5 HOH 213 813 106 HOH HOH A . F 5 HOH 214 814 155 HOH HOH A . F 5 HOH 215 815 126 HOH HOH A . F 5 HOH 216 816 220 HOH HOH A . F 5 HOH 217 817 187 HOH HOH A . F 5 HOH 218 818 221 HOH HOH A . F 5 HOH 219 819 222 HOH HOH A . F 5 HOH 220 820 114 HOH HOH A . F 5 HOH 221 821 165 HOH HOH A . F 5 HOH 222 822 122 HOH HOH A . F 5 HOH 223 823 216 HOH HOH A . F 5 HOH 224 824 223 HOH HOH A . F 5 HOH 225 825 175 HOH HOH A . F 5 HOH 226 826 25 HOH HOH A . F 5 HOH 227 827 219 HOH HOH A . F 5 HOH 228 828 217 HOH HOH A . F 5 HOH 229 829 135 HOH HOH A . F 5 HOH 230 830 105 HOH HOH A . F 5 HOH 231 831 199 HOH HOH A . F 5 HOH 232 832 215 HOH HOH A . F 5 HOH 233 833 213 HOH HOH A . F 5 HOH 234 834 172 HOH HOH A . F 5 HOH 235 835 224 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OG1 ? A THR 188 ? A THR 231 ? 1_555 103.1 ? 2 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 90.1 ? 3 OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 76.4 ? 4 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? A TYR 192 ? A TYR 235 ? 1_555 92.6 ? 5 OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? A TYR 192 ? A TYR 235 ? 1_555 156.2 ? 6 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? A TYR 192 ? A TYR 235 ? 1_555 85.8 ? 7 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 116.8 ? 8 OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 113.7 ? 9 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 146.1 ? 10 O ? A TYR 192 ? A TYR 235 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 73.4 ? 11 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 92.6 ? 12 OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 81.9 ? 13 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 158.2 ? 14 O ? A TYR 192 ? A TYR 235 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 115.6 ? 15 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 47.8 ? 16 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? F HOH . ? A HOH 667 ? 1_555 175.9 ? 17 OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? F HOH . ? A HOH 667 ? 1_555 76.7 ? 18 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? F HOH . ? A HOH 667 ? 1_555 93.8 ? 19 O ? A TYR 192 ? A TYR 235 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? F HOH . ? A HOH 667 ? 1_555 89.0 ? 20 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? F HOH . ? A HOH 667 ? 1_555 60.1 ? 21 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 NA ? E NA . ? A NA 504 ? 1_555 O ? F HOH . ? A HOH 667 ? 1_555 83.3 ? 22 SG ? A CYS 338 ? A CYS 381 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 341 ? A CYS 384 ? 1_555 107.5 ? 23 SG ? A CYS 338 ? A CYS 381 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 358 ? A CYS 401 ? 1_555 114.8 ? 24 SG ? A CYS 341 ? A CYS 384 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 358 ? A CYS 401 ? 1_555 110.5 ? 25 SG ? A CYS 338 ? A CYS 381 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 361 ? A CYS 404 ? 1_555 113.0 ? 26 SG ? A CYS 341 ? A CYS 384 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 361 ? A CYS 404 ? 1_555 107.2 ? 27 SG ? A CYS 358 ? A CYS 401 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 SG ? A CYS 361 ? A CYS 404 ? 1_555 103.5 ? 28 SG ? A CYS 353 ? A CYS 396 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 ND1 ? A HIS 355 ? A HIS 398 ? 1_555 103.9 ? 29 SG ? A CYS 353 ? A CYS 396 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 373 ? A CYS 416 ? 1_555 108.5 ? 30 ND1 ? A HIS 355 ? A HIS 398 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 373 ? A CYS 416 ? 1_555 117.8 ? 31 SG ? A CYS 353 ? A CYS 396 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 376 ? A CYS 419 ? 1_555 108.5 ? 32 ND1 ? A HIS 355 ? A HIS 398 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 376 ? A CYS 419 ? 1_555 107.0 ? 33 SG ? A CYS 373 ? A CYS 416 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 376 ? A CYS 419 ? 1_555 110.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-18 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2019-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.17 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 728 ? ? O A HOH 812 ? ? 2.08 2 1 O A HOH 784 ? ? O A HOH 811 ? ? 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 79 ? ? -64.98 8.15 2 1 LYS A 105 ? ? -140.99 28.42 3 1 LYS A 137 ? ? 53.40 -133.17 4 1 SER A 171 ? ? 59.64 16.33 5 1 ALA A 270 ? ? 59.83 -143.16 6 1 GLU A 386 ? ? -134.54 -59.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 54 ? CD ? A LYS 11 CD 2 1 Y 1 A LYS 54 ? CE ? A LYS 11 CE 3 1 Y 1 A LYS 54 ? NZ ? A LYS 11 NZ 4 1 Y 1 A LYS 58 ? CD ? A LYS 15 CD 5 1 Y 1 A LYS 58 ? CE ? A LYS 15 CE 6 1 Y 1 A LYS 58 ? NZ ? A LYS 15 NZ 7 1 Y 1 A LYS 61 ? CD ? A LYS 18 CD 8 1 Y 1 A LYS 61 ? CE ? A LYS 18 CE 9 1 Y 1 A LYS 61 ? NZ ? A LYS 18 NZ 10 1 Y 1 A LYS 65 ? CG ? A LYS 22 CG 11 1 Y 1 A LYS 65 ? CD ? A LYS 22 CD 12 1 Y 1 A LYS 65 ? CE ? A LYS 22 CE 13 1 Y 1 A LYS 65 ? NZ ? A LYS 22 NZ 14 1 Y 1 A LYS 74 ? CG ? A LYS 31 CG 15 1 Y 1 A LYS 74 ? CD ? A LYS 31 CD 16 1 Y 1 A LYS 74 ? CE ? A LYS 31 CE 17 1 Y 1 A LYS 74 ? NZ ? A LYS 31 NZ 18 1 Y 1 A LYS 78 ? CG ? A LYS 35 CG 19 1 Y 1 A LYS 78 ? CD ? A LYS 35 CD 20 1 Y 1 A LYS 78 ? CE ? A LYS 35 CE 21 1 Y 1 A LYS 78 ? NZ ? A LYS 35 NZ 22 1 Y 1 A GLU 103 ? CG ? A GLU 60 CG 23 1 Y 1 A GLU 103 ? CD ? A GLU 60 CD 24 1 Y 1 A GLU 103 ? OE1 ? A GLU 60 OE1 25 1 Y 1 A GLU 103 ? OE2 ? A GLU 60 OE2 26 1 Y 1 A LYS 134 ? CG ? A LYS 91 CG 27 1 Y 1 A LYS 134 ? CD ? A LYS 91 CD 28 1 Y 1 A LYS 134 ? CE ? A LYS 91 CE 29 1 Y 1 A LYS 134 ? NZ ? A LYS 91 NZ 30 1 Y 1 A GLU 135 ? CD ? A GLU 92 CD 31 1 Y 1 A GLU 135 ? OE1 ? A GLU 92 OE1 32 1 Y 1 A GLU 135 ? OE2 ? A GLU 92 OE2 33 1 Y 1 A LYS 137 ? CE ? A LYS 94 CE 34 1 Y 1 A LYS 137 ? NZ ? A LYS 94 NZ 35 1 Y 1 A GLU 138 ? CG ? A GLU 95 CG 36 1 Y 1 A GLU 138 ? CD ? A GLU 95 CD 37 1 Y 1 A GLU 138 ? OE1 ? A GLU 95 OE1 38 1 Y 1 A GLU 138 ? OE2 ? A GLU 95 OE2 39 1 Y 1 A ARG 139 ? CD ? A ARG 96 CD 40 1 Y 1 A ARG 139 ? NE ? A ARG 96 NE 41 1 Y 1 A ARG 139 ? CZ ? A ARG 96 CZ 42 1 Y 1 A ARG 139 ? NH1 ? A ARG 96 NH1 43 1 Y 1 A ARG 139 ? NH2 ? A ARG 96 NH2 44 1 Y 1 A ARG 180 ? CD ? A ARG 137 CD 45 1 Y 1 A ARG 180 ? NE ? A ARG 137 NE 46 1 Y 1 A ARG 180 ? CZ ? A ARG 137 CZ 47 1 Y 1 A ARG 180 ? NH1 ? A ARG 137 NH1 48 1 Y 1 A ARG 180 ? NH2 ? A ARG 137 NH2 49 1 Y 1 A LYS 203 ? CG ? A LYS 160 CG 50 1 Y 1 A LYS 203 ? CD ? A LYS 160 CD 51 1 Y 1 A LYS 203 ? CE ? A LYS 160 CE 52 1 Y 1 A LYS 203 ? NZ ? A LYS 160 NZ 53 1 Y 1 A GLN 345 ? CG ? A GLN 302 CG 54 1 Y 1 A GLN 345 ? CD ? A GLN 302 CD 55 1 Y 1 A GLN 345 ? OE1 ? A GLN 302 OE1 56 1 Y 1 A GLN 345 ? NE2 ? A GLN 302 NE2 57 1 Y 1 A GLU 366 ? CD ? A GLU 323 CD 58 1 Y 1 A GLU 366 ? OE1 ? A GLU 323 OE1 59 1 Y 1 A GLU 366 ? OE2 ? A GLU 323 OE2 60 1 Y 1 A GLU 369 ? CD ? A GLU 326 CD 61 1 Y 1 A GLU 369 ? OE1 ? A GLU 326 OE1 62 1 Y 1 A GLU 369 ? OE2 ? A GLU 326 OE2 63 1 Y 1 A LYS 382 ? CD ? A LYS 339 CD 64 1 Y 1 A LYS 382 ? CE ? A LYS 339 CE 65 1 Y 1 A LYS 382 ? NZ ? A LYS 339 NZ 66 1 Y 1 A LYS 424 ? CG ? A LYS 381 CG 67 1 Y 1 A LYS 424 ? CD ? A LYS 381 CD 68 1 Y 1 A LYS 424 ? CE ? A LYS 381 CE 69 1 Y 1 A LYS 424 ? NZ ? A LYS 381 NZ 70 1 Y 1 A GLU 427 ? CD ? A GLU 384 CD 71 1 Y 1 A GLU 427 ? OE1 ? A GLU 384 OE1 72 1 Y 1 A GLU 427 ? OE2 ? A GLU 384 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 44 ? A SER 1 2 1 Y 1 A ASN 45 ? A ASN 2 3 1 Y 1 A ALA 46 ? A ALA 3 4 1 Y 1 A PRO 47 ? A PRO 4 5 1 Y 1 A PRO 355 ? A PRO 312 6 1 Y 1 A THR 356 ? A THR 313 7 1 Y 1 A PRO 357 ? A PRO 314 8 1 Y 1 A GLN 358 ? A GLN 315 9 1 Y 1 A ASP 359 ? A ASP 316 10 1 Y 1 A HIS 360 ? A HIS 317 11 1 Y 1 A ILE 361 ? A ILE 318 12 1 Y 1 A LYS 362 ? A LYS 319 13 1 Y 1 A VAL 430 ? A VAL 387 14 1 Y 1 A VAL 431 ? A VAL 388 15 1 Y 1 A ASP 432 ? A ASP 389 16 1 Y 1 A PRO 433 ? A PRO 390 17 1 Y 1 A PHE 434 ? A PHE 391 18 1 Y 1 A ASP 435 ? A ASP 392 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number '5P20RR017708-10 / 8P20GM103420-10' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 'ZINC ION' ZN 4 'SODIUM ION' NA 5 water HOH #