data_5HSB # _entry.id 5HSB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HSB WWPDB D_1000217645 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2020-01-15 _pdbx_database_PDB_obs_spr.pdb_id 6Q99 _pdbx_database_PDB_obs_spr.replace_pdb_id 5HSB _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HSB _pdbx_database_status.recvd_initial_deposition_date 2016-01-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fernandez-Garcia, Y.' 1 'Reguera, J.' 2 'Witte, G.' 3 'Cusack, S.' 4 'Guenther, S.' 5 'Reindl, S.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first e1005635 _citation.page_last e1005635 _citation.title 'Atomic Structure and Biochemical Characterization of an RNA Endonuclease in the N Terminus of Andes Virus L Protein.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1005635 _citation.pdbx_database_id_PubMed 27300328 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fernandez-Garcia, Y.' 1 ? primary 'Reguera, J.' 2 ? primary 'Busch, C.' 3 ? primary 'Witte, G.' 4 ? primary 'Sanchez-Ramos, O.' 5 ? primary 'Betzel, C.' 6 ? primary 'Cusack, S.' 7 ? primary 'Gunther, S.' 8 ? primary 'Reindl, S.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5HSB _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.890 _cell.length_a_esd ? _cell.length_b 82.890 _cell.length_b_esd ? _cell.length_c 79.310 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HSB _symmetry.cell_setting ? _symmetry.Int_Tables_number 90 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 4 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RNA polymerase' 23168.602 1 ? K127A ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AGPMEKYREIHQRVRDLAPGTVSALECIDLLDRLYAVRHDLVDQMIKHDWSDNKDVERPIGQVLLMAGIPNDIIQGMEKK IIPNSPSGQVLKSFFRMTPDNYKITGNLIEFIEVTVTADVSRGIREKKIAYEGGLQFVEHLLETESRKGNIPQPYKITFS VVAVKTDGSNISTQWPSRRNDGVIQHMRLVQADINYVREHLIK ; _entity_poly.pdbx_seq_one_letter_code_can ;AGPMEKYREIHQRVRDLAPGTVSALECIDLLDRLYAVRHDLVDQMIKHDWSDNKDVERPIGQVLLMAGIPNDIIQGMEKK IIPNSPSGQVLKSFFRMTPDNYKITGNLIEFIEVTVTADVSRGIREKKIAYEGGLQFVEHLLETESRKGNIPQPYKITFS VVAVKTDGSNISTQWPSRRNDGVIQHMRLVQADINYVREHLIK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLY n 1 3 PRO n 1 4 MET n 1 5 GLU n 1 6 LYS n 1 7 TYR n 1 8 ARG n 1 9 GLU n 1 10 ILE n 1 11 HIS n 1 12 GLN n 1 13 ARG n 1 14 VAL n 1 15 ARG n 1 16 ASP n 1 17 LEU n 1 18 ALA n 1 19 PRO n 1 20 GLY n 1 21 THR n 1 22 VAL n 1 23 SER n 1 24 ALA n 1 25 LEU n 1 26 GLU n 1 27 CYS n 1 28 ILE n 1 29 ASP n 1 30 LEU n 1 31 LEU n 1 32 ASP n 1 33 ARG n 1 34 LEU n 1 35 TYR n 1 36 ALA n 1 37 VAL n 1 38 ARG n 1 39 HIS n 1 40 ASP n 1 41 LEU n 1 42 VAL n 1 43 ASP n 1 44 GLN n 1 45 MET n 1 46 ILE n 1 47 LYS n 1 48 HIS n 1 49 ASP n 1 50 TRP n 1 51 SER n 1 52 ASP n 1 53 ASN n 1 54 LYS n 1 55 ASP n 1 56 VAL n 1 57 GLU n 1 58 ARG n 1 59 PRO n 1 60 ILE n 1 61 GLY n 1 62 GLN n 1 63 VAL n 1 64 LEU n 1 65 LEU n 1 66 MET n 1 67 ALA n 1 68 GLY n 1 69 ILE n 1 70 PRO n 1 71 ASN n 1 72 ASP n 1 73 ILE n 1 74 ILE n 1 75 GLN n 1 76 GLY n 1 77 MET n 1 78 GLU n 1 79 LYS n 1 80 LYS n 1 81 ILE n 1 82 ILE n 1 83 PRO n 1 84 ASN n 1 85 SER n 1 86 PRO n 1 87 SER n 1 88 GLY n 1 89 GLN n 1 90 VAL n 1 91 LEU n 1 92 LYS n 1 93 SER n 1 94 PHE n 1 95 PHE n 1 96 ARG n 1 97 MET n 1 98 THR n 1 99 PRO n 1 100 ASP n 1 101 ASN n 1 102 TYR n 1 103 LYS n 1 104 ILE n 1 105 THR n 1 106 GLY n 1 107 ASN n 1 108 LEU n 1 109 ILE n 1 110 GLU n 1 111 PHE n 1 112 ILE n 1 113 GLU n 1 114 VAL n 1 115 THR n 1 116 VAL n 1 117 THR n 1 118 ALA n 1 119 ASP n 1 120 VAL n 1 121 SER n 1 122 ARG n 1 123 GLY n 1 124 ILE n 1 125 ARG n 1 126 GLU n 1 127 LYS n 1 128 LYS n 1 129 ILE n 1 130 ALA n 1 131 TYR n 1 132 GLU n 1 133 GLY n 1 134 GLY n 1 135 LEU n 1 136 GLN n 1 137 PHE n 1 138 VAL n 1 139 GLU n 1 140 HIS n 1 141 LEU n 1 142 LEU n 1 143 GLU n 1 144 THR n 1 145 GLU n 1 146 SER n 1 147 ARG n 1 148 LYS n 1 149 GLY n 1 150 ASN n 1 151 ILE n 1 152 PRO n 1 153 GLN n 1 154 PRO n 1 155 TYR n 1 156 LYS n 1 157 ILE n 1 158 THR n 1 159 PHE n 1 160 SER n 1 161 VAL n 1 162 VAL n 1 163 ALA n 1 164 VAL n 1 165 LYS n 1 166 THR n 1 167 ASP n 1 168 GLY n 1 169 SER n 1 170 ASN n 1 171 ILE n 1 172 SER n 1 173 THR n 1 174 GLN n 1 175 TRP n 1 176 PRO n 1 177 SER n 1 178 ARG n 1 179 ARG n 1 180 ASN n 1 181 ASP n 1 182 GLY n 1 183 VAL n 1 184 ILE n 1 185 GLN n 1 186 HIS n 1 187 MET n 1 188 ARG n 1 189 LEU n 1 190 VAL n 1 191 GLN n 1 192 ALA n 1 193 ASP n 1 194 ILE n 1 195 ASN n 1 196 TYR n 1 197 VAL n 1 198 ARG n 1 199 GLU n 1 200 HIS n 1 201 LEU n 1 202 ILE n 1 203 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 203 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Andes virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 46607 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9E005_9VIRU _struct_ref.pdbx_db_accession Q9E005 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEKYREIHQRVRDLAPGTVSALECIDLLDRLYAVRHDLVDQMIKHDWSDNKDVERPIGQVLLMAGIPNDIIQGMEKKIIP NSPSGQVLKSFFRMTPDNYKITGNLIEFIEVTVTADVSRGIREKKIKYEGGLQFVEHLLETESRKGNIPQPYKITFSVVA VKTDGSNISTQWPSRRNDGVVQHMRLVQADINYVREHLIK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HSB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9E005 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HSB ALA A 1 ? UNP Q9E005 ? ? 'expression tag' -2 1 1 5HSB GLY A 2 ? UNP Q9E005 ? ? 'expression tag' -1 2 1 5HSB PRO A 3 ? UNP Q9E005 ? ? 'expression tag' 0 3 1 5HSB ALA A 130 ? UNP Q9E005 LYS 127 'engineered mutation' 127 4 1 5HSB ILE A 184 ? UNP Q9E005 VAL 181 conflict 181 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HSB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2 mM MnCl2, 100 mM Na acetate pH 5.0, 27.5% PEG 3350, 500 mM (NH4)2SO4, Butanediol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Single Crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HSB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 79.31 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 12065 _reflns.number_obs ? _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.35 _reflns_shell.d_res_low 2.43 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 1151 _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.379 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HSB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.400 _refine.ls_d_res_low 79.310 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11227 _refine.ls_number_reflns_R_free 535 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.22 _refine.ls_percent_reflns_R_free 4.77 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2108 _refine.ls_R_factor_R_free 0.2616 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2083 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.78 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.40 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1617 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1672 _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 79.310 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1656 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.370 ? 2238 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.808 ? 636 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 250 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 290 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4002 2.6417 . . 117 2610 99.00 . . . 0.4013 . 0.3167 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6417 3.0240 . . 166 2588 99.00 . . . 0.3636 . 0.2860 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0240 3.8099 . . 120 2686 99.00 . . . 0.2764 . 0.2157 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8099 79.3533 . . 132 2808 99.00 . . . 0.2015 . 0.1695 . . . . . . . . . . # _struct.entry_id 5HSB _struct.title 'Andes Virus endonuclease' _struct.pdbx_descriptor 'RNA polymerase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HSB _struct_keywords.text 'endonuclease, viral transcription, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 1 ? ASP A 16 ? ALA A -2 ASP A 13 1 ? 16 HELX_P HELX_P2 AA2 GLU A 26 ? TRP A 50 ? GLU A 23 TRP A 47 1 ? 25 HELX_P HELX_P3 AA3 PRO A 59 ? GLY A 68 ? PRO A 56 GLY A 65 1 ? 10 HELX_P HELX_P4 AA4 PRO A 70 ? GLU A 78 ? PRO A 67 GLU A 75 1 ? 9 HELX_P HELX_P5 AA5 VAL A 90 ? PHE A 95 ? VAL A 87 PHE A 92 1 ? 6 HELX_P HELX_P6 AA6 ASP A 119 ? LYS A 148 ? ASP A 116 LYS A 145 1 ? 30 HELX_P HELX_P7 AA7 ASN A 170 ? TRP A 175 ? ASN A 167 TRP A 172 1 ? 6 HELX_P HELX_P8 AA8 ARG A 179 ? HIS A 200 ? ARG A 176 HIS A 197 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 36 A MN 301 1_555 ? ? ? ? ? ? ? 2.210 ? metalc2 metalc ? ? A ASP 100 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 97 A MN 301 1_555 ? ? ? ? ? ? ? 2.431 ? metalc3 metalc ? ? A VAL 114 O ? ? ? 1_555 B MN . MN ? ? A VAL 111 A MN 301 1_555 ? ? ? ? ? ? ? 1.911 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 23 A . ? SER 20 A ALA 24 A ? ALA 21 A 1 -19.89 2 LYS 54 A . ? LYS 51 A ASP 55 A ? ASP 52 A 1 3.62 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 101 ? THR A 105 ? ASN A 98 THR A 102 AA1 2 LEU A 108 ? THR A 117 ? LEU A 105 THR A 114 AA1 3 LYS A 156 ? LYS A 165 ? LYS A 153 LYS A 162 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 105 ? N THR A 102 O LEU A 108 ? O LEU A 105 AA1 2 3 N ILE A 109 ? N ILE A 106 O LYS A 156 ? O LYS A 153 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 4 'binding site for residue MN A 301' AC2 Software A GOL 302 ? 8 'binding site for residue GOL A 302' AC3 Software A SO4 303 ? 4 'binding site for residue SO4 A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 39 ? HIS A 36 . ? 1_555 ? 2 AC1 4 ASP A 100 ? ASP A 97 . ? 1_555 ? 3 AC1 4 GLU A 113 ? GLU A 110 . ? 1_555 ? 4 AC1 4 VAL A 114 ? VAL A 111 . ? 1_555 ? 5 AC2 8 TYR A 35 ? TYR A 32 . ? 1_555 ? 6 AC2 8 ARG A 38 ? ARG A 35 . ? 1_555 ? 7 AC2 8 ALA A 118 ? ALA A 115 . ? 1_555 ? 8 AC2 8 THR A 166 ? THR A 163 . ? 1_555 ? 9 AC2 8 GLN A 191 ? GLN A 188 . ? 1_555 ? 10 AC2 8 ILE A 194 ? ILE A 191 . ? 1_555 ? 11 AC2 8 ARG A 198 ? ARG A 195 . ? 1_555 ? 12 AC2 8 HOH E . ? HOH A 401 . ? 1_555 ? 13 AC3 4 HIS A 39 ? HIS A 36 . ? 1_555 ? 14 AC3 4 THR A 115 ? THR A 112 . ? 1_555 ? 15 AC3 4 VAL A 116 ? VAL A 113 . ? 1_555 ? 16 AC3 4 HOH E . ? HOH A 416 . ? 1_555 ? # _atom_sites.entry_id 5HSB _atom_sites.fract_transf_matrix[1][1] 0.012064 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012064 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012609 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -2 -2 ALA ALA A . n A 1 2 GLY 2 -1 -1 GLY GLY A . n A 1 3 PRO 3 0 0 PRO PRO A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 GLU 5 2 2 GLU GLU A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 TYR 7 4 4 TYR TYR A . n A 1 8 ARG 8 5 5 ARG ARG A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 ILE 10 7 7 ILE ILE A . n A 1 11 HIS 11 8 8 HIS HIS A . n A 1 12 GLN 12 9 9 GLN GLN A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 VAL 14 11 11 VAL VAL A . n A 1 15 ARG 15 12 12 ARG ARG A . n A 1 16 ASP 16 13 13 ASP ASP A . n A 1 17 LEU 17 14 14 LEU LEU A . n A 1 18 ALA 18 15 15 ALA ALA A . n A 1 19 PRO 19 16 16 PRO PRO A . n A 1 20 GLY 20 17 17 GLY GLY A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 VAL 22 19 19 VAL VAL A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 LEU 25 22 22 LEU LEU A . n A 1 26 GLU 26 23 23 GLU GLU A . n A 1 27 CYS 27 24 24 CYS CYS A . n A 1 28 ILE 28 25 25 ILE ILE A . n A 1 29 ASP 29 26 26 ASP ASP A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 LEU 31 28 28 LEU LEU A . n A 1 32 ASP 32 29 29 ASP ASP A . n A 1 33 ARG 33 30 30 ARG ARG A . n A 1 34 LEU 34 31 31 LEU LEU A . n A 1 35 TYR 35 32 32 TYR TYR A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 ARG 38 35 35 ARG ARG A . n A 1 39 HIS 39 36 36 HIS HIS A . n A 1 40 ASP 40 37 37 ASP ASP A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 VAL 42 39 39 VAL VAL A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 MET 45 42 42 MET MET A . n A 1 46 ILE 46 43 43 ILE ILE A . n A 1 47 LYS 47 44 44 LYS LYS A . n A 1 48 HIS 48 45 45 HIS HIS A . n A 1 49 ASP 49 46 46 ASP ASP A . n A 1 50 TRP 50 47 47 TRP TRP A . n A 1 51 SER 51 48 48 SER SER A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 ASN 53 50 50 ASN ASN A . n A 1 54 LYS 54 51 51 LYS LYS A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 VAL 56 53 53 VAL VAL A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 ARG 58 55 55 ARG ARG A . n A 1 59 PRO 59 56 56 PRO PRO A . n A 1 60 ILE 60 57 57 ILE ILE A . n A 1 61 GLY 61 58 58 GLY GLY A . n A 1 62 GLN 62 59 59 GLN GLN A . n A 1 63 VAL 63 60 60 VAL VAL A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 MET 66 63 63 MET MET A . n A 1 67 ALA 67 64 64 ALA ALA A . n A 1 68 GLY 68 65 65 GLY GLY A . n A 1 69 ILE 69 66 66 ILE ILE A . n A 1 70 PRO 70 67 67 PRO PRO A . n A 1 71 ASN 71 68 68 ASN ASN A . n A 1 72 ASP 72 69 69 ASP ASP A . n A 1 73 ILE 73 70 70 ILE ILE A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 GLN 75 72 72 GLN GLN A . n A 1 76 GLY 76 73 73 GLY GLY A . n A 1 77 MET 77 74 74 MET MET A . n A 1 78 GLU 78 75 75 GLU GLU A . n A 1 79 LYS 79 76 76 LYS LYS A . n A 1 80 LYS 80 77 77 LYS LYS A . n A 1 81 ILE 81 78 78 ILE ILE A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 PRO 83 80 80 PRO PRO A . n A 1 84 ASN 84 81 81 ASN ASN A . n A 1 85 SER 85 82 82 SER SER A . n A 1 86 PRO 86 83 83 PRO PRO A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 GLN 89 86 86 GLN GLN A . n A 1 90 VAL 90 87 87 VAL VAL A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 LYS 92 89 89 LYS LYS A . n A 1 93 SER 93 90 90 SER SER A . n A 1 94 PHE 94 91 91 PHE PHE A . n A 1 95 PHE 95 92 92 PHE PHE A . n A 1 96 ARG 96 93 93 ARG ARG A . n A 1 97 MET 97 94 94 MET MET A . n A 1 98 THR 98 95 95 THR THR A . n A 1 99 PRO 99 96 96 PRO PRO A . n A 1 100 ASP 100 97 97 ASP ASP A . n A 1 101 ASN 101 98 98 ASN ASN A . n A 1 102 TYR 102 99 99 TYR TYR A . n A 1 103 LYS 103 100 100 LYS LYS A . n A 1 104 ILE 104 101 101 ILE ILE A . n A 1 105 THR 105 102 102 THR THR A . n A 1 106 GLY 106 103 103 GLY GLY A . n A 1 107 ASN 107 104 104 ASN ASN A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 ILE 109 106 106 ILE ILE A . n A 1 110 GLU 110 107 107 GLU GLU A . n A 1 111 PHE 111 108 108 PHE PHE A . n A 1 112 ILE 112 109 109 ILE ILE A . n A 1 113 GLU 113 110 110 GLU GLU A . n A 1 114 VAL 114 111 111 VAL VAL A . n A 1 115 THR 115 112 112 THR THR A . n A 1 116 VAL 116 113 113 VAL VAL A . n A 1 117 THR 117 114 114 THR THR A . n A 1 118 ALA 118 115 115 ALA ALA A . n A 1 119 ASP 119 116 116 ASP ASP A . n A 1 120 VAL 120 117 117 VAL VAL A . n A 1 121 SER 121 118 118 SER SER A . n A 1 122 ARG 122 119 119 ARG ARG A . n A 1 123 GLY 123 120 120 GLY GLY A . n A 1 124 ILE 124 121 121 ILE ILE A . n A 1 125 ARG 125 122 122 ARG ARG A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 LYS 127 124 124 LYS LYS A . n A 1 128 LYS 128 125 125 LYS LYS A . n A 1 129 ILE 129 126 126 ILE ILE A . n A 1 130 ALA 130 127 127 ALA ALA A . n A 1 131 TYR 131 128 128 TYR TYR A . n A 1 132 GLU 132 129 129 GLU GLU A . n A 1 133 GLY 133 130 130 GLY GLY A . n A 1 134 GLY 134 131 131 GLY GLY A . n A 1 135 LEU 135 132 132 LEU LEU A . n A 1 136 GLN 136 133 133 GLN GLN A . n A 1 137 PHE 137 134 134 PHE PHE A . n A 1 138 VAL 138 135 135 VAL VAL A . n A 1 139 GLU 139 136 136 GLU GLU A . n A 1 140 HIS 140 137 137 HIS HIS A . n A 1 141 LEU 141 138 138 LEU LEU A . n A 1 142 LEU 142 139 139 LEU LEU A . n A 1 143 GLU 143 140 140 GLU GLU A . n A 1 144 THR 144 141 141 THR THR A . n A 1 145 GLU 145 142 142 GLU GLU A . n A 1 146 SER 146 143 143 SER SER A . n A 1 147 ARG 147 144 144 ARG ARG A . n A 1 148 LYS 148 145 145 LYS LYS A . n A 1 149 GLY 149 146 146 GLY GLY A . n A 1 150 ASN 150 147 147 ASN ASN A . n A 1 151 ILE 151 148 148 ILE ILE A . n A 1 152 PRO 152 149 149 PRO PRO A . n A 1 153 GLN 153 150 150 GLN GLN A . n A 1 154 PRO 154 151 151 PRO PRO A . n A 1 155 TYR 155 152 152 TYR TYR A . n A 1 156 LYS 156 153 153 LYS LYS A . n A 1 157 ILE 157 154 154 ILE ILE A . n A 1 158 THR 158 155 155 THR THR A . n A 1 159 PHE 159 156 156 PHE PHE A . n A 1 160 SER 160 157 157 SER SER A . n A 1 161 VAL 161 158 158 VAL VAL A . n A 1 162 VAL 162 159 159 VAL VAL A . n A 1 163 ALA 163 160 160 ALA ALA A . n A 1 164 VAL 164 161 161 VAL VAL A . n A 1 165 LYS 165 162 162 LYS LYS A . n A 1 166 THR 166 163 163 THR THR A . n A 1 167 ASP 167 164 164 ASP ASP A . n A 1 168 GLY 168 165 165 GLY GLY A . n A 1 169 SER 169 166 166 SER SER A . n A 1 170 ASN 170 167 167 ASN ASN A . n A 1 171 ILE 171 168 168 ILE ILE A . n A 1 172 SER 172 169 169 SER SER A . n A 1 173 THR 173 170 170 THR THR A . n A 1 174 GLN 174 171 171 GLN GLN A . n A 1 175 TRP 175 172 172 TRP TRP A . n A 1 176 PRO 176 173 173 PRO PRO A . n A 1 177 SER 177 174 174 SER SER A . n A 1 178 ARG 178 175 175 ARG ARG A . n A 1 179 ARG 179 176 176 ARG ARG A . n A 1 180 ASN 180 177 177 ASN ASN A . n A 1 181 ASP 181 178 178 ASP ASP A . n A 1 182 GLY 182 179 179 GLY GLY A . n A 1 183 VAL 183 180 180 VAL VAL A . n A 1 184 ILE 184 181 181 ILE ILE A . n A 1 185 GLN 185 182 182 GLN GLN A . n A 1 186 HIS 186 183 183 HIS HIS A . n A 1 187 MET 187 184 184 MET MET A . n A 1 188 ARG 188 185 185 ARG ARG A . n A 1 189 LEU 189 186 186 LEU LEU A . n A 1 190 VAL 190 187 187 VAL VAL A . n A 1 191 GLN 191 188 188 GLN GLN A . n A 1 192 ALA 192 189 189 ALA ALA A . n A 1 193 ASP 193 190 190 ASP ASP A . n A 1 194 ILE 194 191 191 ILE ILE A . n A 1 195 ASN 195 192 192 ASN ASN A . n A 1 196 TYR 196 193 193 TYR TYR A . n A 1 197 VAL 197 194 194 VAL VAL A . n A 1 198 ARG 198 195 195 ARG ARG A . n A 1 199 GLU 199 196 196 GLU GLU A . n A 1 200 HIS 200 197 197 HIS HIS A . n A 1 201 LEU 201 198 198 LEU LEU A . n A 1 202 ILE 202 199 199 ILE ILE A . n A 1 203 LYS 203 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 1 MN MN A . C 3 GOL 1 302 2 GOL GOL A . D 4 SO4 1 303 3 SO4 SO4 A . E 5 HOH 1 401 26 HOH HOH A . E 5 HOH 2 402 45 HOH HOH A . E 5 HOH 3 403 6 HOH HOH A . E 5 HOH 4 404 2 HOH HOH A . E 5 HOH 5 405 15 HOH HOH A . E 5 HOH 6 406 24 HOH HOH A . E 5 HOH 7 407 37 HOH HOH A . E 5 HOH 8 408 18 HOH HOH A . E 5 HOH 9 409 28 HOH HOH A . E 5 HOH 10 410 9 HOH HOH A . E 5 HOH 11 411 22 HOH HOH A . E 5 HOH 12 412 7 HOH HOH A . E 5 HOH 13 413 5 HOH HOH A . E 5 HOH 14 414 20 HOH HOH A . E 5 HOH 15 415 40 HOH HOH A . E 5 HOH 16 416 23 HOH HOH A . E 5 HOH 17 417 13 HOH HOH A . E 5 HOH 18 418 1 HOH HOH A . E 5 HOH 19 419 8 HOH HOH A . E 5 HOH 20 420 4 HOH HOH A . E 5 HOH 21 421 48 HOH HOH A . E 5 HOH 22 422 14 HOH HOH A . E 5 HOH 23 423 3 HOH HOH A . E 5 HOH 24 424 35 HOH HOH A . E 5 HOH 25 425 31 HOH HOH A . E 5 HOH 26 426 21 HOH HOH A . E 5 HOH 27 427 44 HOH HOH A . E 5 HOH 28 428 42 HOH HOH A . E 5 HOH 29 429 46 HOH HOH A . E 5 HOH 30 430 41 HOH HOH A . E 5 HOH 31 431 47 HOH HOH A . E 5 HOH 32 432 38 HOH HOH A . E 5 HOH 33 433 49 HOH HOH A . E 5 HOH 34 434 30 HOH HOH A . E 5 HOH 35 435 12 HOH HOH A . E 5 HOH 36 436 25 HOH HOH A . E 5 HOH 37 437 33 HOH HOH A . E 5 HOH 38 438 17 HOH HOH A . E 5 HOH 39 439 39 HOH HOH A . E 5 HOH 40 440 16 HOH HOH A . E 5 HOH 41 441 29 HOH HOH A . E 5 HOH 42 442 36 HOH HOH A . E 5 HOH 43 443 43 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 610 ? 1 MORE -23 ? 1 'SSA (A^2)' 10970 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 39 ? A HIS 36 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD2 ? A ASP 100 ? A ASP 97 ? 1_555 75.0 ? 2 NE2 ? A HIS 39 ? A HIS 36 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A VAL 114 ? A VAL 111 ? 1_555 98.3 ? 3 OD2 ? A ASP 100 ? A ASP 97 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A VAL 114 ? A VAL 111 ? 1_555 104.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-18 2 'Structure model' 1 1 2016-06-29 3 'Structure model' 1 2 2020-01-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_database_PDB_obs_spr 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_database_status.status_code' 3 3 'Structure model' '_pdbx_database_status.status_code_sf' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 12.5144 _pdbx_refine_tls.origin_y -15.5032 _pdbx_refine_tls.origin_z 15.9049 _pdbx_refine_tls.T[1][1] 0.5141 _pdbx_refine_tls.T[2][2] 0.4072 _pdbx_refine_tls.T[3][3] 0.2502 _pdbx_refine_tls.T[1][2] -0.1271 _pdbx_refine_tls.T[1][3] -0.0091 _pdbx_refine_tls.T[2][3] 0.0580 _pdbx_refine_tls.L[1][1] 8.5586 _pdbx_refine_tls.L[2][2] 3.3154 _pdbx_refine_tls.L[3][3] 1.4735 _pdbx_refine_tls.L[1][2] -2.6820 _pdbx_refine_tls.L[1][3] -2.2221 _pdbx_refine_tls.L[2][3] 1.5258 _pdbx_refine_tls.S[1][1] 0.2089 _pdbx_refine_tls.S[1][2] -0.7610 _pdbx_refine_tls.S[1][3] 0.2426 _pdbx_refine_tls.S[2][1] -0.2658 _pdbx_refine_tls.S[2][2] 0.0975 _pdbx_refine_tls.S[2][3] 0.1172 _pdbx_refine_tls.S[3][1] -0.0595 _pdbx_refine_tls.S[3][2] 0.1520 _pdbx_refine_tls.S[3][3] -0.2432 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? v7.1.3 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 434 ? ? O A HOH 441 ? ? 2.06 2 1 O A HOH 422 ? ? O A HOH 436 ? ? 2.15 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A LEU 22 ? ? CB A LEU 22 ? ? CG A LEU 22 ? ? 132.78 115.30 17.48 2.30 N 2 1 CA A CYS 24 ? ? CB A CYS 24 ? ? SG A CYS 24 ? ? 124.63 114.20 10.43 1.10 N 3 1 C A ILE 148 ? ? N A PRO 149 ? ? CA A PRO 149 ? ? 130.64 119.30 11.34 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 47 ? ? -146.68 -49.56 2 1 TRP A 172 ? ? -157.15 74.78 3 1 SER A 174 ? ? -178.59 149.92 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 23 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 CYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 24 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 144.52 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id LYS _pdbx_unobs_or_zero_occ_residues.auth_seq_id 200 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id LYS _pdbx_unobs_or_zero_occ_residues.label_seq_id 203 # _pdbx_audit_support.funding_organization 'German Research Foundation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'RE 3712/1-1' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 GLYCEROL GOL 4 'SULFATE ION' SO4 5 water HOH #