data_5HRZ # _entry.id 5HRZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HRZ WWPDB D_1000217462 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HRZ _pdbx_database_status.recvd_initial_deposition_date 2016-01-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cascio, D.' 1 ? 'McNamara, D.E.' 2 ? 'Fallas, J.A.' 3 ? 'Baker, D.' 4 ? 'Yeates, T.O.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1755-4349 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 353 _citation.page_last 360 _citation.title 'Computational design of self-assembling cyclic protein homo-oligomers.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nchem.2673 _citation.pdbx_database_id_PubMed 28338692 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fallas, J.A.' 1 ? primary 'Ueda, G.' 2 ? primary 'Sheffler, W.' 3 ? primary 'Nguyen, V.' 4 ? primary 'McNamara, D.E.' 5 ? primary 'Sankaran, B.' 6 ? primary 'Pereira, J.H.' 7 ? primary 'Parmeggiani, F.' 8 ? primary 'Brunette, T.J.' 9 ? primary 'Cascio, D.' 10 ? primary 'Yeates, T.R.' 11 ? primary 'Zwart, P.' 12 ? primary 'Baker, D.' 13 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5HRZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.570 _cell.length_a_esd ? _cell.length_b 83.570 _cell.length_b_esd ? _cell.length_c 141.930 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HRZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TPR domain protein 1na0C3_3' 14705.200 1 ? ? ? ? 2 water nat water 18.015 14 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNLAEKMYKAGNAMYRKGQYTIAIIAYTLALLKDPNNAEAWYNLGNAAYKKGEYDEAIEAYQKALELDPNNAEAWYNLGN AYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNLAEKMYKAGNAMYRKGQYTIAIIAYTLALLKDPNNAEAWYNLGNAAYKKGEYDEAIEAYQKALELDPNNAEAWYNLGN AYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LEU n 1 4 ALA n 1 5 GLU n 1 6 LYS n 1 7 MET n 1 8 TYR n 1 9 LYS n 1 10 ALA n 1 11 GLY n 1 12 ASN n 1 13 ALA n 1 14 MET n 1 15 TYR n 1 16 ARG n 1 17 LYS n 1 18 GLY n 1 19 GLN n 1 20 TYR n 1 21 THR n 1 22 ILE n 1 23 ALA n 1 24 ILE n 1 25 ILE n 1 26 ALA n 1 27 TYR n 1 28 THR n 1 29 LEU n 1 30 ALA n 1 31 LEU n 1 32 LEU n 1 33 LYS n 1 34 ASP n 1 35 PRO n 1 36 ASN n 1 37 ASN n 1 38 ALA n 1 39 GLU n 1 40 ALA n 1 41 TRP n 1 42 TYR n 1 43 ASN n 1 44 LEU n 1 45 GLY n 1 46 ASN n 1 47 ALA n 1 48 ALA n 1 49 TYR n 1 50 LYS n 1 51 LYS n 1 52 GLY n 1 53 GLU n 1 54 TYR n 1 55 ASP n 1 56 GLU n 1 57 ALA n 1 58 ILE n 1 59 GLU n 1 60 ALA n 1 61 TYR n 1 62 GLN n 1 63 LYS n 1 64 ALA n 1 65 LEU n 1 66 GLU n 1 67 LEU n 1 68 ASP n 1 69 PRO n 1 70 ASN n 1 71 ASN n 1 72 ALA n 1 73 GLU n 1 74 ALA n 1 75 TRP n 1 76 TYR n 1 77 ASN n 1 78 LEU n 1 79 GLY n 1 80 ASN n 1 81 ALA n 1 82 TYR n 1 83 TYR n 1 84 LYS n 1 85 GLN n 1 86 GLY n 1 87 ASP n 1 88 TYR n 1 89 ASP n 1 90 GLU n 1 91 ALA n 1 92 ILE n 1 93 GLU n 1 94 TYR n 1 95 TYR n 1 96 GLN n 1 97 LYS n 1 98 ALA n 1 99 LEU n 1 100 GLU n 1 101 LEU n 1 102 ASP n 1 103 PRO n 1 104 ASN n 1 105 ASN n 1 106 ALA n 1 107 GLU n 1 108 ALA n 1 109 LYS n 1 110 GLN n 1 111 ASN n 1 112 LEU n 1 113 GLY n 1 114 ASN n 1 115 ALA n 1 116 LYS n 1 117 GLN n 1 118 LYS n 1 119 GLN n 1 120 GLY n 1 121 LEU n 1 122 GLU n 1 123 HIS n 1 124 HIS n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET21 NESG' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5HRZ _struct_ref.pdbx_db_accession 5HRZ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HRZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5HRZ _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 127 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 127 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HRZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M sodium malonate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-08-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 45.920 _reflns.entry_id 5HRZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.150 _reflns.d_resolution_low 64.48 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10656 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.6 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.880 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.150 2.220 ? 3.3 ? ? ? ? ? 97.8 ? ? ? ? 0.675 ? ? ? ? ? ? ? ? 9.2 ? ? ? ? ? ? ? 1 1 ? ? 2.200 2.260 ? 4.710 ? ? ? ? ? 100.000 ? ? ? ? 0.566 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 ? ? 2.260 2.330 ? 5.690 ? ? ? ? ? 99.900 ? ? ? ? 0.447 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 ? ? 2.330 2.400 ? 6.540 ? ? ? ? ? 100.000 ? ? ? ? 0.385 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 ? ? 2.400 2.480 ? 7.780 ? ? ? ? ? 100.000 ? ? ? ? 0.328 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 ? ? 2.480 2.570 ? 10.420 ? ? ? ? ? 100.000 ? ? ? ? 0.219 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 ? ? 2.570 2.660 ? 11.980 ? ? ? ? ? 100.000 ? ? ? ? 0.190 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 ? ? 2.660 2.770 ? 14.730 ? ? ? ? ? 100.000 ? ? ? ? 0.160 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 ? ? 2.770 2.900 ? 19.210 ? ? ? ? ? 100.000 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 ? ? 2.900 3.040 ? 22.510 ? ? ? ? ? 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 ? ? 3.040 3.200 ? 26.610 ? ? ? ? ? 99.800 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 ? ? 3.200 3.400 ? 31.470 ? ? ? ? ? 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 ? ? 3.400 3.630 ? 38.570 ? ? ? ? ? 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 ? ? 3.630 3.920 ? 42.790 ? ? ? ? ? 99.800 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 ? ? 3.920 4.290 ? 45.130 ? ? ? ? ? 99.800 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 ? ? 4.290 4.800 ? 44.430 ? ? ? ? ? 99.500 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 ? ? 4.800 5.540 ? 45.140 ? ? ? ? ? 99.700 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 ? ? 5.540 6.790 ? 45.200 ? ? ? ? ? 100.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 ? ? 6.790 9.600 ? 47.210 ? ? ? ? ? 100.000 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 ? ? # _refine.aniso_B[1][1] 3.1850 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 3.1850 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -6.3699 _refine.B_iso_max 115.810 _refine.B_iso_mean 48.2800 _refine.B_iso_min 30.390 _refine.correlation_coeff_Fo_to_Fc 0.9562 _refine.correlation_coeff_Fo_to_Fc_free 0.9510 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HRZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 64.4800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10640 _refine.ls_number_reflns_R_free 946 _refine.ls_number_reflns_R_work 9694 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9200 _refine.ls_percent_reflns_R_free 8.8900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1821 _refine.ls_R_factor_R_free 0.2060 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1800 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Computational model based on 1NA0' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1350 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1320 _refine.pdbx_overall_SU_R_Blow_DPI 0.1460 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1480 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5HRZ _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.256 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 64.4800 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 985 _refine_hist.pdbx_number_residues_total 122 _refine_hist.pdbx_B_iso_mean_solvent 55.85 _refine_hist.pdbx_number_atoms_protein 971 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 347 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 39 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 138 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 991 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 121 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1100 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 991 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 0.940 ? 1342 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.580 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.270 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1500 _refine_ls_shell.d_res_low 2.4000 _refine_ls_shell.number_reflns_all 2975 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 279 _refine_ls_shell.number_reflns_R_work 2696 _refine_ls_shell.percent_reflns_obs 99.9200 _refine_ls_shell.percent_reflns_R_free 9.3800 _refine_ls_shell.R_factor_all 0.1963 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2048 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1954 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5HRZ _struct.title 'Computationally Designed Trimer 1na0C3_3' _struct.pdbx_descriptor 'TPR domain protein 1na0C3_3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HRZ _struct_keywords.text 'Protein Design, Designed Oligomeric Interface, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'Trimer based on SEC-MALS and SAXS' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? LYS A 17 ? ASN A 1 LYS A 16 1 ? 16 HELX_P HELX_P2 AA2 GLN A 19 ? ASP A 34 ? GLN A 18 ASP A 33 1 ? 16 HELX_P HELX_P3 AA3 ASN A 37 ? LYS A 51 ? ASN A 36 LYS A 50 1 ? 15 HELX_P HELX_P4 AA4 GLU A 53 ? ASP A 68 ? GLU A 52 ASP A 67 1 ? 16 HELX_P HELX_P5 AA5 ASN A 71 ? GLN A 85 ? ASN A 70 GLN A 84 1 ? 15 HELX_P HELX_P6 AA6 ASP A 87 ? ASP A 102 ? ASP A 86 ASP A 101 1 ? 16 HELX_P HELX_P7 AA7 ASN A 105 ? GLN A 119 ? ASN A 104 GLN A 118 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5HRZ _atom_sites.fract_transf_matrix[1][1] 0.011966 _atom_sites.fract_transf_matrix[1][2] 0.006909 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013817 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007046 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 ASN 2 1 1 ASN ASN A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 ALA 4 3 3 ALA ALA A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 MET 7 6 6 MET MET A . n A 1 8 TYR 8 7 7 TYR TYR A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 ASN 12 11 11 ASN ASN A . n A 1 13 ALA 13 12 12 ALA ALA A . n A 1 14 MET 14 13 13 MET MET A . n A 1 15 TYR 15 14 14 TYR TYR A . n A 1 16 ARG 16 15 15 ARG ARG A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 GLY 18 17 17 GLY GLY A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 TYR 20 19 19 TYR TYR A . n A 1 21 THR 21 20 20 THR THR A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 ALA 26 25 25 ALA ALA A . n A 1 27 TYR 27 26 26 TYR TYR A . n A 1 28 THR 28 27 27 THR THR A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 ALA 30 29 29 ALA ALA A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 PRO 35 34 34 PRO PRO A . n A 1 36 ASN 36 35 35 ASN ASN A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 ALA 40 39 39 ALA ALA A . n A 1 41 TRP 41 40 40 TRP TRP A . n A 1 42 TYR 42 41 41 TYR TYR A . n A 1 43 ASN 43 42 42 ASN ASN A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 GLY 45 44 44 GLY GLY A . n A 1 46 ASN 46 45 45 ASN ASN A . n A 1 47 ALA 47 46 46 ALA ALA A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 TYR 49 48 48 TYR TYR A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 TYR 54 53 53 TYR TYR A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 ILE 58 57 57 ILE ILE A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 TYR 61 60 60 TYR TYR A . n A 1 62 GLN 62 61 61 GLN GLN A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 ALA 64 63 63 ALA ALA A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 LEU 67 66 66 LEU LEU A . n A 1 68 ASP 68 67 67 ASP ASP A . n A 1 69 PRO 69 68 68 PRO PRO A . n A 1 70 ASN 70 69 69 ASN ASN A . n A 1 71 ASN 71 70 70 ASN ASN A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 ALA 74 73 73 ALA ALA A . n A 1 75 TRP 75 74 74 TRP TRP A . n A 1 76 TYR 76 75 75 TYR TYR A . n A 1 77 ASN 77 76 76 ASN ASN A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 ASN 80 79 79 ASN ASN A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 TYR 82 81 81 TYR TYR A . n A 1 83 TYR 83 82 82 TYR TYR A . n A 1 84 LYS 84 83 83 LYS LYS A . n A 1 85 GLN 85 84 84 GLN GLN A . n A 1 86 GLY 86 85 85 GLY GLY A . n A 1 87 ASP 87 86 86 ASP ASP A . n A 1 88 TYR 88 87 87 TYR TYR A . n A 1 89 ASP 89 88 88 ASP ASP A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 ILE 92 91 91 ILE ILE A . n A 1 93 GLU 93 92 92 GLU GLU A . n A 1 94 TYR 94 93 93 TYR TYR A . n A 1 95 TYR 95 94 94 TYR TYR A . n A 1 96 GLN 96 95 95 GLN GLN A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 LEU 99 98 98 LEU LEU A . n A 1 100 GLU 100 99 99 GLU GLU A . n A 1 101 LEU 101 100 100 LEU LEU A . n A 1 102 ASP 102 101 101 ASP ASP A . n A 1 103 PRO 103 102 102 PRO PRO A . n A 1 104 ASN 104 103 103 ASN ASN A . n A 1 105 ASN 105 104 104 ASN ASN A . n A 1 106 ALA 106 105 105 ALA ALA A . n A 1 107 GLU 107 106 106 GLU GLU A . n A 1 108 ALA 108 107 107 ALA ALA A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 GLN 110 109 109 GLN GLN A . n A 1 111 ASN 111 110 110 ASN ASN A . n A 1 112 LEU 112 111 111 LEU LEU A . n A 1 113 GLY 113 112 112 GLY GLY A . n A 1 114 ASN 114 113 113 ASN ASN A . n A 1 115 ALA 115 114 114 ALA ALA A . n A 1 116 LYS 116 115 115 LYS LYS A . n A 1 117 GLN 117 116 116 GLN GLN A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 GLN 119 118 118 GLN GLN A . n A 1 120 GLY 120 119 119 GLY GLY A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 HIS 123 122 122 HIS HIS A . n A 1 124 HIS 124 123 ? ? ? A . n A 1 125 HIS 125 124 ? ? ? A . n A 1 126 HIS 126 125 ? ? ? A . n A 1 127 HIS 127 126 ? ? ? A . n A 1 128 HIS 128 127 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 8 HOH HOH A . B 2 HOH 2 202 3 HOH HOH A . B 2 HOH 3 203 13 HOH HOH A . B 2 HOH 4 204 17 HOH HOH A . B 2 HOH 5 205 18 HOH HOH A . B 2 HOH 6 206 16 HOH HOH A . B 2 HOH 7 207 9 HOH HOH A . B 2 HOH 8 208 6 HOH HOH A . B 2 HOH 9 209 15 HOH HOH A . B 2 HOH 10 210 2 HOH HOH A . B 2 HOH 11 211 1 HOH HOH A . B 2 HOH 12 212 14 HOH HOH A . B 2 HOH 13 213 11 HOH HOH A . B 2 HOH 14 214 12 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3030 ? 1 MORE -30 ? 1 'SSA (A^2)' 17830 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 41.7850000000 0.8660254038 -0.5000000000 0.0000000000 72.3737429943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -41.7850000000 -0.8660254038 -0.5000000000 0.0000000000 72.3737429943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-12 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2019-11-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_struct_assembly_auth_evidence 3 4 'Structure model' pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -3.4942 _pdbx_refine_tls.origin_y 26.6282 _pdbx_refine_tls.origin_z -11.8166 _pdbx_refine_tls.T[1][1] -0.0256 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0210 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0217 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.0960 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0263 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0561 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.6016 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.3660 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.0488 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 4.9959 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.5258 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.3914 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0082 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0351 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0088 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.2147 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0137 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0930 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.1884 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0794 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0220 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 122 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 32 ? CG ? A LYS 33 CG 2 1 Y 1 A LYS 32 ? CD ? A LYS 33 CD 3 1 Y 1 A LYS 32 ? CE ? A LYS 33 CE 4 1 Y 1 A LYS 32 ? NZ ? A LYS 33 NZ 5 1 Y 1 A HIS 122 ? CG ? A HIS 123 CG 6 1 Y 1 A HIS 122 ? ND1 ? A HIS 123 ND1 7 1 Y 1 A HIS 122 ? CD2 ? A HIS 123 CD2 8 1 Y 1 A HIS 122 ? CE1 ? A HIS 123 CE1 9 1 Y 1 A HIS 122 ? NE2 ? A HIS 123 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A HIS 123 ? A HIS 124 3 1 Y 1 A HIS 124 ? A HIS 125 4 1 Y 1 A HIS 125 ? A HIS 126 5 1 Y 1 A HIS 126 ? A HIS 127 6 1 Y 1 A HIS 127 ? A HIS 128 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1332907 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'gel filtration' ? 2 1 'light scattering' ? 3 1 SAXS ? #