data_5HNV # _entry.id 5HNV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HNV WWPDB D_1000216751 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HNV _pdbx_database_status.recvd_initial_deposition_date 2016-01-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, P.P.' 1 'Ran, T.T.' 2 'Wang, W.W.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 475 _citation.language ? _citation.page_first 2209 _citation.page_last 2224 _citation.title 'Crystal structures of the kinase domain of PpkA, a key regulatory component of T6SS, reveal a general inhibitory mechanism.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20180077 _citation.pdbx_database_id_PubMed 29858276 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, P.P.' 1 ? primary 'Xu, D.Q.' 2 ? primary 'Ma, T.Q.' 3 ? primary 'Wang, D.Y.' 4 ? primary 'Li, W.D.' 5 ? primary 'He, J.H.' 6 ? primary 'Ran, T.T.' 7 ? primary 'Wang, W.W.' 8 0000-0001-6922-9207 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5HNV _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.753 _cell.length_a_esd ? _cell.length_b 78.282 _cell.length_b_esd ? _cell.length_c 59.162 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HNV _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PpkA N terminal' 34112.215 1 ? ? ? ? 2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 267 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSGTGITKPNSNSLPSGYRFNEFEIQEAIGEGGFGIVYRAYDHQLERTIAIKEYMPTSLAKRNDDLSIGLRGERFGKTFQ AGLNSFIQEARLLARFSHPGLLHVLRFWEENGTAYMGTQFYSGTTLKNLQAQQPEKIDEAWIRRLLPPLFSAINTIHQEG YLHRDISLDNIQIQESQLPVLLDFGSARKEIGNLSDETEIVLKPGFAPIEQYTENSDGEQGPWTDIYALGAVLHTLIVGS PPPVSVVRSIEDSYQPLTERRPAGYSPELLRTVDRALALKPEDRPQTIDEMAELLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSGTGITKPNSNSLPSGYRFNEFEIQEAIGEGGFGIVYRAYDHQLERTIAIKEYMPTSLAKRNDDLSIGLRGERFGKTFQ AGLNSFIQEARLLARFSHPGLLHVLRFWEENGTAYMGTQFYSGTTLKNLQAQQPEKIDEAWIRRLLPPLFSAINTIHQEG YLHRDISLDNIQIQESQLPVLLDFGSARKEIGNLSDETEIVLKPGFAPIEQYTENSDGEQGPWTDIYALGAVLHTLIVGS PPPVSVVRSIEDSYQPLTERRPAGYSPELLRTVDRALALKPEDRPQTIDEMAELLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 THR n 1 5 GLY n 1 6 ILE n 1 7 THR n 1 8 LYS n 1 9 PRO n 1 10 ASN n 1 11 SER n 1 12 ASN n 1 13 SER n 1 14 LEU n 1 15 PRO n 1 16 SER n 1 17 GLY n 1 18 TYR n 1 19 ARG n 1 20 PHE n 1 21 ASN n 1 22 GLU n 1 23 PHE n 1 24 GLU n 1 25 ILE n 1 26 GLN n 1 27 GLU n 1 28 ALA n 1 29 ILE n 1 30 GLY n 1 31 GLU n 1 32 GLY n 1 33 GLY n 1 34 PHE n 1 35 GLY n 1 36 ILE n 1 37 VAL n 1 38 TYR n 1 39 ARG n 1 40 ALA n 1 41 TYR n 1 42 ASP n 1 43 HIS n 1 44 GLN n 1 45 LEU n 1 46 GLU n 1 47 ARG n 1 48 THR n 1 49 ILE n 1 50 ALA n 1 51 ILE n 1 52 LYS n 1 53 GLU n 1 54 TYR n 1 55 MET n 1 56 PRO n 1 57 THR n 1 58 SER n 1 59 LEU n 1 60 ALA n 1 61 LYS n 1 62 ARG n 1 63 ASN n 1 64 ASP n 1 65 ASP n 1 66 LEU n 1 67 SER n 1 68 ILE n 1 69 GLY n 1 70 LEU n 1 71 ARG n 1 72 GLY n 1 73 GLU n 1 74 ARG n 1 75 PHE n 1 76 GLY n 1 77 LYS n 1 78 THR n 1 79 PHE n 1 80 GLN n 1 81 ALA n 1 82 GLY n 1 83 LEU n 1 84 ASN n 1 85 SER n 1 86 PHE n 1 87 ILE n 1 88 GLN n 1 89 GLU n 1 90 ALA n 1 91 ARG n 1 92 LEU n 1 93 LEU n 1 94 ALA n 1 95 ARG n 1 96 PHE n 1 97 SER n 1 98 HIS n 1 99 PRO n 1 100 GLY n 1 101 LEU n 1 102 LEU n 1 103 HIS n 1 104 VAL n 1 105 LEU n 1 106 ARG n 1 107 PHE n 1 108 TRP n 1 109 GLU n 1 110 GLU n 1 111 ASN n 1 112 GLY n 1 113 THR n 1 114 ALA n 1 115 TYR n 1 116 MET n 1 117 GLY n 1 118 THR n 1 119 GLN n 1 120 PHE n 1 121 TYR n 1 122 SER n 1 123 GLY n 1 124 THR n 1 125 THR n 1 126 LEU n 1 127 LYS n 1 128 ASN n 1 129 LEU n 1 130 GLN n 1 131 ALA n 1 132 GLN n 1 133 GLN n 1 134 PRO n 1 135 GLU n 1 136 LYS n 1 137 ILE n 1 138 ASP n 1 139 GLU n 1 140 ALA n 1 141 TRP n 1 142 ILE n 1 143 ARG n 1 144 ARG n 1 145 LEU n 1 146 LEU n 1 147 PRO n 1 148 PRO n 1 149 LEU n 1 150 PHE n 1 151 SER n 1 152 ALA n 1 153 ILE n 1 154 ASN n 1 155 THR n 1 156 ILE n 1 157 HIS n 1 158 GLN n 1 159 GLU n 1 160 GLY n 1 161 TYR n 1 162 LEU n 1 163 HIS n 1 164 ARG n 1 165 ASP n 1 166 ILE n 1 167 SER n 1 168 LEU n 1 169 ASP n 1 170 ASN n 1 171 ILE n 1 172 GLN n 1 173 ILE n 1 174 GLN n 1 175 GLU n 1 176 SER n 1 177 GLN n 1 178 LEU n 1 179 PRO n 1 180 VAL n 1 181 LEU n 1 182 LEU n 1 183 ASP n 1 184 PHE n 1 185 GLY n 1 186 SER n 1 187 ALA n 1 188 ARG n 1 189 LYS n 1 190 GLU n 1 191 ILE n 1 192 GLY n 1 193 ASN n 1 194 LEU n 1 195 SER n 1 196 ASP n 1 197 GLU n 1 198 THR n 1 199 GLU n 1 200 ILE n 1 201 VAL n 1 202 LEU n 1 203 LYS n 1 204 PRO n 1 205 GLY n 1 206 PHE n 1 207 ALA n 1 208 PRO n 1 209 ILE n 1 210 GLU n 1 211 GLN n 1 212 TYR n 1 213 THR n 1 214 GLU n 1 215 ASN n 1 216 SER n 1 217 ASP n 1 218 GLY n 1 219 GLU n 1 220 GLN n 1 221 GLY n 1 222 PRO n 1 223 TRP n 1 224 THR n 1 225 ASP n 1 226 ILE n 1 227 TYR n 1 228 ALA n 1 229 LEU n 1 230 GLY n 1 231 ALA n 1 232 VAL n 1 233 LEU n 1 234 HIS n 1 235 THR n 1 236 LEU n 1 237 ILE n 1 238 VAL n 1 239 GLY n 1 240 SER n 1 241 PRO n 1 242 PRO n 1 243 PRO n 1 244 VAL n 1 245 SER n 1 246 VAL n 1 247 VAL n 1 248 ARG n 1 249 SER n 1 250 ILE n 1 251 GLU n 1 252 ASP n 1 253 SER n 1 254 TYR n 1 255 GLN n 1 256 PRO n 1 257 LEU n 1 258 THR n 1 259 GLU n 1 260 ARG n 1 261 ARG n 1 262 PRO n 1 263 ALA n 1 264 GLY n 1 265 TYR n 1 266 SER n 1 267 PRO n 1 268 GLU n 1 269 LEU n 1 270 LEU n 1 271 ARG n 1 272 THR n 1 273 VAL n 1 274 ASP n 1 275 ARG n 1 276 ALA n 1 277 LEU n 1 278 ALA n 1 279 LEU n 1 280 LYS n 1 281 PRO n 1 282 GLU n 1 283 ASP n 1 284 ARG n 1 285 PRO n 1 286 GLN n 1 287 THR n 1 288 ILE n 1 289 ASP n 1 290 GLU n 1 291 MET n 1 292 ALA n 1 293 GLU n 1 294 LEU n 1 295 LEU n 1 296 GLU n 1 297 HIS n 1 298 HIS n 1 299 HIS n 1 300 HIS n 1 301 HIS n 1 302 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 302 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Serratia sp. FS14' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1327989 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain C43 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5HNV _struct_ref.pdbx_db_accession 5HNV _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HNV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 302 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5HNV _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 302 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 302 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HNV _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG3350, HEPES, sodium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HNV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.41 _reflns.d_resolution_low 20 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 59128 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.8 _reflns.pdbx_Rmerge_I_obs 0.042 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.41 _reflns_shell.d_res_low 1.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 95.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.737 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HNV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.410 _refine.ls_d_res_low 19.879 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 59070 _refine.ls_number_reflns_R_free 2945 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.25 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1840 _refine.ls_R_factor_R_free 0.2100 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1827 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.57 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.13 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2260 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.number_atoms_solvent 267 _refine_hist.number_atoms_total 2565 _refine_hist.d_res_high 1.410 _refine_hist.d_res_low 19.879 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2369 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.960 ? 3222 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 23.670 ? 896 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.084 ? 348 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 420 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4101 1.4332 . . 95 2268 85.00 . . . 0.2757 . 0.2713 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4332 1.4579 . . 148 2661 100.00 . . . 0.2914 . 0.2380 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4579 1.4844 . . 145 2630 100.00 . . . 0.2405 . 0.2307 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4844 1.5130 . . 138 2670 100.00 . . . 0.2611 . 0.2222 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5130 1.5438 . . 121 2660 100.00 . . . 0.2371 . 0.2189 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5438 1.5774 . . 146 2676 100.00 . . . 0.2772 . 0.2184 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5774 1.6141 . . 160 2626 100.00 . . . 0.2086 . 0.1965 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6141 1.6544 . . 135 2656 100.00 . . . 0.2440 . 0.1943 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6544 1.6991 . . 119 2716 100.00 . . . 0.2115 . 0.1900 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6991 1.7491 . . 149 2647 100.00 . . . 0.2025 . 0.1960 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7491 1.8055 . . 153 2667 100.00 . . . 0.2039 . 0.1901 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8055 1.8700 . . 142 2668 100.00 . . . 0.2468 . 0.1937 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8700 1.9448 . . 137 2672 100.00 . . . 0.2209 . 0.1893 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9448 2.0332 . . 146 2694 100.00 . . . 0.2292 . 0.1836 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0332 2.1403 . . 150 2685 100.00 . . . 0.2011 . 0.1891 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1403 2.2742 . . 141 2717 100.00 . . . 0.2115 . 0.1805 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2742 2.4495 . . 134 2708 100.00 . . . 0.2163 . 0.1882 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4495 2.6955 . . 124 2744 100.00 . . . 0.2016 . 0.1853 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6955 3.0843 . . 146 2717 100.00 . . . 0.2011 . 0.1885 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0843 3.8812 . . 156 2756 100.00 . . . 0.2051 . 0.1645 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8812 10 . . 160 2887 100.00 . . . 0.1878 . 0.1621 . . . . . . . . . . # _struct.entry_id 5HNV _struct.title 'Crystal structure of PpkA' _struct.pdbx_descriptor 'PpkA N terminal' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HNV _struct_keywords.text 'Kinase, complex, t6ss, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 72 ? ARG A 74 ? GLY A 72 ARG A 74 5 ? 3 HELX_P HELX_P2 AA2 PHE A 75 ? ALA A 94 ? PHE A 75 ALA A 94 1 ? 20 HELX_P HELX_P3 AA3 LEU A 126 ? GLN A 133 ? LEU A 126 GLN A 133 1 ? 8 HELX_P HELX_P4 AA4 PRO A 134 ? ILE A 137 ? PRO A 134 ILE A 137 5 ? 4 HELX_P HELX_P5 AA5 ASP A 138 ? GLU A 159 ? ASP A 138 GLU A 159 1 ? 22 HELX_P HELX_P6 AA6 GLY A 185 ? ASP A 196 ? GLY A 185 ASP A 196 1 ? 12 HELX_P HELX_P7 AA7 GLU A 197 ? VAL A 201 ? GLU A 197 VAL A 201 5 ? 5 HELX_P HELX_P8 AA8 PRO A 208 ? TYR A 212 ? PRO A 208 TYR A 212 5 ? 5 HELX_P HELX_P9 AA9 GLY A 221 ? GLY A 239 ? GLY A 221 GLY A 239 1 ? 19 HELX_P HELX_P10 AB1 VAL A 244 ? GLU A 251 ? VAL A 244 GLU A 251 1 ? 8 HELX_P HELX_P11 AB2 PRO A 256 ? ARG A 261 ? PRO A 256 ARG A 261 1 ? 6 HELX_P HELX_P12 AB3 SER A 266 ? LEU A 277 ? SER A 266 LEU A 277 1 ? 12 HELX_P HELX_P13 AB4 LYS A 280 ? ARG A 284 ? LYS A 280 ARG A 284 5 ? 5 HELX_P HELX_P14 AB5 THR A 287 ? LEU A 295 ? THR A 287 LEU A 295 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ATP . O3G ? ? ? 1_555 C MG . MG ? ? A ATP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.130 ? metalc2 metalc ? ? B ATP . O2B ? ? ? 1_555 C MG . MG ? ? A ATP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.027 ? metalc3 metalc ? ? B ATP . O2A ? ? ? 1_555 C MG . MG ? ? A ATP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.089 ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 402 A HOH 512 1_555 ? ? ? ? ? ? ? 2.161 ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 402 A HOH 681 1_555 ? ? ? ? ? ? ? 2.348 ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 402 A HOH 686 1_555 ? ? ? ? ? ? ? 1.949 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 19 ? PHE A 20 ? ARG A 19 PHE A 20 AA1 2 PHE A 23 ? GLU A 31 ? PHE A 23 GLU A 31 AA1 3 GLY A 35 ? ASP A 42 ? GLY A 35 ASP A 42 AA1 4 ARG A 47 ? TYR A 54 ? ARG A 47 TYR A 54 AA1 5 THR A 113 ? GLN A 119 ? THR A 113 GLN A 119 AA1 6 VAL A 104 ? GLU A 110 ? VAL A 104 GLU A 110 AA2 1 ALA A 60 ? ARG A 62 ? ALA A 60 ARG A 62 AA2 2 ILE A 68 ? LEU A 70 ? ILE A 68 LEU A 70 AA3 1 THR A 124 ? THR A 125 ? THR A 124 THR A 125 AA3 2 ILE A 171 ? ILE A 173 ? ILE A 171 ILE A 173 AA3 3 PRO A 179 ? LEU A 181 ? PRO A 179 LEU A 181 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 20 ? N PHE A 20 O PHE A 23 ? O PHE A 23 AA1 2 3 N GLN A 26 ? N GLN A 26 O ARG A 39 ? O ARG A 39 AA1 3 4 N ASP A 42 ? N ASP A 42 O ARG A 47 ? O ARG A 47 AA1 4 5 N ALA A 50 ? N ALA A 50 O THR A 118 ? O THR A 118 AA1 5 6 O GLY A 117 ? O GLY A 117 N LEU A 105 ? N LEU A 105 AA2 1 2 N LYS A 61 ? N LYS A 61 O GLY A 69 ? O GLY A 69 AA3 1 2 N THR A 124 ? N THR A 124 O ILE A 173 ? O ILE A 173 AA3 2 3 N GLN A 172 ? N GLN A 172 O VAL A 180 ? O VAL A 180 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ATP 401 ? 24 'binding site for residue ATP A 401' AC2 Software A MG 402 ? 4 'binding site for residue MG A 402' AC3 Software A GOL 403 ? 7 'binding site for residue GOL A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 24 ILE A 29 ? ILE A 29 . ? 1_555 ? 2 AC1 24 GLY A 30 ? GLY A 30 . ? 1_555 ? 3 AC1 24 GLU A 31 ? GLU A 31 . ? 1_555 ? 4 AC1 24 ALA A 50 ? ALA A 50 . ? 1_555 ? 5 AC1 24 LEU A 102 ? LEU A 102 . ? 1_555 ? 6 AC1 24 THR A 118 ? THR A 118 . ? 1_555 ? 7 AC1 24 GLN A 119 ? GLN A 119 . ? 1_555 ? 8 AC1 24 TYR A 121 ? TYR A 121 . ? 1_555 ? 9 AC1 24 THR A 125 ? THR A 125 . ? 1_555 ? 10 AC1 24 LYS A 127 ? LYS A 127 . ? 1_555 ? 11 AC1 24 ASN A 128 ? ASN A 128 . ? 1_555 ? 12 AC1 24 GLN A 172 ? GLN A 172 . ? 1_555 ? 13 AC1 24 MG C . ? MG A 402 . ? 1_555 ? 14 AC1 24 GOL D . ? GOL A 403 . ? 1_555 ? 15 AC1 24 HOH E . ? HOH A 505 . ? 1_555 ? 16 AC1 24 HOH E . ? HOH A 512 . ? 1_555 ? 17 AC1 24 HOH E . ? HOH A 516 . ? 1_555 ? 18 AC1 24 HOH E . ? HOH A 519 . ? 1_555 ? 19 AC1 24 HOH E . ? HOH A 570 . ? 1_555 ? 20 AC1 24 HOH E . ? HOH A 643 . ? 1_555 ? 21 AC1 24 HOH E . ? HOH A 657 . ? 1_555 ? 22 AC1 24 HOH E . ? HOH A 678 . ? 1_555 ? 23 AC1 24 HOH E . ? HOH A 681 . ? 1_555 ? 24 AC1 24 HOH E . ? HOH A 686 . ? 1_555 ? 25 AC2 4 ATP B . ? ATP A 401 . ? 1_555 ? 26 AC2 4 HOH E . ? HOH A 512 . ? 1_555 ? 27 AC2 4 HOH E . ? HOH A 681 . ? 1_555 ? 28 AC2 4 HOH E . ? HOH A 686 . ? 1_555 ? 29 AC3 7 LYS A 52 ? LYS A 52 . ? 1_555 ? 30 AC3 7 ASP A 169 ? ASP A 169 . ? 1_555 ? 31 AC3 7 ATP B . ? ATP A 401 . ? 1_555 ? 32 AC3 7 HOH E . ? HOH A 506 . ? 1_555 ? 33 AC3 7 HOH E . ? HOH A 565 . ? 1_555 ? 34 AC3 7 HOH E . ? HOH A 574 . ? 1_555 ? 35 AC3 7 HOH E . ? HOH A 671 . ? 1_555 ? # _atom_sites.entry_id 5HNV _atom_sites.fract_transf_matrix[1][1] 0.015208 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012774 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016903 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 ILE 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 HIS 163 163 163 HIS HIS A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 GLU 214 214 ? ? ? A . n A 1 215 ASN 215 215 ? ? ? A . n A 1 216 SER 216 216 ? ? ? A . n A 1 217 ASP 217 217 ? ? ? A . n A 1 218 GLY 218 218 ? ? ? A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 TRP 223 223 223 TRP TRP A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 TYR 227 227 227 TYR TYR A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 HIS 234 234 234 HIS HIS A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 SER 245 245 245 SER SER A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 ARG 248 248 248 ARG ARG A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 SER 253 253 253 SER SER A . n A 1 254 TYR 254 254 254 TYR TYR A . n A 1 255 GLN 255 255 255 GLN GLN A . n A 1 256 PRO 256 256 256 PRO PRO A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 THR 258 258 258 THR THR A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 ARG 260 260 260 ARG ARG A . n A 1 261 ARG 261 261 261 ARG ARG A . n A 1 262 PRO 262 262 262 PRO PRO A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 TYR 265 265 265 TYR TYR A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 PRO 267 267 267 PRO PRO A . n A 1 268 GLU 268 268 268 GLU GLU A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ARG 271 271 271 ARG ARG A . n A 1 272 THR 272 272 272 THR THR A . n A 1 273 VAL 273 273 273 VAL VAL A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 LEU 279 279 279 LEU LEU A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 PRO 281 281 281 PRO PRO A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 ARG 284 284 284 ARG ARG A . n A 1 285 PRO 285 285 285 PRO PRO A . n A 1 286 GLN 286 286 286 GLN GLN A . n A 1 287 THR 287 287 287 THR THR A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 ASP 289 289 289 ASP ASP A . n A 1 290 GLU 290 290 290 GLU GLU A . n A 1 291 MET 291 291 291 MET MET A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 HIS 297 297 297 HIS HIS A . n A 1 298 HIS 298 298 298 HIS HIS A . n A 1 299 HIS 299 299 ? ? ? A . n A 1 300 HIS 300 300 ? ? ? A . n A 1 301 HIS 301 301 ? ? ? A . n A 1 302 HIS 302 302 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ATP 1 401 1 ATP ATP A . C 3 MG 1 402 1 MG MG A . D 4 GOL 1 403 1 GOL GOL A . E 5 HOH 1 501 203 HOH HOH A . E 5 HOH 2 502 195 HOH HOH A . E 5 HOH 3 503 263 HOH HOH A . E 5 HOH 4 504 90 HOH HOH A . E 5 HOH 5 505 174 HOH HOH A . E 5 HOH 6 506 173 HOH HOH A . E 5 HOH 7 507 215 HOH HOH A . E 5 HOH 8 508 104 HOH HOH A . E 5 HOH 9 509 115 HOH HOH A . E 5 HOH 10 510 224 HOH HOH A . E 5 HOH 11 511 194 HOH HOH A . E 5 HOH 12 512 161 HOH HOH A . E 5 HOH 13 513 89 HOH HOH A . E 5 HOH 14 514 108 HOH HOH A . E 5 HOH 15 515 185 HOH HOH A . E 5 HOH 16 516 175 HOH HOH A . E 5 HOH 17 517 40 HOH HOH A . E 5 HOH 18 518 259 HOH HOH A . E 5 HOH 19 519 12 HOH HOH A . E 5 HOH 20 520 3 HOH HOH A . E 5 HOH 21 521 41 HOH HOH A . E 5 HOH 22 522 191 HOH HOH A . E 5 HOH 23 523 184 HOH HOH A . E 5 HOH 24 524 83 HOH HOH A . E 5 HOH 25 525 37 HOH HOH A . E 5 HOH 26 526 78 HOH HOH A . E 5 HOH 27 527 186 HOH HOH A . E 5 HOH 28 528 111 HOH HOH A . E 5 HOH 29 529 9 HOH HOH A . E 5 HOH 30 530 197 HOH HOH A . E 5 HOH 31 531 139 HOH HOH A . E 5 HOH 32 532 158 HOH HOH A . E 5 HOH 33 533 24 HOH HOH A . E 5 HOH 34 534 227 HOH HOH A . E 5 HOH 35 535 20 HOH HOH A . E 5 HOH 36 536 35 HOH HOH A . E 5 HOH 37 537 86 HOH HOH A . E 5 HOH 38 538 70 HOH HOH A . E 5 HOH 39 539 31 HOH HOH A . E 5 HOH 40 540 110 HOH HOH A . E 5 HOH 41 541 45 HOH HOH A . E 5 HOH 42 542 234 HOH HOH A . E 5 HOH 43 543 255 HOH HOH A . E 5 HOH 44 544 180 HOH HOH A . E 5 HOH 45 545 98 HOH HOH A . E 5 HOH 46 546 192 HOH HOH A . E 5 HOH 47 547 21 HOH HOH A . E 5 HOH 48 548 33 HOH HOH A . E 5 HOH 49 549 143 HOH HOH A . E 5 HOH 50 550 66 HOH HOH A . E 5 HOH 51 551 207 HOH HOH A . E 5 HOH 52 552 62 HOH HOH A . E 5 HOH 53 553 163 HOH HOH A . E 5 HOH 54 554 232 HOH HOH A . E 5 HOH 55 555 25 HOH HOH A . E 5 HOH 56 556 23 HOH HOH A . E 5 HOH 57 557 71 HOH HOH A . E 5 HOH 58 558 202 HOH HOH A . E 5 HOH 59 559 148 HOH HOH A . E 5 HOH 60 560 198 HOH HOH A . E 5 HOH 61 561 92 HOH HOH A . E 5 HOH 62 562 189 HOH HOH A . E 5 HOH 63 563 181 HOH HOH A . E 5 HOH 64 564 15 HOH HOH A . E 5 HOH 65 565 6 HOH HOH A . E 5 HOH 66 566 164 HOH HOH A . E 5 HOH 67 567 182 HOH HOH A . E 5 HOH 68 568 178 HOH HOH A . E 5 HOH 69 569 59 HOH HOH A . E 5 HOH 70 570 176 HOH HOH A . E 5 HOH 71 571 47 HOH HOH A . E 5 HOH 72 572 52 HOH HOH A . E 5 HOH 73 573 61 HOH HOH A . E 5 HOH 74 574 251 HOH HOH A . E 5 HOH 75 575 26 HOH HOH A . E 5 HOH 76 576 165 HOH HOH A . E 5 HOH 77 577 250 HOH HOH A . E 5 HOH 78 578 5 HOH HOH A . E 5 HOH 79 579 74 HOH HOH A . E 5 HOH 80 580 44 HOH HOH A . E 5 HOH 81 581 170 HOH HOH A . E 5 HOH 82 582 252 HOH HOH A . E 5 HOH 83 583 79 HOH HOH A . E 5 HOH 84 584 265 HOH HOH A . E 5 HOH 85 585 38 HOH HOH A . E 5 HOH 86 586 29 HOH HOH A . E 5 HOH 87 587 209 HOH HOH A . E 5 HOH 88 588 179 HOH HOH A . E 5 HOH 89 589 42 HOH HOH A . E 5 HOH 90 590 196 HOH HOH A . E 5 HOH 91 591 22 HOH HOH A . E 5 HOH 92 592 95 HOH HOH A . E 5 HOH 93 593 166 HOH HOH A . E 5 HOH 94 594 65 HOH HOH A . E 5 HOH 95 595 211 HOH HOH A . E 5 HOH 96 596 153 HOH HOH A . E 5 HOH 97 597 200 HOH HOH A . E 5 HOH 98 598 169 HOH HOH A . E 5 HOH 99 599 63 HOH HOH A . E 5 HOH 100 600 30 HOH HOH A . E 5 HOH 101 601 231 HOH HOH A . E 5 HOH 102 602 124 HOH HOH A . E 5 HOH 103 603 50 HOH HOH A . E 5 HOH 104 604 218 HOH HOH A . E 5 HOH 105 605 120 HOH HOH A . E 5 HOH 106 606 228 HOH HOH A . E 5 HOH 107 607 28 HOH HOH A . E 5 HOH 108 608 149 HOH HOH A . E 5 HOH 109 609 152 HOH HOH A . E 5 HOH 110 610 140 HOH HOH A . E 5 HOH 111 611 222 HOH HOH A . E 5 HOH 112 612 130 HOH HOH A . E 5 HOH 113 613 55 HOH HOH A . E 5 HOH 114 614 73 HOH HOH A . E 5 HOH 115 615 129 HOH HOH A . E 5 HOH 116 616 210 HOH HOH A . E 5 HOH 117 617 48 HOH HOH A . E 5 HOH 118 618 11 HOH HOH A . E 5 HOH 119 619 1 HOH HOH A . E 5 HOH 120 620 27 HOH HOH A . E 5 HOH 121 621 241 HOH HOH A . E 5 HOH 122 622 221 HOH HOH A . E 5 HOH 123 623 75 HOH HOH A . E 5 HOH 124 624 223 HOH HOH A . E 5 HOH 125 625 14 HOH HOH A . E 5 HOH 126 626 18 HOH HOH A . E 5 HOH 127 627 199 HOH HOH A . E 5 HOH 128 628 97 HOH HOH A . E 5 HOH 129 629 107 HOH HOH A . E 5 HOH 130 630 233 HOH HOH A . E 5 HOH 131 631 43 HOH HOH A . E 5 HOH 132 632 267 HOH HOH A . E 5 HOH 133 633 32 HOH HOH A . E 5 HOH 134 634 201 HOH HOH A . E 5 HOH 135 635 188 HOH HOH A . E 5 HOH 136 636 82 HOH HOH A . E 5 HOH 137 637 60 HOH HOH A . E 5 HOH 138 638 177 HOH HOH A . E 5 HOH 139 639 121 HOH HOH A . E 5 HOH 140 640 146 HOH HOH A . E 5 HOH 141 641 205 HOH HOH A . E 5 HOH 142 642 2 HOH HOH A . E 5 HOH 143 643 266 HOH HOH A . E 5 HOH 144 644 36 HOH HOH A . E 5 HOH 145 645 91 HOH HOH A . E 5 HOH 146 646 213 HOH HOH A . E 5 HOH 147 647 162 HOH HOH A . E 5 HOH 148 648 247 HOH HOH A . E 5 HOH 149 649 235 HOH HOH A . E 5 HOH 150 650 100 HOH HOH A . E 5 HOH 151 651 57 HOH HOH A . E 5 HOH 152 652 88 HOH HOH A . E 5 HOH 153 653 103 HOH HOH A . E 5 HOH 154 654 93 HOH HOH A . E 5 HOH 155 655 260 HOH HOH A . E 5 HOH 156 656 19 HOH HOH A . E 5 HOH 157 657 172 HOH HOH A . E 5 HOH 158 658 39 HOH HOH A . E 5 HOH 159 659 56 HOH HOH A . E 5 HOH 160 660 242 HOH HOH A . E 5 HOH 161 661 138 HOH HOH A . E 5 HOH 162 662 17 HOH HOH A . E 5 HOH 163 663 84 HOH HOH A . E 5 HOH 164 664 214 HOH HOH A . E 5 HOH 165 665 87 HOH HOH A . E 5 HOH 166 666 85 HOH HOH A . E 5 HOH 167 667 240 HOH HOH A . E 5 HOH 168 668 226 HOH HOH A . E 5 HOH 169 669 187 HOH HOH A . E 5 HOH 170 670 204 HOH HOH A . E 5 HOH 171 671 168 HOH HOH A . E 5 HOH 172 672 157 HOH HOH A . E 5 HOH 173 673 245 HOH HOH A . E 5 HOH 174 674 81 HOH HOH A . E 5 HOH 175 675 132 HOH HOH A . E 5 HOH 176 676 119 HOH HOH A . E 5 HOH 177 677 34 HOH HOH A . E 5 HOH 178 678 133 HOH HOH A . E 5 HOH 179 679 154 HOH HOH A . E 5 HOH 180 680 109 HOH HOH A . E 5 HOH 181 681 160 HOH HOH A . E 5 HOH 182 682 219 HOH HOH A . E 5 HOH 183 683 7 HOH HOH A . E 5 HOH 184 684 225 HOH HOH A . E 5 HOH 185 685 53 HOH HOH A . E 5 HOH 186 686 258 HOH HOH A . E 5 HOH 187 687 141 HOH HOH A . E 5 HOH 188 688 67 HOH HOH A . E 5 HOH 189 689 261 HOH HOH A . E 5 HOH 190 690 253 HOH HOH A . E 5 HOH 191 691 58 HOH HOH A . E 5 HOH 192 692 190 HOH HOH A . E 5 HOH 193 693 49 HOH HOH A . E 5 HOH 194 694 106 HOH HOH A . E 5 HOH 195 695 8 HOH HOH A . E 5 HOH 196 696 46 HOH HOH A . E 5 HOH 197 697 112 HOH HOH A . E 5 HOH 198 698 167 HOH HOH A . E 5 HOH 199 699 155 HOH HOH A . E 5 HOH 200 700 4 HOH HOH A . E 5 HOH 201 701 134 HOH HOH A . E 5 HOH 202 702 114 HOH HOH A . E 5 HOH 203 703 238 HOH HOH A . E 5 HOH 204 704 16 HOH HOH A . E 5 HOH 205 705 159 HOH HOH A . E 5 HOH 206 706 116 HOH HOH A . E 5 HOH 207 707 127 HOH HOH A . E 5 HOH 208 708 239 HOH HOH A . E 5 HOH 209 709 135 HOH HOH A . E 5 HOH 210 710 105 HOH HOH A . E 5 HOH 211 711 229 HOH HOH A . E 5 HOH 212 712 142 HOH HOH A . E 5 HOH 213 713 72 HOH HOH A . E 5 HOH 214 714 102 HOH HOH A . E 5 HOH 215 715 151 HOH HOH A . E 5 HOH 216 716 68 HOH HOH A . E 5 HOH 217 717 144 HOH HOH A . E 5 HOH 218 718 113 HOH HOH A . E 5 HOH 219 719 244 HOH HOH A . E 5 HOH 220 720 193 HOH HOH A . E 5 HOH 221 721 99 HOH HOH A . E 5 HOH 222 722 236 HOH HOH A . E 5 HOH 223 723 254 HOH HOH A . E 5 HOH 224 724 13 HOH HOH A . E 5 HOH 225 725 80 HOH HOH A . E 5 HOH 226 726 136 HOH HOH A . E 5 HOH 227 727 256 HOH HOH A . E 5 HOH 228 728 123 HOH HOH A . E 5 HOH 229 729 51 HOH HOH A . E 5 HOH 230 730 237 HOH HOH A . E 5 HOH 231 731 220 HOH HOH A . E 5 HOH 232 732 126 HOH HOH A . E 5 HOH 233 733 183 HOH HOH A . E 5 HOH 234 734 206 HOH HOH A . E 5 HOH 235 735 64 HOH HOH A . E 5 HOH 236 736 171 HOH HOH A . E 5 HOH 237 737 96 HOH HOH A . E 5 HOH 238 738 249 HOH HOH A . E 5 HOH 239 739 212 HOH HOH A . E 5 HOH 240 740 262 HOH HOH A . E 5 HOH 241 741 147 HOH HOH A . E 5 HOH 242 742 248 HOH HOH A . E 5 HOH 243 743 208 HOH HOH A . E 5 HOH 244 744 125 HOH HOH A . E 5 HOH 245 745 137 HOH HOH A . E 5 HOH 246 746 145 HOH HOH A . E 5 HOH 247 747 131 HOH HOH A . E 5 HOH 248 748 69 HOH HOH A . E 5 HOH 249 749 117 HOH HOH A . E 5 HOH 250 750 128 HOH HOH A . E 5 HOH 251 751 216 HOH HOH A . E 5 HOH 252 752 246 HOH HOH A . E 5 HOH 253 753 217 HOH HOH A . E 5 HOH 254 754 101 HOH HOH A . E 5 HOH 255 755 243 HOH HOH A . E 5 HOH 256 756 264 HOH HOH A . E 5 HOH 257 757 76 HOH HOH A . E 5 HOH 258 758 94 HOH HOH A . E 5 HOH 259 759 10 HOH HOH A . E 5 HOH 260 760 230 HOH HOH A . E 5 HOH 261 761 150 HOH HOH A . E 5 HOH 262 762 122 HOH HOH A . E 5 HOH 263 763 77 HOH HOH A . E 5 HOH 264 764 257 HOH HOH A . E 5 HOH 265 765 54 HOH HOH A . E 5 HOH 266 766 118 HOH HOH A . E 5 HOH 267 767 156 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 50 ? 1 MORE -2 ? 1 'SSA (A^2)' 13210 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O3G ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2B ? B ATP . ? A ATP 401 ? 1_555 80.4 ? 2 O3G ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2A ? B ATP . ? A ATP 401 ? 1_555 89.2 ? 3 O2B ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O2A ? B ATP . ? A ATP 401 ? 1_555 84.9 ? 4 O3G ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 512 ? 1_555 82.0 ? 5 O2B ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 512 ? 1_555 74.2 ? 6 O2A ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 512 ? 1_555 158.4 ? 7 O3G ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 681 ? 1_555 165.5 ? 8 O2B ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 681 ? 1_555 85.1 ? 9 O2A ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 681 ? 1_555 88.2 ? 10 O ? E HOH . ? A HOH 512 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 681 ? 1_555 95.4 ? 11 O3G ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 686 ? 1_555 93.8 ? 12 O2B ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 686 ? 1_555 170.1 ? 13 O2A ? B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 686 ? 1_555 103.1 ? 14 O ? E HOH . ? A HOH 512 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 686 ? 1_555 97.1 ? 15 O ? E HOH . ? A HOH 681 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? E HOH . ? A HOH 686 ? 1_555 100.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-25 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2017-10-18 4 'Structure model' 1 3 2019-08-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_detector 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' citation 4 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_detector.detector' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_citation.country' 4 4 'Structure model' '_citation.journal_abbrev' 5 4 'Structure model' '_citation.journal_id_ASTM' 6 4 'Structure model' '_citation.journal_id_CSD' 7 4 'Structure model' '_citation.journal_id_ISSN' 8 4 'Structure model' '_citation.journal_volume' 9 4 'Structure model' '_citation.page_first' 10 4 'Structure model' '_citation.page_last' 11 4 'Structure model' '_citation.pdbx_database_id_DOI' 12 4 'Structure model' '_citation.pdbx_database_id_PubMed' 13 4 'Structure model' '_citation.title' 14 4 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER 11 ? ? OE1 A GLU 31 ? ? 2.18 2 1 OE1 A GLU 251 ? ? O A HOH 501 ? ? 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CD _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LYS _pdbx_validate_rmsd_angle.auth_seq_id_1 52 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 B _pdbx_validate_rmsd_angle.auth_atom_id_2 CE _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LYS _pdbx_validate_rmsd_angle.auth_seq_id_2 52 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 B _pdbx_validate_rmsd_angle.auth_atom_id_3 NZ _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LYS _pdbx_validate_rmsd_angle.auth_seq_id_3 52 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 B _pdbx_validate_rmsd_angle.angle_value 128.21 _pdbx_validate_rmsd_angle.angle_target_value 111.70 _pdbx_validate_rmsd_angle.angle_deviation 16.51 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 21 ? ? 50.00 -112.76 2 1 MET A 55 ? ? -158.99 83.05 3 1 LEU A 66 ? ? 82.08 2.43 4 1 THR A 113 ? ? -144.18 -159.42 5 1 GLN A 177 ? ? 78.23 -2.56 6 1 ASP A 183 ? ? -170.11 138.36 7 1 HIS A 297 ? ? 82.72 7.35 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 767 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.60 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 298 ? CG ? A HIS 298 CG 2 1 Y 1 A HIS 298 ? ND1 ? A HIS 298 ND1 3 1 Y 1 A HIS 298 ? CD2 ? A HIS 298 CD2 4 1 Y 1 A HIS 298 ? CE1 ? A HIS 298 CE1 5 1 Y 1 A HIS 298 ? NE2 ? A HIS 298 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ILE 6 ? A ILE 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A GLU 214 ? A GLU 214 12 1 Y 1 A ASN 215 ? A ASN 215 13 1 Y 1 A SER 216 ? A SER 216 14 1 Y 1 A ASP 217 ? A ASP 217 15 1 Y 1 A GLY 218 ? A GLY 218 16 1 Y 1 A HIS 299 ? A HIS 299 17 1 Y 1 A HIS 300 ? A HIS 300 18 1 Y 1 A HIS 301 ? A HIS 301 19 1 Y 1 A HIS 302 ? A HIS 302 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China' China 31170686 1 'National Natural Science Foundation of China' China 31400055 2 'National Natural Science Foundation of China' China 31100028 3 'the Natural Science Foundation of Jiangsu Province' China BK20140690 4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 3 'MAGNESIUM ION' MG 4 GLYCEROL GOL 5 water HOH #