data_5HRJ # _entry.id 5HRJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5HRJ pdb_00005hrj 10.2210/pdb5hrj/pdb WWPDB D_1000217608 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-19 2 'Structure model' 1 1 2017-10-04 3 'Structure model' 1 2 2023-11-08 4 'Structure model' 1 3 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_detector 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_detector.detector' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HRJ _pdbx_database_status.recvd_initial_deposition_date 2016-01-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ma, H.' 1 'Jiang, L.' 2 'Qiao, S.' 3 'Zhang, G.' 4 'Li, R.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the scavenger receptor cysteine-rich domain 5 (SRCR5) from porcine CD163' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, H.' 1 ? primary 'Jiang, L.' 2 ? primary 'Qiao, S.' 3 ? primary 'Zhang, G.' 4 ? primary 'Li, R.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Scavenger receptor cysteine-rich type 1 protein M130' 11636.828 1 ? ? 'scavenger receptor cysteine-rich domain 5 (SRCR5), UNP residues 477-577' ? 2 water nat water 18.015 72 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PRLVGGDIPCSGRVEVQHGDTWGTVCDSDFSLEAASVLCRELQCGTVVSLLGGAHFGEGSGQIWAEEFQCEGHESHLSLC PVAPRPDGTCSHSRDVGVVCSVDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;PRLVGGDIPCSGRVEVQHGDTWGTVCDSDFSLEAASVLCRELQCGTVVSLLGGAHFGEGSGQIWAEEFQCEGHESHLSLC PVAPRPDGTCSHSRDVGVVCSVDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ARG n 1 3 LEU n 1 4 VAL n 1 5 GLY n 1 6 GLY n 1 7 ASP n 1 8 ILE n 1 9 PRO n 1 10 CYS n 1 11 SER n 1 12 GLY n 1 13 ARG n 1 14 VAL n 1 15 GLU n 1 16 VAL n 1 17 GLN n 1 18 HIS n 1 19 GLY n 1 20 ASP n 1 21 THR n 1 22 TRP n 1 23 GLY n 1 24 THR n 1 25 VAL n 1 26 CYS n 1 27 ASP n 1 28 SER n 1 29 ASP n 1 30 PHE n 1 31 SER n 1 32 LEU n 1 33 GLU n 1 34 ALA n 1 35 ALA n 1 36 SER n 1 37 VAL n 1 38 LEU n 1 39 CYS n 1 40 ARG n 1 41 GLU n 1 42 LEU n 1 43 GLN n 1 44 CYS n 1 45 GLY n 1 46 THR n 1 47 VAL n 1 48 VAL n 1 49 SER n 1 50 LEU n 1 51 LEU n 1 52 GLY n 1 53 GLY n 1 54 ALA n 1 55 HIS n 1 56 PHE n 1 57 GLY n 1 58 GLU n 1 59 GLY n 1 60 SER n 1 61 GLY n 1 62 GLN n 1 63 ILE n 1 64 TRP n 1 65 ALA n 1 66 GLU n 1 67 GLU n 1 68 PHE n 1 69 GLN n 1 70 CYS n 1 71 GLU n 1 72 GLY n 1 73 HIS n 1 74 GLU n 1 75 SER n 1 76 HIS n 1 77 LEU n 1 78 SER n 1 79 LEU n 1 80 CYS n 1 81 PRO n 1 82 VAL n 1 83 ALA n 1 84 PRO n 1 85 ARG n 1 86 PRO n 1 87 ASP n 1 88 GLY n 1 89 THR n 1 90 CYS n 1 91 SER n 1 92 HIS n 1 93 SER n 1 94 ARG n 1 95 ASP n 1 96 VAL n 1 97 GLY n 1 98 VAL n 1 99 VAL n 1 100 CYS n 1 101 SER n 1 102 VAL n 1 103 ASP n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name Pig _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CD163, M130' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain X-33 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPICZ-alpha-A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 477 477 PRO PRO A . n A 1 2 ARG 2 478 478 ARG ARG A . n A 1 3 LEU 3 479 479 LEU LEU A . n A 1 4 VAL 4 480 480 VAL VAL A . n A 1 5 GLY 5 481 481 GLY GLY A . n A 1 6 GLY 6 482 482 GLY GLY A . n A 1 7 ASP 7 483 483 ASP ASP A . n A 1 8 ILE 8 484 484 ILE ILE A . n A 1 9 PRO 9 485 485 PRO PRO A . n A 1 10 CYS 10 486 486 CYS CYS A . n A 1 11 SER 11 487 487 SER SER A . n A 1 12 GLY 12 488 488 GLY GLY A . n A 1 13 ARG 13 489 489 ARG ARG A . n A 1 14 VAL 14 490 490 VAL VAL A . n A 1 15 GLU 15 491 491 GLU GLU A . n A 1 16 VAL 16 492 492 VAL VAL A . n A 1 17 GLN 17 493 493 GLN GLN A . n A 1 18 HIS 18 494 494 HIS HIS A . n A 1 19 GLY 19 495 495 GLY GLY A . n A 1 20 ASP 20 496 496 ASP ASP A . n A 1 21 THR 21 497 497 THR THR A . n A 1 22 TRP 22 498 498 TRP TRP A . n A 1 23 GLY 23 499 499 GLY GLY A . n A 1 24 THR 24 500 500 THR THR A . n A 1 25 VAL 25 501 501 VAL VAL A . n A 1 26 CYS 26 502 502 CYS CYS A . n A 1 27 ASP 27 503 503 ASP ASP A . n A 1 28 SER 28 504 504 SER SER A . n A 1 29 ASP 29 505 505 ASP ASP A . n A 1 30 PHE 30 506 506 PHE PHE A . n A 1 31 SER 31 507 507 SER SER A . n A 1 32 LEU 32 508 508 LEU LEU A . n A 1 33 GLU 33 509 509 GLU GLU A . n A 1 34 ALA 34 510 510 ALA ALA A . n A 1 35 ALA 35 511 511 ALA ALA A . n A 1 36 SER 36 512 512 SER SER A . n A 1 37 VAL 37 513 513 VAL VAL A . n A 1 38 LEU 38 514 514 LEU LEU A . n A 1 39 CYS 39 515 515 CYS CYS A . n A 1 40 ARG 40 516 516 ARG ARG A . n A 1 41 GLU 41 517 517 GLU GLU A . n A 1 42 LEU 42 518 518 LEU LEU A . n A 1 43 GLN 43 519 519 GLN GLN A . n A 1 44 CYS 44 520 520 CYS CYS A . n A 1 45 GLY 45 521 521 GLY GLY A . n A 1 46 THR 46 522 522 THR THR A . n A 1 47 VAL 47 523 523 VAL VAL A . n A 1 48 VAL 48 524 524 VAL VAL A . n A 1 49 SER 49 525 525 SER SER A . n A 1 50 LEU 50 526 526 LEU LEU A . n A 1 51 LEU 51 527 527 LEU LEU A . n A 1 52 GLY 52 528 528 GLY GLY A . n A 1 53 GLY 53 529 529 GLY GLY A . n A 1 54 ALA 54 530 530 ALA ALA A . n A 1 55 HIS 55 531 531 HIS HIS A . n A 1 56 PHE 56 532 532 PHE PHE A . n A 1 57 GLY 57 533 533 GLY GLY A . n A 1 58 GLU 58 534 534 GLU GLU A . n A 1 59 GLY 59 535 535 GLY GLY A . n A 1 60 SER 60 536 536 SER SER A . n A 1 61 GLY 61 537 537 GLY GLY A . n A 1 62 GLN 62 538 538 GLN GLN A . n A 1 63 ILE 63 539 539 ILE ILE A . n A 1 64 TRP 64 540 540 TRP TRP A . n A 1 65 ALA 65 541 541 ALA ALA A . n A 1 66 GLU 66 542 542 GLU GLU A . n A 1 67 GLU 67 543 543 GLU GLU A . n A 1 68 PHE 68 544 544 PHE PHE A . n A 1 69 GLN 69 545 545 GLN GLN A . n A 1 70 CYS 70 546 546 CYS CYS A . n A 1 71 GLU 71 547 547 GLU GLU A . n A 1 72 GLY 72 548 548 GLY GLY A . n A 1 73 HIS 73 549 549 HIS HIS A . n A 1 74 GLU 74 550 550 GLU GLU A . n A 1 75 SER 75 551 551 SER SER A . n A 1 76 HIS 76 552 552 HIS HIS A . n A 1 77 LEU 77 553 553 LEU LEU A . n A 1 78 SER 78 554 554 SER SER A . n A 1 79 LEU 79 555 555 LEU LEU A . n A 1 80 CYS 80 556 556 CYS CYS A . n A 1 81 PRO 81 557 557 PRO PRO A . n A 1 82 VAL 82 558 558 VAL VAL A . n A 1 83 ALA 83 559 559 ALA ALA A . n A 1 84 PRO 84 560 560 PRO PRO A . n A 1 85 ARG 85 561 561 ARG ARG A . n A 1 86 PRO 86 562 562 PRO PRO A . n A 1 87 ASP 87 563 563 ASP ASP A . n A 1 88 GLY 88 564 564 GLY GLY A . n A 1 89 THR 89 565 565 THR THR A . n A 1 90 CYS 90 566 566 CYS CYS A . n A 1 91 SER 91 567 567 SER SER A . n A 1 92 HIS 92 568 568 HIS HIS A . n A 1 93 SER 93 569 569 SER SER A . n A 1 94 ARG 94 570 570 ARG ARG A . n A 1 95 ASP 95 571 571 ASP ASP A . n A 1 96 VAL 96 572 572 VAL VAL A . n A 1 97 GLY 97 573 573 GLY GLY A . n A 1 98 VAL 98 574 574 VAL VAL A . n A 1 99 VAL 99 575 575 VAL VAL A . n A 1 100 CYS 100 576 576 CYS CYS A . n A 1 101 SER 101 577 577 SER SER A . n A 1 102 VAL 102 578 ? ? ? A . n A 1 103 ASP 103 579 ? ? ? A . n A 1 104 HIS 104 580 ? ? ? A . n A 1 105 HIS 105 581 ? ? ? A . n A 1 106 HIS 106 582 ? ? ? A . n A 1 107 HIS 107 583 ? ? ? A . n A 1 108 HIS 108 584 ? ? ? A . n A 1 109 HIS 109 585 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 601 5 HOH HOH A . B 2 HOH 2 602 25 HOH HOH A . B 2 HOH 3 603 72 HOH HOH A . B 2 HOH 4 604 24 HOH HOH A . B 2 HOH 5 605 3 HOH HOH A . B 2 HOH 6 606 8 HOH HOH A . B 2 HOH 7 607 55 HOH HOH A . B 2 HOH 8 608 28 HOH HOH A . B 2 HOH 9 609 35 HOH HOH A . B 2 HOH 10 610 19 HOH HOH A . B 2 HOH 11 611 20 HOH HOH A . B 2 HOH 12 612 15 HOH HOH A . B 2 HOH 13 613 12 HOH HOH A . B 2 HOH 14 614 9 HOH HOH A . B 2 HOH 15 615 11 HOH HOH A . B 2 HOH 16 616 14 HOH HOH A . B 2 HOH 17 617 27 HOH HOH A . B 2 HOH 18 618 46 HOH HOH A . B 2 HOH 19 619 26 HOH HOH A . B 2 HOH 20 620 44 HOH HOH A . B 2 HOH 21 621 22 HOH HOH A . B 2 HOH 22 622 30 HOH HOH A . B 2 HOH 23 623 21 HOH HOH A . B 2 HOH 24 624 33 HOH HOH A . B 2 HOH 25 625 1 HOH HOH A . B 2 HOH 26 626 4 HOH HOH A . B 2 HOH 27 627 56 HOH HOH A . B 2 HOH 28 628 34 HOH HOH A . B 2 HOH 29 629 54 HOH HOH A . B 2 HOH 30 630 48 HOH HOH A . B 2 HOH 31 631 13 HOH HOH A . B 2 HOH 32 632 2 HOH HOH A . B 2 HOH 33 633 10 HOH HOH A . B 2 HOH 34 634 60 HOH HOH A . B 2 HOH 35 635 17 HOH HOH A . B 2 HOH 36 636 41 HOH HOH A . B 2 HOH 37 637 7 HOH HOH A . B 2 HOH 38 638 62 HOH HOH A . B 2 HOH 39 639 6 HOH HOH A . B 2 HOH 40 640 45 HOH HOH A . B 2 HOH 41 641 23 HOH HOH A . B 2 HOH 42 642 36 HOH HOH A . B 2 HOH 43 643 18 HOH HOH A . B 2 HOH 44 644 47 HOH HOH A . B 2 HOH 45 645 40 HOH HOH A . B 2 HOH 46 646 43 HOH HOH A . B 2 HOH 47 647 57 HOH HOH A . B 2 HOH 48 648 31 HOH HOH A . B 2 HOH 49 649 52 HOH HOH A . B 2 HOH 50 650 29 HOH HOH A . B 2 HOH 51 651 61 HOH HOH A . B 2 HOH 52 652 70 HOH HOH A . B 2 HOH 53 653 63 HOH HOH A . B 2 HOH 54 654 42 HOH HOH A . B 2 HOH 55 655 16 HOH HOH A . B 2 HOH 56 656 64 HOH HOH A . B 2 HOH 57 657 39 HOH HOH A . B 2 HOH 58 658 50 HOH HOH A . B 2 HOH 59 659 65 HOH HOH A . B 2 HOH 60 660 49 HOH HOH A . B 2 HOH 61 661 66 HOH HOH A . B 2 HOH 62 662 58 HOH HOH A . B 2 HOH 63 663 68 HOH HOH A . B 2 HOH 64 664 37 HOH HOH A . B 2 HOH 65 665 67 HOH HOH A . B 2 HOH 66 666 59 HOH HOH A . B 2 HOH 67 667 69 HOH HOH A . B 2 HOH 68 668 38 HOH HOH A . B 2 HOH 69 669 32 HOH HOH A . B 2 HOH 70 670 53 HOH HOH A . B 2 HOH 71 671 51 HOH HOH A . B 2 HOH 72 672 71 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5HRJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 29.720 _cell.length_a_esd ? _cell.length_b 73.010 _cell.length_b_esd ? _cell.length_c 87.400 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HRJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HRJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.96 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% (w/v) PEG 4000, 200mM (NH4)2SO4, 100mM sodium acetate, pH 4.6' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NFPSS BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site NFPSS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HRJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 29.1 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8953 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.57 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.95 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 1.52 _refine.B_iso_max ? _refine.B_iso_mean 16.370 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.917 _refine.correlation_coeff_Fo_to_Fc_free 0.873 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HRJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 29.1 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8487 _refine.ls_number_reflns_R_free 443 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.24 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21495 _refine.ls_R_factor_R_free 0.25341 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21300 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1BY2 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.156 _refine.pdbx_overall_ESU_R_Free 0.145 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.888 _refine.overall_SU_ML 0.093 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 737 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 72 _refine_hist.number_atoms_total 809 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 29.1 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 757 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 669 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.333 1.933 1030 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.925 3.000 1548 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.579 5.000 100 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 26.722 23.939 33 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.782 15.000 109 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.037 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 112 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 880 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 171 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.080 1.494 403 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.075 1.492 402 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.876 2.236 502 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.876 2.238 503 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.105 1.637 354 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.104 1.637 354 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.814 2.415 529 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.114 12.915 864 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.349 12.185 831 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.847 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 34 _refine_ls_shell.number_reflns_R_work 597 _refine_ls_shell.percent_reflns_obs 95.61 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.211 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.194 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5HRJ _struct.title 'Crystal structure of the scavenger receptor cysteine-rich domain 5 (SRCR5) from porcine CD163' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HRJ _struct_keywords.text 'CD163, SRCR, PRRSV, BALBES NMR, ENDOCYTOSIS' _struct_keywords.pdbx_keywords ENDOCYTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C163A_PIG _struct_ref.pdbx_db_accession Q2VL90 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PRLVGGDIPCSGRVEVQHGDTWGTVCDSDFSLEAASVLCRELQCGTVVSLLGGAHFGEGSGQIWAEEFQCEGHESHLSLC PVAPRPDGTCSHSRDVGVVCS ; _struct_ref.pdbx_align_begin 477 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HRJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2VL90 _struct_ref_seq.db_align_beg 477 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 577 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 477 _struct_ref_seq.pdbx_auth_seq_align_end 577 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HRJ VAL A 102 ? UNP Q2VL90 ? ? 'expression tag' 578 1 1 5HRJ ASP A 103 ? UNP Q2VL90 ? ? 'expression tag' 579 2 1 5HRJ HIS A 104 ? UNP Q2VL90 ? ? 'expression tag' 580 3 1 5HRJ HIS A 105 ? UNP Q2VL90 ? ? 'expression tag' 581 4 1 5HRJ HIS A 106 ? UNP Q2VL90 ? ? 'expression tag' 582 5 1 5HRJ HIS A 107 ? UNP Q2VL90 ? ? 'expression tag' 583 6 1 5HRJ HIS A 108 ? UNP Q2VL90 ? ? 'expression tag' 584 7 1 5HRJ HIS A 109 ? UNP Q2VL90 ? ? 'expression tag' 585 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 31 ? LEU A 42 ? SER A 507 LEU A 518 1 ? 12 HELX_P HELX_P2 AA2 HIS A 76 ? CYS A 80 ? HIS A 552 CYS A 556 5 ? 5 HELX_P HELX_P3 AA3 SER A 91 ? ASP A 95 ? SER A 567 ASP A 571 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 486 A CYS 520 1_555 ? ? ? ? ? ? ? 2.085 ? ? disulf2 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 90 SG ? ? A CYS 502 A CYS 566 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf3 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 100 SG ? ? A CYS 515 A CYS 576 1_555 ? ? ? ? ? ? ? 1.976 ? ? disulf4 disulf ? ? A CYS 70 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 546 A CYS 556 1_555 ? ? ? ? ? ? ? 2.126 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 10 ? CYS A 44 ? CYS A 486 ? 1_555 CYS A 520 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 26 ? CYS A 90 ? CYS A 502 ? 1_555 CYS A 566 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 39 ? CYS A 100 ? CYS A 515 ? 1_555 CYS A 576 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 70 ? CYS A 80 ? CYS A 546 ? 1_555 CYS A 556 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 2 ? GLY A 5 ? ARG A 478 GLY A 481 AA1 2 SER A 11 ? HIS A 18 ? SER A 487 HIS A 494 AA1 3 GLY A 97 ? CYS A 100 ? GLY A 573 CYS A 576 AA1 4 VAL A 47 ? LEU A 51 ? VAL A 523 LEU A 527 AA2 1 ARG A 2 ? GLY A 5 ? ARG A 478 GLY A 481 AA2 2 SER A 11 ? HIS A 18 ? SER A 487 HIS A 494 AA2 3 THR A 21 ? THR A 24 ? THR A 497 THR A 500 AA2 4 GLN A 62 ? ILE A 63 ? GLN A 538 ILE A 539 AA3 1 GLU A 66 ? PHE A 68 ? GLU A 542 PHE A 544 AA3 2 VAL A 82 ? PRO A 84 ? VAL A 558 PRO A 560 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 4 ? N VAL A 480 O ARG A 13 ? O ARG A 489 AA1 2 3 N GLY A 12 ? N GLY A 488 O VAL A 98 ? O VAL A 574 AA1 3 4 O GLY A 97 ? O GLY A 573 N LEU A 51 ? N LEU A 527 AA2 1 2 N VAL A 4 ? N VAL A 480 O ARG A 13 ? O ARG A 489 AA2 2 3 N HIS A 18 ? N HIS A 494 O THR A 21 ? O THR A 497 AA2 3 4 N THR A 24 ? N THR A 500 O GLN A 62 ? O GLN A 538 AA3 1 2 N GLU A 67 ? N GLU A 543 O ALA A 83 ? O ALA A 559 # _pdbx_entry_details.entry_id 5HRJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 504 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 570 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.08 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 636 ? B HOH . 2 1 A HOH 663 ? B HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 578 ? A VAL 102 2 1 Y 1 A ASP 579 ? A ASP 103 3 1 Y 1 A HIS 580 ? A HIS 104 4 1 Y 1 A HIS 581 ? A HIS 105 5 1 Y 1 A HIS 582 ? A HIS 106 6 1 Y 1 A HIS 583 ? A HIS 107 7 1 Y 1 A HIS 584 ? A HIS 108 8 1 Y 1 A HIS 585 ? A HIS 109 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 HOH O O N N 141 HOH H1 H N N 142 HOH H2 H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 PHE N N N N 188 PHE CA C N S 189 PHE C C N N 190 PHE O O N N 191 PHE CB C N N 192 PHE CG C Y N 193 PHE CD1 C Y N 194 PHE CD2 C Y N 195 PHE CE1 C Y N 196 PHE CE2 C Y N 197 PHE CZ C Y N 198 PHE OXT O N N 199 PHE H H N N 200 PHE H2 H N N 201 PHE HA H N N 202 PHE HB2 H N N 203 PHE HB3 H N N 204 PHE HD1 H N N 205 PHE HD2 H N N 206 PHE HE1 H N N 207 PHE HE2 H N N 208 PHE HZ H N N 209 PHE HXT H N N 210 PRO N N N N 211 PRO CA C N S 212 PRO C C N N 213 PRO O O N N 214 PRO CB C N N 215 PRO CG C N N 216 PRO CD C N N 217 PRO OXT O N N 218 PRO H H N N 219 PRO HA H N N 220 PRO HB2 H N N 221 PRO HB3 H N N 222 PRO HG2 H N N 223 PRO HG3 H N N 224 PRO HD2 H N N 225 PRO HD3 H N N 226 PRO HXT H N N 227 SER N N N N 228 SER CA C N S 229 SER C C N N 230 SER O O N N 231 SER CB C N N 232 SER OG O N N 233 SER OXT O N N 234 SER H H N N 235 SER H2 H N N 236 SER HA H N N 237 SER HB2 H N N 238 SER HB3 H N N 239 SER HG H N N 240 SER HXT H N N 241 THR N N N N 242 THR CA C N S 243 THR C C N N 244 THR O O N N 245 THR CB C N R 246 THR OG1 O N N 247 THR CG2 C N N 248 THR OXT O N N 249 THR H H N N 250 THR H2 H N N 251 THR HA H N N 252 THR HB H N N 253 THR HG1 H N N 254 THR HG21 H N N 255 THR HG22 H N N 256 THR HG23 H N N 257 THR HXT H N N 258 TRP N N N N 259 TRP CA C N S 260 TRP C C N N 261 TRP O O N N 262 TRP CB C N N 263 TRP CG C Y N 264 TRP CD1 C Y N 265 TRP CD2 C Y N 266 TRP NE1 N Y N 267 TRP CE2 C Y N 268 TRP CE3 C Y N 269 TRP CZ2 C Y N 270 TRP CZ3 C Y N 271 TRP CH2 C Y N 272 TRP OXT O N N 273 TRP H H N N 274 TRP H2 H N N 275 TRP HA H N N 276 TRP HB2 H N N 277 TRP HB3 H N N 278 TRP HD1 H N N 279 TRP HE1 H N N 280 TRP HE3 H N N 281 TRP HZ2 H N N 282 TRP HZ3 H N N 283 TRP HH2 H N N 284 TRP HXT H N N 285 VAL N N N N 286 VAL CA C N S 287 VAL C C N N 288 VAL O O N N 289 VAL CB C N N 290 VAL CG1 C N N 291 VAL CG2 C N N 292 VAL OXT O N N 293 VAL H H N N 294 VAL H2 H N N 295 VAL HA H N N 296 VAL HB H N N 297 VAL HG11 H N N 298 VAL HG12 H N N 299 VAL HG13 H N N 300 VAL HG21 H N N 301 VAL HG22 H N N 302 VAL HG23 H N N 303 VAL HXT H N N 304 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 HOH O H1 sing N N 134 HOH O H2 sing N N 135 ILE N CA sing N N 136 ILE N H sing N N 137 ILE N H2 sing N N 138 ILE CA C sing N N 139 ILE CA CB sing N N 140 ILE CA HA sing N N 141 ILE C O doub N N 142 ILE C OXT sing N N 143 ILE CB CG1 sing N N 144 ILE CB CG2 sing N N 145 ILE CB HB sing N N 146 ILE CG1 CD1 sing N N 147 ILE CG1 HG12 sing N N 148 ILE CG1 HG13 sing N N 149 ILE CG2 HG21 sing N N 150 ILE CG2 HG22 sing N N 151 ILE CG2 HG23 sing N N 152 ILE CD1 HD11 sing N N 153 ILE CD1 HD12 sing N N 154 ILE CD1 HD13 sing N N 155 ILE OXT HXT sing N N 156 LEU N CA sing N N 157 LEU N H sing N N 158 LEU N H2 sing N N 159 LEU CA C sing N N 160 LEU CA CB sing N N 161 LEU CA HA sing N N 162 LEU C O doub N N 163 LEU C OXT sing N N 164 LEU CB CG sing N N 165 LEU CB HB2 sing N N 166 LEU CB HB3 sing N N 167 LEU CG CD1 sing N N 168 LEU CG CD2 sing N N 169 LEU CG HG sing N N 170 LEU CD1 HD11 sing N N 171 LEU CD1 HD12 sing N N 172 LEU CD1 HD13 sing N N 173 LEU CD2 HD21 sing N N 174 LEU CD2 HD22 sing N N 175 LEU CD2 HD23 sing N N 176 LEU OXT HXT sing N N 177 PHE N CA sing N N 178 PHE N H sing N N 179 PHE N H2 sing N N 180 PHE CA C sing N N 181 PHE CA CB sing N N 182 PHE CA HA sing N N 183 PHE C O doub N N 184 PHE C OXT sing N N 185 PHE CB CG sing N N 186 PHE CB HB2 sing N N 187 PHE CB HB3 sing N N 188 PHE CG CD1 doub Y N 189 PHE CG CD2 sing Y N 190 PHE CD1 CE1 sing Y N 191 PHE CD1 HD1 sing N N 192 PHE CD2 CE2 doub Y N 193 PHE CD2 HD2 sing N N 194 PHE CE1 CZ doub Y N 195 PHE CE1 HE1 sing N N 196 PHE CE2 CZ sing Y N 197 PHE CE2 HE2 sing N N 198 PHE CZ HZ sing N N 199 PHE OXT HXT sing N N 200 PRO N CA sing N N 201 PRO N CD sing N N 202 PRO N H sing N N 203 PRO CA C sing N N 204 PRO CA CB sing N N 205 PRO CA HA sing N N 206 PRO C O doub N N 207 PRO C OXT sing N N 208 PRO CB CG sing N N 209 PRO CB HB2 sing N N 210 PRO CB HB3 sing N N 211 PRO CG CD sing N N 212 PRO CG HG2 sing N N 213 PRO CG HG3 sing N N 214 PRO CD HD2 sing N N 215 PRO CD HD3 sing N N 216 PRO OXT HXT sing N N 217 SER N CA sing N N 218 SER N H sing N N 219 SER N H2 sing N N 220 SER CA C sing N N 221 SER CA CB sing N N 222 SER CA HA sing N N 223 SER C O doub N N 224 SER C OXT sing N N 225 SER CB OG sing N N 226 SER CB HB2 sing N N 227 SER CB HB3 sing N N 228 SER OG HG sing N N 229 SER OXT HXT sing N N 230 THR N CA sing N N 231 THR N H sing N N 232 THR N H2 sing N N 233 THR CA C sing N N 234 THR CA CB sing N N 235 THR CA HA sing N N 236 THR C O doub N N 237 THR C OXT sing N N 238 THR CB OG1 sing N N 239 THR CB CG2 sing N N 240 THR CB HB sing N N 241 THR OG1 HG1 sing N N 242 THR CG2 HG21 sing N N 243 THR CG2 HG22 sing N N 244 THR CG2 HG23 sing N N 245 THR OXT HXT sing N N 246 TRP N CA sing N N 247 TRP N H sing N N 248 TRP N H2 sing N N 249 TRP CA C sing N N 250 TRP CA CB sing N N 251 TRP CA HA sing N N 252 TRP C O doub N N 253 TRP C OXT sing N N 254 TRP CB CG sing N N 255 TRP CB HB2 sing N N 256 TRP CB HB3 sing N N 257 TRP CG CD1 doub Y N 258 TRP CG CD2 sing Y N 259 TRP CD1 NE1 sing Y N 260 TRP CD1 HD1 sing N N 261 TRP CD2 CE2 doub Y N 262 TRP CD2 CE3 sing Y N 263 TRP NE1 CE2 sing Y N 264 TRP NE1 HE1 sing N N 265 TRP CE2 CZ2 sing Y N 266 TRP CE3 CZ3 doub Y N 267 TRP CE3 HE3 sing N N 268 TRP CZ2 CH2 doub Y N 269 TRP CZ2 HZ2 sing N N 270 TRP CZ3 CH2 sing Y N 271 TRP CZ3 HZ3 sing N N 272 TRP CH2 HH2 sing N N 273 TRP OXT HXT sing N N 274 VAL N CA sing N N 275 VAL N H sing N N 276 VAL N H2 sing N N 277 VAL CA C sing N N 278 VAL CA CB sing N N 279 VAL CA HA sing N N 280 VAL C O doub N N 281 VAL C OXT sing N N 282 VAL CB CG1 sing N N 283 VAL CB CG2 sing N N 284 VAL CB HB sing N N 285 VAL CG1 HG11 sing N N 286 VAL CG1 HG12 sing N N 287 VAL CG1 HG13 sing N N 288 VAL CG2 HG21 sing N N 289 VAL CG2 HG22 sing N N 290 VAL CG2 HG23 sing N N 291 VAL OXT HXT sing N N 292 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1BY2 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5HRJ _atom_sites.fract_transf_matrix[1][1] 0.033647 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013697 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011442 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_