data_5HLE # _entry.id 5HLE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5HLE pdb_00005hle 10.2210/pdb5hle/pdb WWPDB D_1000217200 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5HNW PDB . unspecified 5HNX PDB . unspecified 5HNY PDB . unspecified 5HNZ PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HLE _pdbx_database_status.recvd_initial_deposition_date 2016-01-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Nitta, R.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Backwards motion in kinesin-14 requires neck-mimic to control a neck-helix swing.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yamagishi, M.' 1 ? primary 'Shigematsu, H.' 2 ? primary 'Yokoyama, T.' 3 ? primary 'Kikkawa, M.' 4 ? primary 'Sugawa, M.' 5 ? primary 'Aoki, M.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yajima, J.' 8 ? primary 'Nitta, R.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5HLE _cell.details ? _cell.formula_units_Z ? _cell.length_a 112.858 _cell.length_a_esd ? _cell.length_b 112.858 _cell.length_b_esd ? _cell.length_c 72.110 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HLE _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein claret segregational,Minus-end kinesin-1/kinesin-14,Protein claret segregational' 41620.250 1 ? ? ? ? 2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KEQLFQSNMERKELHNTVMDLRGNIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIQGKPYVFDRVLPPNTTQEQVYNA CAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFAIKVSYFEIYLDKIRD LLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLS GKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTTHVPYRDSKMTRILQDSLGGNCRTTIVICCSP SVFNEAETKSTLMFAASVNSCKMTKAKRNRYLNNSVANSSTQSNNSGSFDK ; _entity_poly.pdbx_seq_one_letter_code_can ;KEQLFQSNMERKELHNTVMDLRGNIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIQGKPYVFDRVLPPNTTQEQVYNA CAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFAIKVSYFEIYLDKIRD LLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLS GKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTTHVPYRDSKMTRILQDSLGGNCRTTIVICCSP SVFNEAETKSTLMFAASVNSCKMTKAKRNRYLNNSVANSSTQSNNSGSFDK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 GLN n 1 4 LEU n 1 5 PHE n 1 6 GLN n 1 7 SER n 1 8 ASN n 1 9 MET n 1 10 GLU n 1 11 ARG n 1 12 LYS n 1 13 GLU n 1 14 LEU n 1 15 HIS n 1 16 ASN n 1 17 THR n 1 18 VAL n 1 19 MET n 1 20 ASP n 1 21 LEU n 1 22 ARG n 1 23 GLY n 1 24 ASN n 1 25 ILE n 1 26 LYS n 1 27 VAL n 1 28 MET n 1 29 CYS n 1 30 ARG n 1 31 PHE n 1 32 ARG n 1 33 PRO n 1 34 LEU n 1 35 ASN n 1 36 GLU n 1 37 ALA n 1 38 GLU n 1 39 ILE n 1 40 LEU n 1 41 ARG n 1 42 GLY n 1 43 ASP n 1 44 LYS n 1 45 PHE n 1 46 ILE n 1 47 PRO n 1 48 LYS n 1 49 PHE n 1 50 LYS n 1 51 GLY n 1 52 GLU n 1 53 GLU n 1 54 THR n 1 55 VAL n 1 56 VAL n 1 57 ILE n 1 58 GLN n 1 59 GLY n 1 60 LYS n 1 61 PRO n 1 62 TYR n 1 63 VAL n 1 64 PHE n 1 65 ASP n 1 66 ARG n 1 67 VAL n 1 68 LEU n 1 69 PRO n 1 70 PRO n 1 71 ASN n 1 72 THR n 1 73 THR n 1 74 GLN n 1 75 GLU n 1 76 GLN n 1 77 VAL n 1 78 TYR n 1 79 ASN n 1 80 ALA n 1 81 CYS n 1 82 ALA n 1 83 LYS n 1 84 GLN n 1 85 ILE n 1 86 VAL n 1 87 LYS n 1 88 ASP n 1 89 VAL n 1 90 LEU n 1 91 GLU n 1 92 GLY n 1 93 TYR n 1 94 ASN n 1 95 GLY n 1 96 THR n 1 97 ILE n 1 98 PHE n 1 99 ALA n 1 100 TYR n 1 101 GLY n 1 102 GLN n 1 103 THR n 1 104 SER n 1 105 SER n 1 106 GLY n 1 107 LYS n 1 108 THR n 1 109 HIS n 1 110 THR n 1 111 MET n 1 112 GLU n 1 113 GLY n 1 114 LYS n 1 115 LEU n 1 116 HIS n 1 117 ASP n 1 118 PRO n 1 119 GLN n 1 120 LEU n 1 121 MET n 1 122 GLY n 1 123 ILE n 1 124 ILE n 1 125 PRO n 1 126 ARG n 1 127 ILE n 1 128 ALA n 1 129 HIS n 1 130 ASP n 1 131 ILE n 1 132 PHE n 1 133 ASP n 1 134 HIS n 1 135 ILE n 1 136 TYR n 1 137 SER n 1 138 MET n 1 139 ASP n 1 140 GLU n 1 141 ASN n 1 142 LEU n 1 143 GLU n 1 144 PHE n 1 145 ALA n 1 146 ILE n 1 147 LYS n 1 148 VAL n 1 149 SER n 1 150 TYR n 1 151 PHE n 1 152 GLU n 1 153 ILE n 1 154 TYR n 1 155 LEU n 1 156 ASP n 1 157 LYS n 1 158 ILE n 1 159 ARG n 1 160 ASP n 1 161 LEU n 1 162 LEU n 1 163 ASP n 1 164 VAL n 1 165 SER n 1 166 LYS n 1 167 THR n 1 168 ASN n 1 169 LEU n 1 170 ALA n 1 171 VAL n 1 172 HIS n 1 173 GLU n 1 174 ASP n 1 175 LYS n 1 176 ASN n 1 177 ARG n 1 178 VAL n 1 179 PRO n 1 180 TYR n 1 181 VAL n 1 182 LYS n 1 183 GLY n 1 184 CYS n 1 185 THR n 1 186 GLU n 1 187 ARG n 1 188 PHE n 1 189 VAL n 1 190 SER n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 VAL n 1 196 MET n 1 197 ASP n 1 198 VAL n 1 199 ILE n 1 200 ASP n 1 201 GLU n 1 202 GLY n 1 203 LYS n 1 204 SER n 1 205 ASN n 1 206 ARG n 1 207 HIS n 1 208 VAL n 1 209 ALA n 1 210 VAL n 1 211 THR n 1 212 ASN n 1 213 MET n 1 214 ASN n 1 215 GLU n 1 216 HIS n 1 217 SER n 1 218 SER n 1 219 ARG n 1 220 SER n 1 221 HIS n 1 222 SER n 1 223 ILE n 1 224 PHE n 1 225 LEU n 1 226 ILE n 1 227 ASN n 1 228 ILE n 1 229 LYS n 1 230 GLN n 1 231 GLU n 1 232 ASN n 1 233 VAL n 1 234 GLU n 1 235 THR n 1 236 GLU n 1 237 LYS n 1 238 LYS n 1 239 LEU n 1 240 SER n 1 241 GLY n 1 242 LYS n 1 243 LEU n 1 244 TYR n 1 245 LEU n 1 246 VAL n 1 247 ASP n 1 248 LEU n 1 249 ALA n 1 250 GLY n 1 251 SER n 1 252 GLU n 1 253 LYS n 1 254 VAL n 1 255 SER n 1 256 LYS n 1 257 THR n 1 258 GLY n 1 259 ALA n 1 260 GLU n 1 261 GLY n 1 262 ALA n 1 263 VAL n 1 264 LEU n 1 265 ASP n 1 266 GLU n 1 267 ALA n 1 268 LYS n 1 269 ASN n 1 270 ILE n 1 271 ASN n 1 272 LYS n 1 273 SER n 1 274 LEU n 1 275 SER n 1 276 ALA n 1 277 LEU n 1 278 GLY n 1 279 ASN n 1 280 VAL n 1 281 ILE n 1 282 SER n 1 283 ALA n 1 284 LEU n 1 285 ALA n 1 286 GLU n 1 287 GLY n 1 288 THR n 1 289 THR n 1 290 HIS n 1 291 VAL n 1 292 PRO n 1 293 TYR n 1 294 ARG n 1 295 ASP n 1 296 SER n 1 297 LYS n 1 298 MET n 1 299 THR n 1 300 ARG n 1 301 ILE n 1 302 LEU n 1 303 GLN n 1 304 ASP n 1 305 SER n 1 306 LEU n 1 307 GLY n 1 308 GLY n 1 309 ASN n 1 310 CYS n 1 311 ARG n 1 312 THR n 1 313 THR n 1 314 ILE n 1 315 VAL n 1 316 ILE n 1 317 CYS n 1 318 CYS n 1 319 SER n 1 320 PRO n 1 321 SER n 1 322 VAL n 1 323 PHE n 1 324 ASN n 1 325 GLU n 1 326 ALA n 1 327 GLU n 1 328 THR n 1 329 LYS n 1 330 SER n 1 331 THR n 1 332 LEU n 1 333 MET n 1 334 PHE n 1 335 ALA n 1 336 ALA n 1 337 SER n 1 338 VAL n 1 339 ASN n 1 340 SER n 1 341 CYS n 1 342 LYS n 1 343 MET n 1 344 THR n 1 345 LYS n 1 346 ALA n 1 347 LYS n 1 348 ARG n 1 349 ASN n 1 350 ARG n 1 351 TYR n 1 352 LEU n 1 353 ASN n 1 354 ASN n 1 355 SER n 1 356 VAL n 1 357 ALA n 1 358 ASN n 1 359 SER n 1 360 SER n 1 361 THR n 1 362 GLN n 1 363 SER n 1 364 ASN n 1 365 ASN n 1 366 SER n 1 367 GLY n 1 368 SER n 1 369 PHE n 1 370 ASP n 1 371 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 24 'Fruit fly' ? ? ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 1 2 sample 'Biological sequence' 25 334 rat ? ? ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 1 3 sample 'Biological sequence' 335 371 'Fruit fly' ? ? ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP NCD_DROME P20480 ? 1 KEQLFQSNMERKELHNTVMDLRGN 325 2 PDB 5HLE 5HLE ? 1 ? 25 3 UNP NCD_DROME P20480 ? 1 AASVNSCKMTKAKRNRYLNNSVANSSTQSNNSGSFDK 664 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5HLE A 1 ? 24 ? P20480 325 ? 348 ? 1 24 2 2 5HLE A 25 ? 334 ? 5HLE 25 ? 334 ? 25 334 3 3 5HLE A 335 ? 371 ? P20480 664 ? 700 ? 335 371 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HLE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350, Ammonium sulfate, HEPES Benzamidine-HCl, ADP' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL26B2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL26B2 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HLE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12353 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HLE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.900 _refine.ls_d_res_low 19.548 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11668 _refine.ls_number_reflns_R_free 1171 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 10.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2185 _refine.ls_R_factor_R_free 0.2872 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2109 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1BG2 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.09 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.44 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2369 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 2400 _refine_hist.d_res_high 2.900 _refine_hist.d_res_low 19.548 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 2437 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.573 ? 3293 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.766 ? 914 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.057 ? 375 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 421 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9004 3.0320 . . 144 1282 100.00 . . . 0.3662 . 0.2845 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0320 3.1912 . . 144 1320 100.00 . . . 0.3645 . 0.2676 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1912 3.3901 . . 144 1302 100.00 . . . 0.3231 . 0.2430 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3901 3.6503 . . 151 1313 100.00 . . . 0.3038 . 0.2138 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6503 4.0148 . . 143 1307 100.00 . . . 0.2750 . 0.2004 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0148 4.5892 . . 144 1309 100.00 . . . 0.2785 . 0.1778 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5892 5.7573 . . 148 1323 100.00 . . . 0.2513 . 0.2009 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.7573 19.5480 . . 153 1341 100.00 . . . 0.2622 . 0.2005 . . . . . . . . . . # _struct.entry_id 5HLE _struct.title 'Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP state' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HLE _struct_keywords.text 'kinesin, kinesin-14, microtubule, ATPase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 35 ? ARG A 41 ? ASN A 35 ARG A 41 1 ? 7 HELX_P HELX_P2 AA2 THR A 73 ? ALA A 82 ? THR A 73 ALA A 82 1 ? 10 HELX_P HELX_P3 AA3 ALA A 82 ? LEU A 90 ? ALA A 82 LEU A 90 1 ? 9 HELX_P HELX_P4 AA4 GLY A 106 ? GLU A 112 ? GLY A 106 GLU A 112 1 ? 7 HELX_P HELX_P5 AA5 GLY A 122 ? ILE A 135 ? GLY A 122 ILE A 135 1 ? 14 HELX_P HELX_P6 AA6 TYR A 136 ? MET A 138 ? TYR A 136 MET A 138 5 ? 3 HELX_P HELX_P7 AA7 SER A 191 ? ARG A 206 ? SER A 191 ARG A 206 1 ? 16 HELX_P HELX_P8 AA8 HIS A 216 ? SER A 220 ? HIS A 216 SER A 220 5 ? 5 HELX_P HELX_P9 AA9 LYS A 272 ? ALA A 285 ? LYS A 272 ALA A 285 1 ? 14 HELX_P HELX_P10 AB1 PRO A 292 ? ASP A 295 ? PRO A 292 ASP A 295 5 ? 4 HELX_P HELX_P11 AB2 SER A 296 ? LEU A 302 ? SER A 296 LEU A 302 1 ? 7 HELX_P HELX_P12 AB3 GLN A 303 ? LEU A 306 ? GLN A 303 LEU A 306 5 ? 4 HELX_P HELX_P13 AB4 ASN A 324 ? PHE A 334 ? ASN A 324 PHE A 334 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A THR 108 OG1 ? ? ? 1_555 C MG . MG ? ? A THR 108 A MG 402 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc2 metalc ? ? B ADP . O3B ? ? ? 1_555 C MG . MG ? ? A ADP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.514 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 23 A . ? GLY 23 A ASN 24 A ? ASN 24 A 1 1.06 2 ASP 139 A . ? ASP 139 A GLU 140 A ? GLU 140 A 1 6.75 3 ILE 270 A . ? ILE 270 A ASN 271 A ? ASN 271 A 1 11.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 8 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 66 ? LEU A 68 ? ARG A 66 LEU A 68 AA1 2 LYS A 26 ? PHE A 31 ? LYS A 26 PHE A 31 AA1 3 ARG A 311 ? CYS A 318 ? ARG A 311 CYS A 318 AA1 4 GLY A 95 ? TYR A 100 ? GLY A 95 TYR A 100 AA1 5 LYS A 238 ? ASP A 247 ? LYS A 238 ASP A 247 AA1 6 HIS A 221 ? ASN A 232 ? HIS A 221 ASN A 232 AA1 7 LEU A 142 ? TYR A 154 ? LEU A 142 TYR A 154 AA1 8 LYS A 157 ? ASP A 160 ? LYS A 157 ASP A 160 AA2 1 ARG A 66 ? LEU A 68 ? ARG A 66 LEU A 68 AA2 2 LYS A 26 ? PHE A 31 ? LYS A 26 PHE A 31 AA2 3 ARG A 311 ? CYS A 318 ? ARG A 311 CYS A 318 AA2 4 GLY A 95 ? TYR A 100 ? GLY A 95 TYR A 100 AA2 5 LYS A 238 ? ASP A 247 ? LYS A 238 ASP A 247 AA2 6 HIS A 221 ? ASN A 232 ? HIS A 221 ASN A 232 AA2 7 LEU A 142 ? TYR A 154 ? LEU A 142 TYR A 154 AA2 8 ARG A 187 ? VAL A 189 ? ARG A 187 VAL A 189 AA3 1 THR A 54 ? VAL A 55 ? THR A 54 VAL A 55 AA3 2 TYR A 62 ? VAL A 63 ? TYR A 62 VAL A 63 AA4 1 VAL A 171 ? GLU A 173 ? VAL A 171 GLU A 173 AA4 2 PRO A 179 ? VAL A 181 ? PRO A 179 VAL A 181 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 68 ? O LEU A 68 N CYS A 29 ? N CYS A 29 AA1 2 3 N MET A 28 ? N MET A 28 O ILE A 316 ? O ILE A 316 AA1 3 4 O VAL A 315 ? O VAL A 315 N PHE A 98 ? N PHE A 98 AA1 4 5 N ILE A 97 ? N ILE A 97 O VAL A 246 ? O VAL A 246 AA1 5 6 O LEU A 245 ? O LEU A 245 N PHE A 224 ? N PHE A 224 AA1 6 7 O LEU A 225 ? O LEU A 225 N SER A 149 ? N SER A 149 AA1 7 8 N GLU A 152 ? N GLU A 152 O ARG A 159 ? O ARG A 159 AA2 1 2 O LEU A 68 ? O LEU A 68 N CYS A 29 ? N CYS A 29 AA2 2 3 N MET A 28 ? N MET A 28 O ILE A 316 ? O ILE A 316 AA2 3 4 O VAL A 315 ? O VAL A 315 N PHE A 98 ? N PHE A 98 AA2 4 5 N ILE A 97 ? N ILE A 97 O VAL A 246 ? O VAL A 246 AA2 5 6 O LEU A 245 ? O LEU A 245 N PHE A 224 ? N PHE A 224 AA2 6 7 O LEU A 225 ? O LEU A 225 N SER A 149 ? N SER A 149 AA2 7 8 N ILE A 146 ? N ILE A 146 O VAL A 189 ? O VAL A 189 AA3 1 2 N VAL A 55 ? N VAL A 55 O TYR A 62 ? O TYR A 62 AA4 1 2 N HIS A 172 ? N HIS A 172 O TYR A 180 ? O TYR A 180 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ADP 401 ? 11 'binding site for residue ADP A 401' AC2 Software A MG 402 ? 2 'binding site for residue MG A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ARG A 32 ? ARG A 32 . ? 1_555 ? 2 AC1 11 PRO A 33 ? PRO A 33 . ? 1_555 ? 3 AC1 11 GLN A 102 ? GLN A 102 . ? 1_555 ? 4 AC1 11 SER A 104 ? SER A 104 . ? 1_555 ? 5 AC1 11 SER A 105 ? SER A 105 . ? 1_555 ? 6 AC1 11 GLY A 106 ? GLY A 106 . ? 1_555 ? 7 AC1 11 LYS A 107 ? LYS A 107 . ? 1_555 ? 8 AC1 11 THR A 108 ? THR A 108 . ? 1_555 ? 9 AC1 11 HIS A 109 ? HIS A 109 . ? 1_555 ? 10 AC1 11 LYS A 114 ? LYS A 114 . ? 1_555 ? 11 AC1 11 MG C . ? MG A 402 . ? 1_555 ? 12 AC2 2 THR A 108 ? THR A 108 . ? 1_555 ? 13 AC2 2 ADP B . ? ADP A 401 . ? 1_555 ? # _atom_sites.entry_id 5HLE _atom_sites.fract_transf_matrix[1][1] 0.008861 _atom_sites.fract_transf_matrix[1][2] 0.005116 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010231 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013868 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 MET 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 LYS 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 HIS 15 15 ? ? ? A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 THR 17 17 17 THR ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 MET 19 19 19 MET ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU ALA A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 CYS 184 184 184 CYS CYS A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 MET 196 196 196 MET MET A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 ASN 205 205 205 ASN ASN A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 VAL 210 210 ? ? ? A . n A 1 211 THR 211 211 ? ? ? A . n A 1 212 ASN 212 212 ? ? ? A . n A 1 213 MET 213 213 ? ? ? A . n A 1 214 ASN 214 214 ? ? ? A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 ARG 219 219 219 ARG ARG A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 HIS 221 221 221 HIS HIS A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 GLU 236 236 236 GLU GLU A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 ALA 249 249 249 ALA ALA A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 SER 255 255 ? ? ? A . n A 1 256 LYS 256 256 ? ? ? A . n A 1 257 THR 257 257 ? ? ? A . n A 1 258 GLY 258 258 ? ? ? A . n A 1 259 ALA 259 259 ? ? ? A . n A 1 260 GLU 260 260 ? ? ? A . n A 1 261 GLY 261 261 ? ? ? A . n A 1 262 ALA 262 262 ? ? ? A . n A 1 263 VAL 263 263 ? ? ? A . n A 1 264 LEU 264 264 ? ? ? A . n A 1 265 ASP 265 265 ? ? ? A . n A 1 266 GLU 266 266 ? ? ? A . n A 1 267 ALA 267 267 ? ? ? A . n A 1 268 LYS 268 268 268 LYS ALA A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 ASN 271 271 271 ASN ASN A . n A 1 272 LYS 272 272 272 LYS LYS A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 ASN 279 279 279 ASN ASN A . n A 1 280 VAL 280 280 280 VAL VAL A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 GLU 286 286 286 GLU GLU A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 THR 288 288 288 THR THR A . n A 1 289 THR 289 289 289 THR THR A . n A 1 290 HIS 290 290 290 HIS HIS A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 PRO 292 292 292 PRO PRO A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 ARG 294 294 294 ARG ARG A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 SER 296 296 296 SER SER A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 MET 298 298 298 MET MET A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 ARG 300 300 300 ARG ARG A . n A 1 301 ILE 301 301 301 ILE ILE A . n A 1 302 LEU 302 302 302 LEU LEU A . n A 1 303 GLN 303 303 303 GLN GLN A . n A 1 304 ASP 304 304 304 ASP ASP A . n A 1 305 SER 305 305 305 SER SER A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 GLY 307 307 307 GLY GLY A . n A 1 308 GLY 308 308 308 GLY GLY A . n A 1 309 ASN 309 309 309 ASN ASN A . n A 1 310 CYS 310 310 310 CYS CYS A . n A 1 311 ARG 311 311 311 ARG ARG A . n A 1 312 THR 312 312 312 THR THR A . n A 1 313 THR 313 313 313 THR THR A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 ILE 316 316 316 ILE ILE A . n A 1 317 CYS 317 317 317 CYS CYS A . n A 1 318 CYS 318 318 318 CYS CYS A . n A 1 319 SER 319 319 319 SER SER A . n A 1 320 PRO 320 320 320 PRO PRO A . n A 1 321 SER 321 321 321 SER SER A . n A 1 322 VAL 322 322 322 VAL VAL A . n A 1 323 PHE 323 323 323 PHE PHE A . n A 1 324 ASN 324 324 324 ASN ASN A . n A 1 325 GLU 325 325 325 GLU GLU A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 GLU 327 327 327 GLU GLU A . n A 1 328 THR 328 328 328 THR THR A . n A 1 329 LYS 329 329 329 LYS LYS A . n A 1 330 SER 330 330 330 SER SER A . n A 1 331 THR 331 331 331 THR THR A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 MET 333 333 333 MET MET A . n A 1 334 PHE 334 334 334 PHE PHE A . n A 1 335 ALA 335 335 335 ALA ALA A . n A 1 336 ALA 336 336 336 ALA ALA A . n A 1 337 SER 337 337 ? ? ? A . n A 1 338 VAL 338 338 ? ? ? A . n A 1 339 ASN 339 339 ? ? ? A . n A 1 340 SER 340 340 ? ? ? A . n A 1 341 CYS 341 341 ? ? ? A . n A 1 342 LYS 342 342 ? ? ? A . n A 1 343 MET 343 343 ? ? ? A . n A 1 344 THR 344 344 ? ? ? A . n A 1 345 LYS 345 345 ? ? ? A . n A 1 346 ALA 346 346 ? ? ? A . n A 1 347 LYS 347 347 ? ? ? A . n A 1 348 ARG 348 348 ? ? ? A . n A 1 349 ASN 349 349 ? ? ? A . n A 1 350 ARG 350 350 ? ? ? A . n A 1 351 TYR 351 351 ? ? ? A . n A 1 352 LEU 352 352 ? ? ? A . n A 1 353 ASN 353 353 ? ? ? A . n A 1 354 ASN 354 354 ? ? ? A . n A 1 355 SER 355 355 ? ? ? A . n A 1 356 VAL 356 356 ? ? ? A . n A 1 357 ALA 357 357 ? ? ? A . n A 1 358 ASN 358 358 ? ? ? A . n A 1 359 SER 359 359 ? ? ? A . n A 1 360 SER 360 360 ? ? ? A . n A 1 361 THR 361 361 ? ? ? A . n A 1 362 GLN 362 362 ? ? ? A . n A 1 363 SER 363 363 ? ? ? A . n A 1 364 ASN 364 364 ? ? ? A . n A 1 365 ASN 365 365 ? ? ? A . n A 1 366 SER 366 366 ? ? ? A . n A 1 367 GLY 367 367 ? ? ? A . n A 1 368 SER 368 368 ? ? ? A . n A 1 369 PHE 369 369 ? ? ? A . n A 1 370 ASP 370 370 ? ? ? A . n A 1 371 LYS 371 371 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADP 1 401 1 ADP ADP A . C 3 MG 1 402 701 MG MG A . D 4 HOH 1 501 2 HOH HOH A . D 4 HOH 2 502 1 HOH HOH A . D 4 HOH 3 503 3 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 780 ? 1 MORE -17 ? 1 'SSA (A^2)' 14740 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OG1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id THR _pdbx_struct_conn_angle.ptnr1_label_seq_id 108 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id THR _pdbx_struct_conn_angle.ptnr1_auth_seq_id 108 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MG _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id C _pdbx_struct_conn_angle.ptnr2_label_comp_id MG _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id MG _pdbx_struct_conn_angle.ptnr2_auth_seq_id 402 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O3B _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id B _pdbx_struct_conn_angle.ptnr3_label_comp_id ADP _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id ADP _pdbx_struct_conn_angle.ptnr3_auth_seq_id 401 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 74.1 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2020-02-19 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 2 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ILE _pdbx_validate_close_contact.auth_seq_id_1 270 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 501 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 22 ? ? -19.56 103.22 2 1 ARG A 41 ? ? -36.91 -30.70 3 1 GLU A 53 ? ? -146.89 -5.13 4 1 GLN A 58 ? ? 65.19 -37.71 5 1 LYS A 60 ? ? 53.76 124.40 6 1 SER A 104 ? ? 92.91 -10.37 7 1 MET A 138 ? ? -127.76 -67.84 8 1 ASP A 139 ? ? -49.62 98.53 9 1 GLU A 140 ? ? 96.81 -84.34 10 1 ASN A 141 ? ? 177.41 9.77 11 1 ASN A 168 ? ? 36.83 52.04 12 1 LYS A 175 ? ? 3.73 -63.33 13 1 ARG A 177 ? ? 60.78 -38.90 14 1 PRO A 179 ? ? -46.13 154.65 15 1 SER A 190 ? ? -158.41 9.37 16 1 VAL A 208 ? ? -123.94 -67.04 17 1 GLU A 234 ? ? -94.15 -67.28 18 1 GLU A 236 ? ? 73.61 -26.82 19 1 ASN A 269 ? ? -164.19 -100.36 20 1 ALA A 285 ? ? -79.78 23.88 21 1 THR A 288 ? ? -73.63 -132.06 22 1 THR A 289 ? ? -145.19 -38.16 23 1 PRO A 292 ? ? -66.16 57.77 24 1 ASN A 309 ? ? -43.54 -10.66 25 1 ALA A 326 ? ? -33.13 -73.93 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASP A 20 ? ? LEU A 21 ? ? -148.14 2 1 ASN A 271 ? ? LYS A 272 ? ? 148.80 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 16 ? N ? A ASN 16 N 2 1 Y 1 A THR 17 ? OG1 ? A THR 17 OG1 3 1 Y 1 A THR 17 ? CG2 ? A THR 17 CG2 4 1 Y 1 A MET 19 ? CG ? A MET 19 CG 5 1 Y 1 A MET 19 ? SD ? A MET 19 SD 6 1 Y 1 A MET 19 ? CE ? A MET 19 CE 7 1 Y 1 A LEU 21 ? CG ? A LEU 21 CG 8 1 Y 1 A LEU 21 ? CD1 ? A LEU 21 CD1 9 1 Y 1 A LEU 21 ? CD2 ? A LEU 21 CD2 10 1 Y 1 A LYS 268 ? CG ? A LYS 268 CG 11 1 Y 1 A LYS 268 ? CD ? A LYS 268 CD 12 1 Y 1 A LYS 268 ? CE ? A LYS 268 CE 13 1 Y 1 A LYS 268 ? NZ ? A LYS 268 NZ 14 1 Y 1 A ARG 294 ? CG ? A ARG 294 CG 15 1 Y 1 A ARG 294 ? CD ? A ARG 294 CD 16 1 Y 1 A ARG 294 ? NE ? A ARG 294 NE 17 1 Y 1 A ARG 294 ? CZ ? A ARG 294 CZ 18 1 Y 1 A ARG 294 ? NH1 ? A ARG 294 NH1 19 1 Y 1 A ARG 294 ? NH2 ? A ARG 294 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 1 ? A LYS 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A MET 9 ? A MET 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A LYS 12 ? A LYS 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A HIS 15 ? A HIS 15 16 1 Y 1 A VAL 210 ? A VAL 210 17 1 Y 1 A THR 211 ? A THR 211 18 1 Y 1 A ASN 212 ? A ASN 212 19 1 Y 1 A MET 213 ? A MET 213 20 1 Y 1 A ASN 214 ? A ASN 214 21 1 Y 1 A SER 255 ? A SER 255 22 1 Y 1 A LYS 256 ? A LYS 256 23 1 Y 1 A THR 257 ? A THR 257 24 1 Y 1 A GLY 258 ? A GLY 258 25 1 Y 1 A ALA 259 ? A ALA 259 26 1 Y 1 A GLU 260 ? A GLU 260 27 1 Y 1 A GLY 261 ? A GLY 261 28 1 Y 1 A ALA 262 ? A ALA 262 29 1 Y 1 A VAL 263 ? A VAL 263 30 1 Y 1 A LEU 264 ? A LEU 264 31 1 Y 1 A ASP 265 ? A ASP 265 32 1 Y 1 A GLU 266 ? A GLU 266 33 1 Y 1 A ALA 267 ? A ALA 267 34 1 Y 1 A SER 337 ? A SER 337 35 1 Y 1 A VAL 338 ? A VAL 338 36 1 Y 1 A ASN 339 ? A ASN 339 37 1 Y 1 A SER 340 ? A SER 340 38 1 Y 1 A CYS 341 ? A CYS 341 39 1 Y 1 A LYS 342 ? A LYS 342 40 1 Y 1 A MET 343 ? A MET 343 41 1 Y 1 A THR 344 ? A THR 344 42 1 Y 1 A LYS 345 ? A LYS 345 43 1 Y 1 A ALA 346 ? A ALA 346 44 1 Y 1 A LYS 347 ? A LYS 347 45 1 Y 1 A ARG 348 ? A ARG 348 46 1 Y 1 A ASN 349 ? A ASN 349 47 1 Y 1 A ARG 350 ? A ARG 350 48 1 Y 1 A TYR 351 ? A TYR 351 49 1 Y 1 A LEU 352 ? A LEU 352 50 1 Y 1 A ASN 353 ? A ASN 353 51 1 Y 1 A ASN 354 ? A ASN 354 52 1 Y 1 A SER 355 ? A SER 355 53 1 Y 1 A VAL 356 ? A VAL 356 54 1 Y 1 A ALA 357 ? A ALA 357 55 1 Y 1 A ASN 358 ? A ASN 358 56 1 Y 1 A SER 359 ? A SER 359 57 1 Y 1 A SER 360 ? A SER 360 58 1 Y 1 A THR 361 ? A THR 361 59 1 Y 1 A GLN 362 ? A GLN 362 60 1 Y 1 A SER 363 ? A SER 363 61 1 Y 1 A ASN 364 ? A ASN 364 62 1 Y 1 A ASN 365 ? A ASN 365 63 1 Y 1 A SER 366 ? A SER 366 64 1 Y 1 A GLY 367 ? A GLY 367 65 1 Y 1 A SER 368 ? A SER 368 66 1 Y 1 A PHE 369 ? A PHE 369 67 1 Y 1 A ASP 370 ? A ASP 370 68 1 Y 1 A LYS 371 ? A LYS 371 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ADP PB P N N 1 ADP O1B O N N 2 ADP O2B O N N 3 ADP O3B O N N 4 ADP PA P N S 5 ADP O1A O N N 6 ADP O2A O N N 7 ADP O3A O N N 8 ADP "O5'" O N N 9 ADP "C5'" C N N 10 ADP "C4'" C N R 11 ADP "O4'" O N N 12 ADP "C3'" C N S 13 ADP "O3'" O N N 14 ADP "C2'" C N R 15 ADP "O2'" O N N 16 ADP "C1'" C N R 17 ADP N9 N Y N 18 ADP C8 C Y N 19 ADP N7 N Y N 20 ADP C5 C Y N 21 ADP C6 C Y N 22 ADP N6 N N N 23 ADP N1 N Y N 24 ADP C2 C Y N 25 ADP N3 N Y N 26 ADP C4 C Y N 27 ADP HOB2 H N N 28 ADP HOB3 H N N 29 ADP HOA2 H N N 30 ADP "H5'1" H N N 31 ADP "H5'2" H N N 32 ADP "H4'" H N N 33 ADP "H3'" H N N 34 ADP "HO3'" H N N 35 ADP "H2'" H N N 36 ADP "HO2'" H N N 37 ADP "H1'" H N N 38 ADP H8 H N N 39 ADP HN61 H N N 40 ADP HN62 H N N 41 ADP H2 H N N 42 ALA N N N N 43 ALA CA C N S 44 ALA C C N N 45 ALA O O N N 46 ALA CB C N N 47 ALA OXT O N N 48 ALA H H N N 49 ALA H2 H N N 50 ALA HA H N N 51 ALA HB1 H N N 52 ALA HB2 H N N 53 ALA HB3 H N N 54 ALA HXT H N N 55 ARG N N N N 56 ARG CA C N S 57 ARG C C N N 58 ARG O O N N 59 ARG CB C N N 60 ARG CG C N N 61 ARG CD C N N 62 ARG NE N N N 63 ARG CZ C N N 64 ARG NH1 N N N 65 ARG NH2 N N N 66 ARG OXT O N N 67 ARG H H N N 68 ARG H2 H N N 69 ARG HA H N N 70 ARG HB2 H N N 71 ARG HB3 H N N 72 ARG HG2 H N N 73 ARG HG3 H N N 74 ARG HD2 H N N 75 ARG HD3 H N N 76 ARG HE H N N 77 ARG HH11 H N N 78 ARG HH12 H N N 79 ARG HH21 H N N 80 ARG HH22 H N N 81 ARG HXT H N N 82 ASN N N N N 83 ASN CA C N S 84 ASN C C N N 85 ASN O O N N 86 ASN CB C N N 87 ASN CG C N N 88 ASN OD1 O N N 89 ASN ND2 N N N 90 ASN OXT O N N 91 ASN H H N N 92 ASN H2 H N N 93 ASN HA H N N 94 ASN HB2 H N N 95 ASN HB3 H N N 96 ASN HD21 H N N 97 ASN HD22 H N N 98 ASN HXT H N N 99 ASP N N N N 100 ASP CA C N S 101 ASP C C N N 102 ASP O O N N 103 ASP CB C N N 104 ASP CG C N N 105 ASP OD1 O N N 106 ASP OD2 O N N 107 ASP OXT O N N 108 ASP H H N N 109 ASP H2 H N N 110 ASP HA H N N 111 ASP HB2 H N N 112 ASP HB3 H N N 113 ASP HD2 H N N 114 ASP HXT H N N 115 CYS N N N N 116 CYS CA C N R 117 CYS C C N N 118 CYS O O N N 119 CYS CB C N N 120 CYS SG S N N 121 CYS OXT O N N 122 CYS H H N N 123 CYS H2 H N N 124 CYS HA H N N 125 CYS HB2 H N N 126 CYS HB3 H N N 127 CYS HG H N N 128 CYS HXT H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HIS N N N N 179 HIS CA C N S 180 HIS C C N N 181 HIS O O N N 182 HIS CB C N N 183 HIS CG C Y N 184 HIS ND1 N Y N 185 HIS CD2 C Y N 186 HIS CE1 C Y N 187 HIS NE2 N Y N 188 HIS OXT O N N 189 HIS H H N N 190 HIS H2 H N N 191 HIS HA H N N 192 HIS HB2 H N N 193 HIS HB3 H N N 194 HIS HD1 H N N 195 HIS HD2 H N N 196 HIS HE1 H N N 197 HIS HE2 H N N 198 HIS HXT H N N 199 HOH O O N N 200 HOH H1 H N N 201 HOH H2 H N N 202 ILE N N N N 203 ILE CA C N S 204 ILE C C N N 205 ILE O O N N 206 ILE CB C N S 207 ILE CG1 C N N 208 ILE CG2 C N N 209 ILE CD1 C N N 210 ILE OXT O N N 211 ILE H H N N 212 ILE H2 H N N 213 ILE HA H N N 214 ILE HB H N N 215 ILE HG12 H N N 216 ILE HG13 H N N 217 ILE HG21 H N N 218 ILE HG22 H N N 219 ILE HG23 H N N 220 ILE HD11 H N N 221 ILE HD12 H N N 222 ILE HD13 H N N 223 ILE HXT H N N 224 LEU N N N N 225 LEU CA C N S 226 LEU C C N N 227 LEU O O N N 228 LEU CB C N N 229 LEU CG C N N 230 LEU CD1 C N N 231 LEU CD2 C N N 232 LEU OXT O N N 233 LEU H H N N 234 LEU H2 H N N 235 LEU HA H N N 236 LEU HB2 H N N 237 LEU HB3 H N N 238 LEU HG H N N 239 LEU HD11 H N N 240 LEU HD12 H N N 241 LEU HD13 H N N 242 LEU HD21 H N N 243 LEU HD22 H N N 244 LEU HD23 H N N 245 LEU HXT H N N 246 LYS N N N N 247 LYS CA C N S 248 LYS C C N N 249 LYS O O N N 250 LYS CB C N N 251 LYS CG C N N 252 LYS CD C N N 253 LYS CE C N N 254 LYS NZ N N N 255 LYS OXT O N N 256 LYS H H N N 257 LYS H2 H N N 258 LYS HA H N N 259 LYS HB2 H N N 260 LYS HB3 H N N 261 LYS HG2 H N N 262 LYS HG3 H N N 263 LYS HD2 H N N 264 LYS HD3 H N N 265 LYS HE2 H N N 266 LYS HE3 H N N 267 LYS HZ1 H N N 268 LYS HZ2 H N N 269 LYS HZ3 H N N 270 LYS HXT H N N 271 MET N N N N 272 MET CA C N S 273 MET C C N N 274 MET O O N N 275 MET CB C N N 276 MET CG C N N 277 MET SD S N N 278 MET CE C N N 279 MET OXT O N N 280 MET H H N N 281 MET H2 H N N 282 MET HA H N N 283 MET HB2 H N N 284 MET HB3 H N N 285 MET HG2 H N N 286 MET HG3 H N N 287 MET HE1 H N N 288 MET HE2 H N N 289 MET HE3 H N N 290 MET HXT H N N 291 MG MG MG N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ADP PB O1B doub N N 1 ADP PB O2B sing N N 2 ADP PB O3B sing N N 3 ADP PB O3A sing N N 4 ADP O2B HOB2 sing N N 5 ADP O3B HOB3 sing N N 6 ADP PA O1A doub N N 7 ADP PA O2A sing N N 8 ADP PA O3A sing N N 9 ADP PA "O5'" sing N N 10 ADP O2A HOA2 sing N N 11 ADP "O5'" "C5'" sing N N 12 ADP "C5'" "C4'" sing N N 13 ADP "C5'" "H5'1" sing N N 14 ADP "C5'" "H5'2" sing N N 15 ADP "C4'" "O4'" sing N N 16 ADP "C4'" "C3'" sing N N 17 ADP "C4'" "H4'" sing N N 18 ADP "O4'" "C1'" sing N N 19 ADP "C3'" "O3'" sing N N 20 ADP "C3'" "C2'" sing N N 21 ADP "C3'" "H3'" sing N N 22 ADP "O3'" "HO3'" sing N N 23 ADP "C2'" "O2'" sing N N 24 ADP "C2'" "C1'" sing N N 25 ADP "C2'" "H2'" sing N N 26 ADP "O2'" "HO2'" sing N N 27 ADP "C1'" N9 sing N N 28 ADP "C1'" "H1'" sing N N 29 ADP N9 C8 sing Y N 30 ADP N9 C4 sing Y N 31 ADP C8 N7 doub Y N 32 ADP C8 H8 sing N N 33 ADP N7 C5 sing Y N 34 ADP C5 C6 sing Y N 35 ADP C5 C4 doub Y N 36 ADP C6 N6 sing N N 37 ADP C6 N1 doub Y N 38 ADP N6 HN61 sing N N 39 ADP N6 HN62 sing N N 40 ADP N1 C2 sing Y N 41 ADP C2 N3 doub Y N 42 ADP C2 H2 sing N N 43 ADP N3 C4 sing Y N 44 ALA N CA sing N N 45 ALA N H sing N N 46 ALA N H2 sing N N 47 ALA CA C sing N N 48 ALA CA CB sing N N 49 ALA CA HA sing N N 50 ALA C O doub N N 51 ALA C OXT sing N N 52 ALA CB HB1 sing N N 53 ALA CB HB2 sing N N 54 ALA CB HB3 sing N N 55 ALA OXT HXT sing N N 56 ARG N CA sing N N 57 ARG N H sing N N 58 ARG N H2 sing N N 59 ARG CA C sing N N 60 ARG CA CB sing N N 61 ARG CA HA sing N N 62 ARG C O doub N N 63 ARG C OXT sing N N 64 ARG CB CG sing N N 65 ARG CB HB2 sing N N 66 ARG CB HB3 sing N N 67 ARG CG CD sing N N 68 ARG CG HG2 sing N N 69 ARG CG HG3 sing N N 70 ARG CD NE sing N N 71 ARG CD HD2 sing N N 72 ARG CD HD3 sing N N 73 ARG NE CZ sing N N 74 ARG NE HE sing N N 75 ARG CZ NH1 sing N N 76 ARG CZ NH2 doub N N 77 ARG NH1 HH11 sing N N 78 ARG NH1 HH12 sing N N 79 ARG NH2 HH21 sing N N 80 ARG NH2 HH22 sing N N 81 ARG OXT HXT sing N N 82 ASN N CA sing N N 83 ASN N H sing N N 84 ASN N H2 sing N N 85 ASN CA C sing N N 86 ASN CA CB sing N N 87 ASN CA HA sing N N 88 ASN C O doub N N 89 ASN C OXT sing N N 90 ASN CB CG sing N N 91 ASN CB HB2 sing N N 92 ASN CB HB3 sing N N 93 ASN CG OD1 doub N N 94 ASN CG ND2 sing N N 95 ASN ND2 HD21 sing N N 96 ASN ND2 HD22 sing N N 97 ASN OXT HXT sing N N 98 ASP N CA sing N N 99 ASP N H sing N N 100 ASP N H2 sing N N 101 ASP CA C sing N N 102 ASP CA CB sing N N 103 ASP CA HA sing N N 104 ASP C O doub N N 105 ASP C OXT sing N N 106 ASP CB CG sing N N 107 ASP CB HB2 sing N N 108 ASP CB HB3 sing N N 109 ASP CG OD1 doub N N 110 ASP CG OD2 sing N N 111 ASP OD2 HD2 sing N N 112 ASP OXT HXT sing N N 113 CYS N CA sing N N 114 CYS N H sing N N 115 CYS N H2 sing N N 116 CYS CA C sing N N 117 CYS CA CB sing N N 118 CYS CA HA sing N N 119 CYS C O doub N N 120 CYS C OXT sing N N 121 CYS CB SG sing N N 122 CYS CB HB2 sing N N 123 CYS CB HB3 sing N N 124 CYS SG HG sing N N 125 CYS OXT HXT sing N N 126 GLN N CA sing N N 127 GLN N H sing N N 128 GLN N H2 sing N N 129 GLN CA C sing N N 130 GLN CA CB sing N N 131 GLN CA HA sing N N 132 GLN C O doub N N 133 GLN C OXT sing N N 134 GLN CB CG sing N N 135 GLN CB HB2 sing N N 136 GLN CB HB3 sing N N 137 GLN CG CD sing N N 138 GLN CG HG2 sing N N 139 GLN CG HG3 sing N N 140 GLN CD OE1 doub N N 141 GLN CD NE2 sing N N 142 GLN NE2 HE21 sing N N 143 GLN NE2 HE22 sing N N 144 GLN OXT HXT sing N N 145 GLU N CA sing N N 146 GLU N H sing N N 147 GLU N H2 sing N N 148 GLU CA C sing N N 149 GLU CA CB sing N N 150 GLU CA HA sing N N 151 GLU C O doub N N 152 GLU C OXT sing N N 153 GLU CB CG sing N N 154 GLU CB HB2 sing N N 155 GLU CB HB3 sing N N 156 GLU CG CD sing N N 157 GLU CG HG2 sing N N 158 GLU CG HG3 sing N N 159 GLU CD OE1 doub N N 160 GLU CD OE2 sing N N 161 GLU OE2 HE2 sing N N 162 GLU OXT HXT sing N N 163 GLY N CA sing N N 164 GLY N H sing N N 165 GLY N H2 sing N N 166 GLY CA C sing N N 167 GLY CA HA2 sing N N 168 GLY CA HA3 sing N N 169 GLY C O doub N N 170 GLY C OXT sing N N 171 GLY OXT HXT sing N N 172 HIS N CA sing N N 173 HIS N H sing N N 174 HIS N H2 sing N N 175 HIS CA C sing N N 176 HIS CA CB sing N N 177 HIS CA HA sing N N 178 HIS C O doub N N 179 HIS C OXT sing N N 180 HIS CB CG sing N N 181 HIS CB HB2 sing N N 182 HIS CB HB3 sing N N 183 HIS CG ND1 sing Y N 184 HIS CG CD2 doub Y N 185 HIS ND1 CE1 doub Y N 186 HIS ND1 HD1 sing N N 187 HIS CD2 NE2 sing Y N 188 HIS CD2 HD2 sing N N 189 HIS CE1 NE2 sing Y N 190 HIS CE1 HE1 sing N N 191 HIS NE2 HE2 sing N N 192 HIS OXT HXT sing N N 193 HOH O H1 sing N N 194 HOH O H2 sing N N 195 ILE N CA sing N N 196 ILE N H sing N N 197 ILE N H2 sing N N 198 ILE CA C sing N N 199 ILE CA CB sing N N 200 ILE CA HA sing N N 201 ILE C O doub N N 202 ILE C OXT sing N N 203 ILE CB CG1 sing N N 204 ILE CB CG2 sing N N 205 ILE CB HB sing N N 206 ILE CG1 CD1 sing N N 207 ILE CG1 HG12 sing N N 208 ILE CG1 HG13 sing N N 209 ILE CG2 HG21 sing N N 210 ILE CG2 HG22 sing N N 211 ILE CG2 HG23 sing N N 212 ILE CD1 HD11 sing N N 213 ILE CD1 HD12 sing N N 214 ILE CD1 HD13 sing N N 215 ILE OXT HXT sing N N 216 LEU N CA sing N N 217 LEU N H sing N N 218 LEU N H2 sing N N 219 LEU CA C sing N N 220 LEU CA CB sing N N 221 LEU CA HA sing N N 222 LEU C O doub N N 223 LEU C OXT sing N N 224 LEU CB CG sing N N 225 LEU CB HB2 sing N N 226 LEU CB HB3 sing N N 227 LEU CG CD1 sing N N 228 LEU CG CD2 sing N N 229 LEU CG HG sing N N 230 LEU CD1 HD11 sing N N 231 LEU CD1 HD12 sing N N 232 LEU CD1 HD13 sing N N 233 LEU CD2 HD21 sing N N 234 LEU CD2 HD22 sing N N 235 LEU CD2 HD23 sing N N 236 LEU OXT HXT sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 MET N CA sing N N 262 MET N H sing N N 263 MET N H2 sing N N 264 MET CA C sing N N 265 MET CA CB sing N N 266 MET CA HA sing N N 267 MET C O doub N N 268 MET C OXT sing N N 269 MET CB CG sing N N 270 MET CB HB2 sing N N 271 MET CB HB3 sing N N 272 MET CG SD sing N N 273 MET CG HG2 sing N N 274 MET CG HG3 sing N N 275 MET SD CE sing N N 276 MET CE HE1 sing N N 277 MET CE HE2 sing N N 278 MET CE HE3 sing N N 279 MET OXT HXT sing N N 280 PHE N CA sing N N 281 PHE N H sing N N 282 PHE N H2 sing N N 283 PHE CA C sing N N 284 PHE CA CB sing N N 285 PHE CA HA sing N N 286 PHE C O doub N N 287 PHE C OXT sing N N 288 PHE CB CG sing N N 289 PHE CB HB2 sing N N 290 PHE CB HB3 sing N N 291 PHE CG CD1 doub Y N 292 PHE CG CD2 sing Y N 293 PHE CD1 CE1 sing Y N 294 PHE CD1 HD1 sing N N 295 PHE CD2 CE2 doub Y N 296 PHE CD2 HD2 sing N N 297 PHE CE1 CZ doub Y N 298 PHE CE1 HE1 sing N N 299 PHE CE2 CZ sing Y N 300 PHE CE2 HE2 sing N N 301 PHE CZ HZ sing N N 302 PHE OXT HXT sing N N 303 PRO N CA sing N N 304 PRO N CD sing N N 305 PRO N H sing N N 306 PRO CA C sing N N 307 PRO CA CB sing N N 308 PRO CA HA sing N N 309 PRO C O doub N N 310 PRO C OXT sing N N 311 PRO CB CG sing N N 312 PRO CB HB2 sing N N 313 PRO CB HB3 sing N N 314 PRO CG CD sing N N 315 PRO CG HG2 sing N N 316 PRO CG HG3 sing N N 317 PRO CD HD2 sing N N 318 PRO CD HD3 sing N N 319 PRO OXT HXT sing N N 320 SER N CA sing N N 321 SER N H sing N N 322 SER N H2 sing N N 323 SER CA C sing N N 324 SER CA CB sing N N 325 SER CA HA sing N N 326 SER C O doub N N 327 SER C OXT sing N N 328 SER CB OG sing N N 329 SER CB HB2 sing N N 330 SER CB HB3 sing N N 331 SER OG HG sing N N 332 SER OXT HXT sing N N 333 THR N CA sing N N 334 THR N H sing N N 335 THR N H2 sing N N 336 THR CA C sing N N 337 THR CA CB sing N N 338 THR CA HA sing N N 339 THR C O doub N N 340 THR C OXT sing N N 341 THR CB OG1 sing N N 342 THR CB CG2 sing N N 343 THR CB HB sing N N 344 THR OG1 HG1 sing N N 345 THR CG2 HG21 sing N N 346 THR CG2 HG22 sing N N 347 THR CG2 HG23 sing N N 348 THR OXT HXT sing N N 349 TYR N CA sing N N 350 TYR N H sing N N 351 TYR N H2 sing N N 352 TYR CA C sing N N 353 TYR CA CB sing N N 354 TYR CA HA sing N N 355 TYR C O doub N N 356 TYR C OXT sing N N 357 TYR CB CG sing N N 358 TYR CB HB2 sing N N 359 TYR CB HB3 sing N N 360 TYR CG CD1 doub Y N 361 TYR CG CD2 sing Y N 362 TYR CD1 CE1 sing Y N 363 TYR CD1 HD1 sing N N 364 TYR CD2 CE2 doub Y N 365 TYR CD2 HD2 sing N N 366 TYR CE1 CZ doub Y N 367 TYR CE1 HE1 sing N N 368 TYR CE2 CZ sing Y N 369 TYR CE2 HE2 sing N N 370 TYR CZ OH sing N N 371 TYR OH HH sing N N 372 TYR OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-DIPHOSPHATE" ADP 3 'MAGNESIUM ION' MG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1BG2 _pdbx_initial_refinement_model.details ? #