data_5HSL # _entry.id 5HSL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.283 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HSL WWPDB D_1000217520 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2017-08-09 _pdbx_database_PDB_obs_spr.pdb_id 5X7Z _pdbx_database_PDB_obs_spr.replace_pdb_id 5HSL _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5HSO PDB . unspecified 5HSM PDB . unspecified 5HSN PDB . # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HSL _pdbx_database_status.recvd_initial_deposition_date 2016-01-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gao, Y.R.' 1 'Li, D.F.' 2 'Wang, D.C.' 3 'Bi, L.J.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural and functional analysis of the mechanism of MarR protein Rv2887 from M. tuberculosis' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gao, Y.R.' 1 primary 'Li, D.F.' 2 primary 'Bi, L.J.' 3 primary 'Wang, D.C.' 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5HSL _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.810 _cell.length_a_esd ? _cell.length_b 86.870 _cell.length_b_esd ? _cell.length_c 43.560 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HSL _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized HTH-type transcriptional regulator Rv2887' 17012.662 1 ? ? ? ? 2 non-polymer syn '2-HYDROXY-4-AMINOBENZOIC ACID' 153.135 1 ? ? ? ? 3 water nat water 18.015 43 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMMGLADDAPLGYLLYRVGAVLRPEVSAALSPLGLTLPEFVCLRMLSQSPGLSSAELARHA SVTPQAMNTVLRKLEDAGAVARPASVSSGRSLPATLTARGRALAKRAEAVVRAADARVLARLTAPQQREFKRMLEKLGSD ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMMGLADDAPLGYLLYRVGAVLRPEVSAALSPLGLTLPEFVCLRMLSQSPGLSSAELARHA SVTPQAMNTVLRKLEDAGAVARPASVSSGRSLPATLTARGRALAKRAEAVVRAADARVLARLTAPQQREFKRMLEKLGSD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 MET n 1 23 GLY n 1 24 LEU n 1 25 ALA n 1 26 ASP n 1 27 ASP n 1 28 ALA n 1 29 PRO n 1 30 LEU n 1 31 GLY n 1 32 TYR n 1 33 LEU n 1 34 LEU n 1 35 TYR n 1 36 ARG n 1 37 VAL n 1 38 GLY n 1 39 ALA n 1 40 VAL n 1 41 LEU n 1 42 ARG n 1 43 PRO n 1 44 GLU n 1 45 VAL n 1 46 SER n 1 47 ALA n 1 48 ALA n 1 49 LEU n 1 50 SER n 1 51 PRO n 1 52 LEU n 1 53 GLY n 1 54 LEU n 1 55 THR n 1 56 LEU n 1 57 PRO n 1 58 GLU n 1 59 PHE n 1 60 VAL n 1 61 CYS n 1 62 LEU n 1 63 ARG n 1 64 MET n 1 65 LEU n 1 66 SER n 1 67 GLN n 1 68 SER n 1 69 PRO n 1 70 GLY n 1 71 LEU n 1 72 SER n 1 73 SER n 1 74 ALA n 1 75 GLU n 1 76 LEU n 1 77 ALA n 1 78 ARG n 1 79 HIS n 1 80 ALA n 1 81 SER n 1 82 VAL n 1 83 THR n 1 84 PRO n 1 85 GLN n 1 86 ALA n 1 87 MET n 1 88 ASN n 1 89 THR n 1 90 VAL n 1 91 LEU n 1 92 ARG n 1 93 LYS n 1 94 LEU n 1 95 GLU n 1 96 ASP n 1 97 ALA n 1 98 GLY n 1 99 ALA n 1 100 VAL n 1 101 ALA n 1 102 ARG n 1 103 PRO n 1 104 ALA n 1 105 SER n 1 106 VAL n 1 107 SER n 1 108 SER n 1 109 GLY n 1 110 ARG n 1 111 SER n 1 112 LEU n 1 113 PRO n 1 114 ALA n 1 115 THR n 1 116 LEU n 1 117 THR n 1 118 ALA n 1 119 ARG n 1 120 GLY n 1 121 ARG n 1 122 ALA n 1 123 LEU n 1 124 ALA n 1 125 LYS n 1 126 ARG n 1 127 ALA n 1 128 GLU n 1 129 ALA n 1 130 VAL n 1 131 VAL n 1 132 ARG n 1 133 ALA n 1 134 ALA n 1 135 ASP n 1 136 ALA n 1 137 ARG n 1 138 VAL n 1 139 LEU n 1 140 ALA n 1 141 ARG n 1 142 LEU n 1 143 THR n 1 144 ALA n 1 145 PRO n 1 146 GLN n 1 147 GLN n 1 148 ARG n 1 149 GLU n 1 150 PHE n 1 151 LYS n 1 152 ARG n 1 153 MET n 1 154 LEU n 1 155 GLU n 1 156 LYS n 1 157 LEU n 1 158 GLY n 1 159 SER n 1 160 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 160 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Rv2887, MTCY274.18' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25618 / H37Rv' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y2887_MYCTU _struct_ref.pdbx_db_accession P9WME9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGLADDAPLGYLLYRVGAVLRPEVSAALSPLGLTLPEFVCLRMLSQSPGLSSAELARHASVTPQAMNTVLRKLEDAGAVA RPASVSSGRSLPATLTARGRALAKRAEAVVRAADARVLARLTAPQQREFKRMLEKLGSD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HSL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 160 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WME9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HSL MET A 1 ? UNP P9WME9 ? ? 'initiating methionine' -20 1 1 5HSL GLY A 2 ? UNP P9WME9 ? ? 'expression tag' -19 2 1 5HSL SER A 3 ? UNP P9WME9 ? ? 'expression tag' -18 3 1 5HSL SER A 4 ? UNP P9WME9 ? ? 'expression tag' -17 4 1 5HSL HIS A 5 ? UNP P9WME9 ? ? 'expression tag' -16 5 1 5HSL HIS A 6 ? UNP P9WME9 ? ? 'expression tag' -15 6 1 5HSL HIS A 7 ? UNP P9WME9 ? ? 'expression tag' -14 7 1 5HSL HIS A 8 ? UNP P9WME9 ? ? 'expression tag' -13 8 1 5HSL HIS A 9 ? UNP P9WME9 ? ? 'expression tag' -12 9 1 5HSL HIS A 10 ? UNP P9WME9 ? ? 'expression tag' -11 10 1 5HSL SER A 11 ? UNP P9WME9 ? ? 'expression tag' -10 11 1 5HSL SER A 12 ? UNP P9WME9 ? ? 'expression tag' -9 12 1 5HSL GLY A 13 ? UNP P9WME9 ? ? 'expression tag' -8 13 1 5HSL LEU A 14 ? UNP P9WME9 ? ? 'expression tag' -7 14 1 5HSL VAL A 15 ? UNP P9WME9 ? ? 'expression tag' -6 15 1 5HSL PRO A 16 ? UNP P9WME9 ? ? 'expression tag' -5 16 1 5HSL ARG A 17 ? UNP P9WME9 ? ? 'expression tag' -4 17 1 5HSL GLY A 18 ? UNP P9WME9 ? ? 'expression tag' -3 18 1 5HSL SER A 19 ? UNP P9WME9 ? ? 'expression tag' -2 19 1 5HSL HIS A 20 ? UNP P9WME9 ? ? 'expression tag' -1 20 1 5HSL MET A 21 ? UNP P9WME9 ? ? 'expression tag' 0 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BHA non-polymer . '2-HYDROXY-4-AMINOBENZOIC ACID' ? 'C7 H7 N O3' 153.135 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HSL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 3.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1M CITRIC ACID PH 3.5, 2.0M AMMONIUM SULFATE, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 289K ; _exptl_crystal_grow.pdbx_pH_range 3.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details MIRRORS _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-09-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'DOUBLE CRYSTAL (SI 111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 40.80 _reflns.entry_id 5HSL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.200 _reflns.d_resolution_low 27.450 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8664 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0.000 _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.500 _reflns.pdbx_Rmerge_I_obs 0.11700 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.11700 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.0000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.200 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.82100 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.50 _reflns_shell.pdbx_Rsym_value 0.82100 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HSL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 27.45 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8654 _refine.ls_number_reflns_R_free 864 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6 _refine.ls_percent_reflns_R_free 9.980 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.227 _refine.ls_R_factor_R_free 0.266 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.223 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5HSM _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.110 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.250 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 979 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1033 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 27.45 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1003 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.619 ? 1358 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.588 ? 385 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.023 ? 162 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 176 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2003 2.3381 . . 140 1276 100.00 . . . 0.2919 . 0.2308 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3381 2.5185 . . 141 1269 100.00 . . . 0.3263 . 0.2454 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5185 2.7717 . . 144 1291 100.00 . . . 0.2773 . 0.2341 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7717 3.1723 . . 138 1274 99.00 . . . 0.2972 . 0.2617 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1723 3.9948 . . 146 1306 100.00 . . . 0.2828 . 0.2125 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9948 27.4557 . . 155 1374 100.00 . . . 0.2296 . 0.2074 . . . . . . . . . . # _struct.entry_id 5HSL _struct.title 'CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS MARR FAMILY PROTEIN RV2887 COMPLEX WITH P-AMINOSALICYLIC ACID' _struct.pdbx_descriptor 'Uncharacterized HTH-type transcriptional regulator Rv2887' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HSL _struct_keywords.text 'WHTH MOTIF, HTH-TYPE TRANSCRIPTIONAL REGULATOR, DNA BINDING, P-AMINOSALICYLIC ACID BINDING, SALICYLIC ACID BINDING, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 29 ? SER A 50 ? PRO A 8 SER A 29 1 ? 22 HELX_P HELX_P2 AA2 PRO A 51 ? GLY A 53 ? PRO A 30 GLY A 32 5 ? 3 HELX_P HELX_P3 AA3 THR A 55 ? SER A 68 ? THR A 34 SER A 47 1 ? 14 HELX_P HELX_P4 AA4 SER A 72 ? ALA A 80 ? SER A 51 ALA A 59 1 ? 9 HELX_P HELX_P5 AA5 THR A 83 ? ALA A 97 ? THR A 62 ALA A 76 1 ? 15 HELX_P HELX_P6 AA6 THR A 117 ? ALA A 140 ? THR A 96 ALA A 119 1 ? 24 HELX_P HELX_P7 AA7 THR A 143 ? SER A 159 ? THR A 122 SER A 138 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 108 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 87 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 109 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 88 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.84 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 100 ? ALA A 101 ? VAL A 79 ALA A 80 AA1 2 THR A 115 ? LEU A 116 ? THR A 94 LEU A 95 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 101 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 80 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 115 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 94 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BHA _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue BHA A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 PRO A 29 ? PRO A 8 . ? 4_555 ? 2 AC1 6 ARG A 42 ? ARG A 21 . ? 1_555 ? 3 AC1 6 LEU A 56 ? LEU A 35 . ? 1_555 ? 4 AC1 6 PHE A 59 ? PHE A 38 . ? 1_555 ? 5 AC1 6 ARG A 63 ? ARG A 42 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 314 . ? 1_555 ? # _database_PDB_matrix.entry_id 5HSL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5HSL _atom_sites.fract_transf_matrix[1][1] 0.011519 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011511 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022957 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 GLY 2 -19 ? ? ? A . n A 1 3 SER 3 -18 ? ? ? A . n A 1 4 SER 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 HIS 9 -12 ? ? ? A . n A 1 10 HIS 10 -11 ? ? ? A . n A 1 11 SER 11 -10 ? ? ? A . n A 1 12 SER 12 -9 ? ? ? A . n A 1 13 GLY 13 -8 ? ? ? A . n A 1 14 LEU 14 -7 ? ? ? A . n A 1 15 VAL 15 -6 ? ? ? A . n A 1 16 PRO 16 -5 ? ? ? A . n A 1 17 ARG 17 -4 ? ? ? A . n A 1 18 GLY 18 -3 ? ? ? A . n A 1 19 SER 19 -2 ? ? ? A . n A 1 20 HIS 20 -1 ? ? ? A . n A 1 21 MET 21 0 ? ? ? A . n A 1 22 MET 22 1 ? ? ? A . n A 1 23 GLY 23 2 ? ? ? A . n A 1 24 LEU 24 3 ? ? ? A . n A 1 25 ALA 25 4 ? ? ? A . n A 1 26 ASP 26 5 ? ? ? A . n A 1 27 ASP 27 6 ? ? ? A . n A 1 28 ALA 28 7 7 ALA ALA A . n A 1 29 PRO 29 8 8 PRO PRO A . n A 1 30 LEU 30 9 9 LEU LEU A . n A 1 31 GLY 31 10 10 GLY GLY A . n A 1 32 TYR 32 11 11 TYR TYR A . n A 1 33 LEU 33 12 12 LEU LEU A . n A 1 34 LEU 34 13 13 LEU LEU A . n A 1 35 TYR 35 14 14 TYR TYR A . n A 1 36 ARG 36 15 15 ARG ARG A . n A 1 37 VAL 37 16 16 VAL VAL A . n A 1 38 GLY 38 17 17 GLY GLY A . n A 1 39 ALA 39 18 18 ALA ALA A . n A 1 40 VAL 40 19 19 VAL VAL A . n A 1 41 LEU 41 20 20 LEU LEU A . n A 1 42 ARG 42 21 21 ARG ARG A . n A 1 43 PRO 43 22 22 PRO PRO A . n A 1 44 GLU 44 23 23 GLU GLU A . n A 1 45 VAL 45 24 24 VAL VAL A . n A 1 46 SER 46 25 25 SER SER A . n A 1 47 ALA 47 26 26 ALA ALA A . n A 1 48 ALA 48 27 27 ALA ALA A . n A 1 49 LEU 49 28 28 LEU LEU A . n A 1 50 SER 50 29 29 SER SER A . n A 1 51 PRO 51 30 30 PRO PRO A . n A 1 52 LEU 52 31 31 LEU LEU A . n A 1 53 GLY 53 32 32 GLY GLY A . n A 1 54 LEU 54 33 33 LEU LEU A . n A 1 55 THR 55 34 34 THR THR A . n A 1 56 LEU 56 35 35 LEU LEU A . n A 1 57 PRO 57 36 36 PRO PRO A . n A 1 58 GLU 58 37 37 GLU GLU A . n A 1 59 PHE 59 38 38 PHE PHE A . n A 1 60 VAL 60 39 39 VAL VAL A . n A 1 61 CYS 61 40 40 CYS CYS A . n A 1 62 LEU 62 41 41 LEU LEU A . n A 1 63 ARG 63 42 42 ARG ARG A . n A 1 64 MET 64 43 43 MET MET A . n A 1 65 LEU 65 44 44 LEU LEU A . n A 1 66 SER 66 45 45 SER SER A . n A 1 67 GLN 67 46 46 GLN GLN A . n A 1 68 SER 68 47 47 SER SER A . n A 1 69 PRO 69 48 48 PRO PRO A . n A 1 70 GLY 70 49 49 GLY GLY A . n A 1 71 LEU 71 50 50 LEU LEU A . n A 1 72 SER 72 51 51 SER SER A . n A 1 73 SER 73 52 52 SER SER A . n A 1 74 ALA 74 53 53 ALA ALA A . n A 1 75 GLU 75 54 54 GLU GLU A . n A 1 76 LEU 76 55 55 LEU LEU A . n A 1 77 ALA 77 56 56 ALA ALA A . n A 1 78 ARG 78 57 57 ARG ARG A . n A 1 79 HIS 79 58 58 HIS HIS A . n A 1 80 ALA 80 59 59 ALA ALA A . n A 1 81 SER 81 60 60 SER SER A . n A 1 82 VAL 82 61 61 VAL VAL A . n A 1 83 THR 83 62 62 THR THR A . n A 1 84 PRO 84 63 63 PRO PRO A . n A 1 85 GLN 85 64 64 GLN GLN A . n A 1 86 ALA 86 65 65 ALA ALA A . n A 1 87 MET 87 66 66 MET MET A . n A 1 88 ASN 88 67 67 ASN ASN A . n A 1 89 THR 89 68 68 THR THR A . n A 1 90 VAL 90 69 69 VAL VAL A . n A 1 91 LEU 91 70 70 LEU LEU A . n A 1 92 ARG 92 71 71 ARG ARG A . n A 1 93 LYS 93 72 72 LYS LYS A . n A 1 94 LEU 94 73 73 LEU LEU A . n A 1 95 GLU 95 74 74 GLU GLU A . n A 1 96 ASP 96 75 75 ASP ASP A . n A 1 97 ALA 97 76 76 ALA ALA A . n A 1 98 GLY 98 77 77 GLY GLY A . n A 1 99 ALA 99 78 78 ALA ALA A . n A 1 100 VAL 100 79 79 VAL VAL A . n A 1 101 ALA 101 80 80 ALA ALA A . n A 1 102 ARG 102 81 81 ARG ARG A . n A 1 103 PRO 103 82 82 PRO PRO A . n A 1 104 ALA 104 83 83 ALA ALA A . n A 1 105 SER 105 84 84 SER SER A . n A 1 106 VAL 106 85 85 VAL VAL A . n A 1 107 SER 107 86 86 SER SER A . n A 1 108 SER 108 87 87 SER SER A . n A 1 109 GLY 109 88 88 GLY GLY A . n A 1 110 ARG 110 89 89 ARG ARG A . n A 1 111 SER 111 90 90 SER SER A . n A 1 112 LEU 112 91 91 LEU LEU A . n A 1 113 PRO 113 92 92 PRO PRO A . n A 1 114 ALA 114 93 93 ALA ALA A . n A 1 115 THR 115 94 94 THR THR A . n A 1 116 LEU 116 95 95 LEU LEU A . n A 1 117 THR 117 96 96 THR THR A . n A 1 118 ALA 118 97 97 ALA ALA A . n A 1 119 ARG 119 98 98 ARG ARG A . n A 1 120 GLY 120 99 99 GLY GLY A . n A 1 121 ARG 121 100 100 ARG ARG A . n A 1 122 ALA 122 101 101 ALA ALA A . n A 1 123 LEU 123 102 102 LEU LEU A . n A 1 124 ALA 124 103 103 ALA ALA A . n A 1 125 LYS 125 104 104 LYS LYS A . n A 1 126 ARG 126 105 105 ARG ARG A . n A 1 127 ALA 127 106 106 ALA ALA A . n A 1 128 GLU 128 107 107 GLU GLU A . n A 1 129 ALA 129 108 108 ALA ALA A . n A 1 130 VAL 130 109 109 VAL VAL A . n A 1 131 VAL 131 110 110 VAL VAL A . n A 1 132 ARG 132 111 111 ARG ARG A . n A 1 133 ALA 133 112 112 ALA ALA A . n A 1 134 ALA 134 113 113 ALA ALA A . n A 1 135 ASP 135 114 114 ASP ASP A . n A 1 136 ALA 136 115 115 ALA ALA A . n A 1 137 ARG 137 116 116 ARG ARG A . n A 1 138 VAL 138 117 117 VAL VAL A . n A 1 139 LEU 139 118 118 LEU LEU A . n A 1 140 ALA 140 119 119 ALA ALA A . n A 1 141 ARG 141 120 120 ARG ARG A . n A 1 142 LEU 142 121 121 LEU LEU A . n A 1 143 THR 143 122 122 THR THR A . n A 1 144 ALA 144 123 123 ALA ALA A . n A 1 145 PRO 145 124 124 PRO PRO A . n A 1 146 GLN 146 125 125 GLN GLN A . n A 1 147 GLN 147 126 126 GLN GLN A . n A 1 148 ARG 148 127 127 ARG ARG A . n A 1 149 GLU 149 128 128 GLU GLU A . n A 1 150 PHE 150 129 129 PHE PHE A . n A 1 151 LYS 151 130 130 LYS LYS A . n A 1 152 ARG 152 131 131 ARG ARG A . n A 1 153 MET 153 132 132 MET MET A . n A 1 154 LEU 154 133 133 LEU LEU A . n A 1 155 GLU 155 134 134 GLU GLU A . n A 1 156 LYS 156 135 135 LYS LYS A . n A 1 157 LEU 157 136 136 LEU LEU A . n A 1 158 GLY 158 137 137 GLY GLY A . n A 1 159 SER 159 138 138 SER SER A . n A 1 160 ASP 160 139 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BHA 1 201 201 BHA BHA A . C 3 HOH 1 301 338 HOH HOH A . C 3 HOH 2 302 308 HOH HOH A . C 3 HOH 3 303 314 HOH HOH A . C 3 HOH 4 304 325 HOH HOH A . C 3 HOH 5 305 318 HOH HOH A . C 3 HOH 6 306 304 HOH HOH A . C 3 HOH 7 307 302 HOH HOH A . C 3 HOH 8 308 309 HOH HOH A . C 3 HOH 9 309 315 HOH HOH A . C 3 HOH 10 310 307 HOH HOH A . C 3 HOH 11 311 319 HOH HOH A . C 3 HOH 12 312 311 HOH HOH A . C 3 HOH 13 313 340 HOH HOH A . C 3 HOH 14 314 301 HOH HOH A . C 3 HOH 15 315 306 HOH HOH A . C 3 HOH 16 316 343 HOH HOH A . C 3 HOH 17 317 331 HOH HOH A . C 3 HOH 18 318 317 HOH HOH A . C 3 HOH 19 319 322 HOH HOH A . C 3 HOH 20 320 316 HOH HOH A . C 3 HOH 21 321 305 HOH HOH A . C 3 HOH 22 322 327 HOH HOH A . C 3 HOH 23 323 312 HOH HOH A . C 3 HOH 24 324 326 HOH HOH A . C 3 HOH 25 325 303 HOH HOH A . C 3 HOH 26 326 323 HOH HOH A . C 3 HOH 27 327 333 HOH HOH A . C 3 HOH 28 328 334 HOH HOH A . C 3 HOH 29 329 330 HOH HOH A . C 3 HOH 30 330 342 HOH HOH A . C 3 HOH 31 331 337 HOH HOH A . C 3 HOH 32 332 321 HOH HOH A . C 3 HOH 33 333 339 HOH HOH A . C 3 HOH 34 334 310 HOH HOH A . C 3 HOH 35 335 313 HOH HOH A . C 3 HOH 36 336 336 HOH HOH A . C 3 HOH 37 337 332 HOH HOH A . C 3 HOH 38 338 341 HOH HOH A . C 3 HOH 39 339 328 HOH HOH A . C 3 HOH 40 340 329 HOH HOH A . C 3 HOH 41 341 335 HOH HOH A . C 3 HOH 42 342 324 HOH HOH A . C 3 HOH 43 343 320 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4670 ? 1 MORE -27 ? 1 'SSA (A^2)' 13610 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-01 2 'Structure model' 1 1 2017-08-09 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_PDB_obs_spr 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code' 2 2 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASES ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NZ A LYS 130 ? ? O A HOH 301 ? ? 1.88 2 1 O A HOH 315 ? ? O A HOH 338 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 332 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 343 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_655 _pdbx_validate_symm_contact.dist 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 47 ? ? -154.64 69.11 2 1 SER A 86 ? ? -131.32 -78.67 3 1 SER A 87 ? ? 173.94 63.58 4 1 ARG A 89 ? ? -73.22 -144.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A GLY -19 ? A GLY 2 3 1 Y 1 A SER -18 ? A SER 3 4 1 Y 1 A SER -17 ? A SER 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A HIS -12 ? A HIS 9 10 1 Y 1 A HIS -11 ? A HIS 10 11 1 Y 1 A SER -10 ? A SER 11 12 1 Y 1 A SER -9 ? A SER 12 13 1 Y 1 A GLY -8 ? A GLY 13 14 1 Y 1 A LEU -7 ? A LEU 14 15 1 Y 1 A VAL -6 ? A VAL 15 16 1 Y 1 A PRO -5 ? A PRO 16 17 1 Y 1 A ARG -4 ? A ARG 17 18 1 Y 1 A GLY -3 ? A GLY 18 19 1 Y 1 A SER -2 ? A SER 19 20 1 Y 1 A HIS -1 ? A HIS 20 21 1 Y 1 A MET 0 ? A MET 21 22 1 Y 1 A MET 1 ? A MET 22 23 1 Y 1 A GLY 2 ? A GLY 23 24 1 Y 1 A LEU 3 ? A LEU 24 25 1 Y 1 A ALA 4 ? A ALA 25 26 1 Y 1 A ASP 5 ? A ASP 26 27 1 Y 1 A ASP 6 ? A ASP 27 28 1 Y 1 A ASP 139 ? A ASP 160 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-HYDROXY-4-AMINOBENZOIC ACID' BHA 3 water HOH #