data_5HZE # _entry.id 5HZE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5HZE WWPDB D_1000216254 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HZE _pdbx_database_status.recvd_initial_deposition_date 2016-02-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Larsen, N.A.' 1 'Bloudoff, K.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Mek1 adopts DFG-out conformation when bound to an analog of E6201.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Larsen, N.A.' 1 primary 'Bloudoff, K.' 2 primary 'Subramanian, V.' 3 primary 'Nomoto, K.' 4 primary 'Wang, J.' 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5HZE _cell.details ? _cell.formula_units_Z ? _cell.length_a 77.118 _cell.length_a_esd ? _cell.length_b 77.118 _cell.length_b_esd ? _cell.length_c 222.064 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HZE _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 1' 38934.871 1 2.7.12.2 'S298N, S299K, Y300F' ? ? 2 non-polymer syn '(3S,4R,8S,9S,11E)-8,9,16-trihydroxy-3,4-dimethyl-14-(methylamino)-3,4,5,6,9,10-hexahydro-1H-2-benzoxacyclotetradecine-1,7(8H)-dione' 377.431 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MKK1,ERK activator kinase 1,MAPK/ERK kinase 1,MEK 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIREL QVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSN ILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMF GCQVEGDAAETPPRPRTPGRPLNKFGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQL MVHAFIKRSDAEEVDFAGWLCSTIGLNQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIREL QVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSN ILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMF GCQVEGDAAETPPRPRTPGRPLNKFGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQL MVHAFIKRSDAEEVDFAGWLCSTIGLNQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 GLU n 1 4 GLU n 1 5 LEU n 1 6 GLU n 1 7 LEU n 1 8 ASP n 1 9 GLU n 1 10 GLN n 1 11 GLN n 1 12 ARG n 1 13 LYS n 1 14 ARG n 1 15 LEU n 1 16 GLU n 1 17 ALA n 1 18 PHE n 1 19 LEU n 1 20 THR n 1 21 GLN n 1 22 LYS n 1 23 GLN n 1 24 LYS n 1 25 VAL n 1 26 GLY n 1 27 GLU n 1 28 LEU n 1 29 LYS n 1 30 ASP n 1 31 ASP n 1 32 ASP n 1 33 PHE n 1 34 GLU n 1 35 LYS n 1 36 ILE n 1 37 SER n 1 38 GLU n 1 39 LEU n 1 40 GLY n 1 41 ALA n 1 42 GLY n 1 43 ASN n 1 44 GLY n 1 45 GLY n 1 46 VAL n 1 47 VAL n 1 48 PHE n 1 49 LYS n 1 50 VAL n 1 51 SER n 1 52 HIS n 1 53 LYS n 1 54 PRO n 1 55 SER n 1 56 GLY n 1 57 LEU n 1 58 VAL n 1 59 MET n 1 60 ALA n 1 61 ARG n 1 62 LYS n 1 63 LEU n 1 64 ILE n 1 65 HIS n 1 66 LEU n 1 67 GLU n 1 68 ILE n 1 69 LYS n 1 70 PRO n 1 71 ALA n 1 72 ILE n 1 73 ARG n 1 74 ASN n 1 75 GLN n 1 76 ILE n 1 77 ILE n 1 78 ARG n 1 79 GLU n 1 80 LEU n 1 81 GLN n 1 82 VAL n 1 83 LEU n 1 84 HIS n 1 85 GLU n 1 86 CYS n 1 87 ASN n 1 88 SER n 1 89 PRO n 1 90 TYR n 1 91 ILE n 1 92 VAL n 1 93 GLY n 1 94 PHE n 1 95 TYR n 1 96 GLY n 1 97 ALA n 1 98 PHE n 1 99 TYR n 1 100 SER n 1 101 ASP n 1 102 GLY n 1 103 GLU n 1 104 ILE n 1 105 SER n 1 106 ILE n 1 107 CYS n 1 108 MET n 1 109 GLU n 1 110 HIS n 1 111 MET n 1 112 ASP n 1 113 GLY n 1 114 GLY n 1 115 SER n 1 116 LEU n 1 117 ASP n 1 118 GLN n 1 119 VAL n 1 120 LEU n 1 121 LYS n 1 122 LYS n 1 123 ALA n 1 124 GLY n 1 125 ARG n 1 126 ILE n 1 127 PRO n 1 128 GLU n 1 129 GLN n 1 130 ILE n 1 131 LEU n 1 132 GLY n 1 133 LYS n 1 134 VAL n 1 135 SER n 1 136 ILE n 1 137 ALA n 1 138 VAL n 1 139 ILE n 1 140 LYS n 1 141 GLY n 1 142 LEU n 1 143 THR n 1 144 TYR n 1 145 LEU n 1 146 ARG n 1 147 GLU n 1 148 LYS n 1 149 HIS n 1 150 LYS n 1 151 ILE n 1 152 MET n 1 153 HIS n 1 154 ARG n 1 155 ASP n 1 156 VAL n 1 157 LYS n 1 158 PRO n 1 159 SER n 1 160 ASN n 1 161 ILE n 1 162 LEU n 1 163 VAL n 1 164 ASN n 1 165 SER n 1 166 ARG n 1 167 GLY n 1 168 GLU n 1 169 ILE n 1 170 LYS n 1 171 LEU n 1 172 CYS n 1 173 ASP n 1 174 PHE n 1 175 GLY n 1 176 VAL n 1 177 SER n 1 178 GLY n 1 179 GLN n 1 180 LEU n 1 181 ILE n 1 182 ASP n 1 183 SER n 1 184 MET n 1 185 ALA n 1 186 ASN n 1 187 SER n 1 188 PHE n 1 189 VAL n 1 190 GLY n 1 191 THR n 1 192 ARG n 1 193 SER n 1 194 TYR n 1 195 MET n 1 196 SER n 1 197 PRO n 1 198 GLU n 1 199 ARG n 1 200 LEU n 1 201 GLN n 1 202 GLY n 1 203 THR n 1 204 HIS n 1 205 TYR n 1 206 SER n 1 207 VAL n 1 208 GLN n 1 209 SER n 1 210 ASP n 1 211 ILE n 1 212 TRP n 1 213 SER n 1 214 MET n 1 215 GLY n 1 216 LEU n 1 217 SER n 1 218 LEU n 1 219 VAL n 1 220 GLU n 1 221 MET n 1 222 ALA n 1 223 VAL n 1 224 GLY n 1 225 ARG n 1 226 TYR n 1 227 PRO n 1 228 ILE n 1 229 PRO n 1 230 PRO n 1 231 PRO n 1 232 ASP n 1 233 ALA n 1 234 LYS n 1 235 GLU n 1 236 LEU n 1 237 GLU n 1 238 LEU n 1 239 MET n 1 240 PHE n 1 241 GLY n 1 242 CYS n 1 243 GLN n 1 244 VAL n 1 245 GLU n 1 246 GLY n 1 247 ASP n 1 248 ALA n 1 249 ALA n 1 250 GLU n 1 251 THR n 1 252 PRO n 1 253 PRO n 1 254 ARG n 1 255 PRO n 1 256 ARG n 1 257 THR n 1 258 PRO n 1 259 GLY n 1 260 ARG n 1 261 PRO n 1 262 LEU n 1 263 ASN n 1 264 LYS n 1 265 PHE n 1 266 GLY n 1 267 MET n 1 268 ASP n 1 269 SER n 1 270 ARG n 1 271 PRO n 1 272 PRO n 1 273 MET n 1 274 ALA n 1 275 ILE n 1 276 PHE n 1 277 GLU n 1 278 LEU n 1 279 LEU n 1 280 ASP n 1 281 TYR n 1 282 ILE n 1 283 VAL n 1 284 ASN n 1 285 GLU n 1 286 PRO n 1 287 PRO n 1 288 PRO n 1 289 LYS n 1 290 LEU n 1 291 PRO n 1 292 SER n 1 293 GLY n 1 294 VAL n 1 295 PHE n 1 296 SER n 1 297 LEU n 1 298 GLU n 1 299 PHE n 1 300 GLN n 1 301 ASP n 1 302 PHE n 1 303 VAL n 1 304 ASN n 1 305 LYS n 1 306 CYS n 1 307 LEU n 1 308 ILE n 1 309 LYS n 1 310 ASN n 1 311 PRO n 1 312 ALA n 1 313 GLU n 1 314 ARG n 1 315 ALA n 1 316 ASP n 1 317 LEU n 1 318 LYS n 1 319 GLN n 1 320 LEU n 1 321 MET n 1 322 VAL n 1 323 HIS n 1 324 ALA n 1 325 PHE n 1 326 ILE n 1 327 LYS n 1 328 ARG n 1 329 SER n 1 330 ASP n 1 331 ALA n 1 332 GLU n 1 333 GLU n 1 334 VAL n 1 335 ASP n 1 336 PHE n 1 337 ALA n 1 338 GLY n 1 339 TRP n 1 340 LEU n 1 341 CYS n 1 342 SER n 1 343 THR n 1 344 ILE n 1 345 GLY n 1 346 LEU n 1 347 ASN n 1 348 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 348 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP2K1, MEK1, PRKMK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line SF9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MP2K1_HUMAN _struct_ref.pdbx_db_accession Q02750 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQ VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNI LVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFG CQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLM VHAFIKRSDAEEVDFAGWLCSTIGLNQ ; _struct_ref.pdbx_align_begin 37 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5HZE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 348 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02750 _struct_ref_seq.db_align_beg 37 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 383 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 37 _struct_ref_seq.pdbx_auth_seq_align_end 383 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5HZE GLY A 1 ? UNP Q02750 ? ? 'expression tag' 36 1 1 5HZE ASN A 263 ? UNP Q02750 SER 298 'engineered mutation' 298 2 1 5HZE LYS A 264 ? UNP Q02750 SER 299 'engineered mutation' 299 3 1 5HZE PHE A 265 ? UNP Q02750 TYR 300 'engineered mutation' 300 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 E62 non-polymer . '(3S,4R,8S,9S,11E)-8,9,16-trihydroxy-3,4-dimethyl-14-(methylamino)-3,4,5,6,9,10-hexahydro-1H-2-benzoxacyclotetradecine-1,7(8H)-dione' ? 'C20 H27 N O6' 377.431 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HZE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Tris pH 8.0, 180 mM CaCl2, 14-18% PEG 4000. Co-crystallized with 1mM ATPgammaS (30 mM stock formulated in H2O). Crystals backsoaked for 2 weeks in 1 mM compound 3.3% DMSO final. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-08-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HZE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.40 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16108 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 2.02 _refine.aniso_B[1][2] 1.01 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.02 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -6.55 _refine.B_iso_max ? _refine.B_iso_mean 69.241 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.908 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5HZE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 42.69 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15135 _refine.ls_number_reflns_R_free 822 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.36 _refine.ls_percent_reflns_R_free 5.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20498 _refine.ls_R_factor_R_free 0.28714 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20053 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.329 _refine.pdbx_overall_ESU_R_Free 0.282 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 9.117 _refine.overall_SU_ML 0.210 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5HZE _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2359 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 2422 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 42.69 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 2439 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 2363 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.806 1.987 3290 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.426 3.004 5450 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.917 5.000 304 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.541 24.762 105 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.308 15.000 432 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.695 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.095 0.200 367 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.021 2732 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 527 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.503 6.815 1219 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.488 6.811 1218 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.159 10.196 1519 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.157 10.201 1520 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.076 7.219 1220 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.074 7.217 1221 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 9.119 10.608 1771 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 13.472 63.618 10062 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 13.472 63.617 10062 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.403 _refine_ls_shell.d_res_low 2.465 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 54 _refine_ls_shell.number_reflns_R_work 1061 _refine_ls_shell.percent_reflns_obs 98.07 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.321 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.258 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5HZE _struct.title 'Mek1 adopts DFG-out conformation when bound to an analog of E6201.' _struct.pdbx_descriptor 'Dual specificity mitogen-activated protein kinase kinase 1 (E.C.2.7.12.2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HZE _struct_keywords.text 'Mek1, E6201, Covalent inhibitor, kinase, Mek-1, MAP2K1, DFG-out, Transferase-Transferase Inhibitor complex' _struct_keywords.pdbx_keywords 'Transferase/Transferase Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 8 ? LYS A 24 ? ASP A 43 LYS A 59 1 ? 17 HELX_P HELX_P2 AA2 LYS A 29 ? ASP A 31 ? LYS A 64 ASP A 66 5 ? 3 HELX_P HELX_P3 AA3 LYS A 69 ? GLN A 81 ? LYS A 104 GLN A 116 1 ? 13 HELX_P HELX_P4 AA4 VAL A 82 ? GLU A 85 ? VAL A 117 GLU A 120 5 ? 4 HELX_P HELX_P5 AA5 SER A 115 ? GLY A 124 ? SER A 150 GLY A 159 1 ? 10 HELX_P HELX_P6 AA6 PRO A 127 ? LYS A 148 ? PRO A 162 LYS A 183 1 ? 22 HELX_P HELX_P7 AA7 LYS A 157 ? SER A 159 ? LYS A 192 SER A 194 5 ? 3 HELX_P HELX_P8 AA8 GLY A 178 ? ALA A 185 ? GLY A 213 ALA A 220 1 ? 8 HELX_P HELX_P9 AA9 SER A 196 ? GLN A 201 ? SER A 231 GLN A 236 1 ? 6 HELX_P HELX_P10 AB1 SER A 206 ? GLY A 224 ? SER A 241 GLY A 259 1 ? 19 HELX_P HELX_P11 AB2 LYS A 234 ? PHE A 240 ? LYS A 269 PHE A 275 1 ? 7 HELX_P HELX_P12 AB3 ALA A 274 ? GLU A 285 ? ALA A 309 GLU A 320 1 ? 12 HELX_P HELX_P13 AB4 SER A 296 ? LEU A 307 ? SER A 331 LEU A 342 1 ? 12 HELX_P HELX_P14 AB5 ASP A 316 ? HIS A 323 ? ASP A 351 HIS A 358 1 ? 8 HELX_P HELX_P15 AB6 HIS A 323 ? ALA A 331 ? HIS A 358 ALA A 366 1 ? 9 HELX_P HELX_P16 AB7 ASP A 335 ? GLY A 345 ? ASP A 370 GLY A 380 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 31 OD1 ? ? ? 1_555 D MG . MG ? ? A ASP 66 A MG 403 1_555 ? ? ? ? ? ? ? 2.019 ? covale1 covale none ? A CYS 172 SG ? ? ? 1_555 B E62 . CAT ? ? A CYS 207 A E62 401 1_555 ? ? ? ? ? ? ? 1.711 ? metalc2 metalc ? ? A ASP 30 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 65 A MG 402 12_565 ? ? ? ? ? ? ? 2.441 ? metalc3 metalc ? ? A ASP 30 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 65 A MG 402 12_565 ? ? ? ? ? ? ? 1.932 ? metalc4 metalc ? ? A ASP 31 OD1 ? ? ? 1_555 D MG . MG ? ? A ASP 66 A MG 403 12_565 ? ? ? ? ? ? ? 2.121 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 228 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 263 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 229 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 264 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.78 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 33 ? GLU A 38 ? PHE A 68 GLU A 73 AA1 2 VAL A 46 ? HIS A 52 ? VAL A 81 HIS A 87 AA1 3 LEU A 57 ? HIS A 65 ? LEU A 92 HIS A 100 AA1 4 GLU A 103 ? MET A 108 ? GLU A 138 MET A 143 AA1 5 PHE A 94 ? SER A 100 ? PHE A 129 SER A 135 AA2 1 ILE A 161 ? VAL A 163 ? ILE A 196 VAL A 198 AA2 2 ILE A 169 ? LEU A 171 ? ILE A 204 LEU A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 34 ? N GLU A 69 O SER A 51 ? O SER A 86 AA1 2 3 N HIS A 52 ? N HIS A 87 O LEU A 57 ? O LEU A 92 AA1 3 4 N ALA A 60 ? N ALA A 95 O MET A 108 ? O MET A 143 AA1 4 5 O SER A 105 ? O SER A 140 N PHE A 98 ? N PHE A 133 AA2 1 2 N LEU A 162 ? N LEU A 197 O LYS A 170 ? O LYS A 205 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A E62 401 ? 13 'binding site for residue E62 A 401' AC2 Software A MG 402 ? 2 'binding site for residue MG A 402' AC3 Software A MG 403 ? 4 'binding site for residue MG A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 LEU A 39 ? LEU A 74 . ? 1_555 ? 2 AC1 13 ALA A 60 ? ALA A 95 . ? 1_555 ? 3 AC1 13 LYS A 62 ? LYS A 97 . ? 1_555 ? 4 AC1 13 MET A 108 ? MET A 143 . ? 1_555 ? 5 AC1 13 GLU A 109 ? GLU A 144 . ? 1_555 ? 6 AC1 13 HIS A 110 ? HIS A 145 . ? 1_555 ? 7 AC1 13 MET A 111 ? MET A 146 . ? 1_555 ? 8 AC1 13 GLY A 114 ? GLY A 149 . ? 1_555 ? 9 AC1 13 SER A 159 ? SER A 194 . ? 1_555 ? 10 AC1 13 ASN A 160 ? ASN A 195 . ? 1_555 ? 11 AC1 13 LEU A 162 ? LEU A 197 . ? 1_555 ? 12 AC1 13 CYS A 172 ? CYS A 207 . ? 1_555 ? 13 AC1 13 PHE A 174 ? PHE A 209 . ? 1_555 ? 14 AC2 2 ASP A 30 ? ASP A 65 . ? 12_565 ? 15 AC2 2 ASP A 31 ? ASP A 66 . ? 1_555 ? 16 AC3 4 ASP A 30 ? ASP A 65 . ? 1_555 ? 17 AC3 4 ASP A 30 ? ASP A 65 . ? 12_565 ? 18 AC3 4 ASP A 31 ? ASP A 66 . ? 1_555 ? 19 AC3 4 ASP A 31 ? ASP A 66 . ? 12_565 ? # _atom_sites.entry_id 5HZE _atom_sites.fract_transf_matrix[1][1] 0.012967 _atom_sites.fract_transf_matrix[1][2] 0.007487 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014973 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004503 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 36 ? ? ? A . n A 1 2 LEU 2 37 ? ? ? A . n A 1 3 GLU 3 38 ? ? ? A . n A 1 4 GLU 4 39 ? ? ? A . n A 1 5 LEU 5 40 ? ? ? A . n A 1 6 GLU 6 41 ? ? ? A . n A 1 7 LEU 7 42 ? ? ? A . n A 1 8 ASP 8 43 43 ASP ASP A . n A 1 9 GLU 9 44 44 GLU GLU A . n A 1 10 GLN 10 45 45 GLN GLN A . n A 1 11 GLN 11 46 46 GLN GLN A . n A 1 12 ARG 12 47 47 ARG ARG A . n A 1 13 LYS 13 48 48 LYS LYS A . n A 1 14 ARG 14 49 49 ARG ARG A . n A 1 15 LEU 15 50 50 LEU LEU A . n A 1 16 GLU 16 51 51 GLU GLU A . n A 1 17 ALA 17 52 52 ALA ALA A . n A 1 18 PHE 18 53 53 PHE PHE A . n A 1 19 LEU 19 54 54 LEU LEU A . n A 1 20 THR 20 55 55 THR THR A . n A 1 21 GLN 21 56 56 GLN GLN A . n A 1 22 LYS 22 57 57 LYS LYS A . n A 1 23 GLN 23 58 58 GLN GLN A . n A 1 24 LYS 24 59 59 LYS LYS A . n A 1 25 VAL 25 60 60 VAL VAL A . n A 1 26 GLY 26 61 61 GLY GLY A . n A 1 27 GLU 27 62 62 GLU GLU A . n A 1 28 LEU 28 63 63 LEU LEU A . n A 1 29 LYS 29 64 64 LYS LYS A . n A 1 30 ASP 30 65 65 ASP ASP A . n A 1 31 ASP 31 66 66 ASP ASP A . n A 1 32 ASP 32 67 67 ASP ASP A . n A 1 33 PHE 33 68 68 PHE PHE A . n A 1 34 GLU 34 69 69 GLU GLU A . n A 1 35 LYS 35 70 70 LYS LYS A . n A 1 36 ILE 36 71 71 ILE ILE A . n A 1 37 SER 37 72 72 SER SER A . n A 1 38 GLU 38 73 73 GLU GLU A . n A 1 39 LEU 39 74 74 LEU LEU A . n A 1 40 GLY 40 75 75 GLY GLY A . n A 1 41 ALA 41 76 76 ALA ALA A . n A 1 42 GLY 42 77 77 GLY GLY A . n A 1 43 ASN 43 78 78 ASN ASN A . n A 1 44 GLY 44 79 79 GLY GLY A . n A 1 45 GLY 45 80 80 GLY GLY A . n A 1 46 VAL 46 81 81 VAL VAL A . n A 1 47 VAL 47 82 82 VAL VAL A . n A 1 48 PHE 48 83 83 PHE PHE A . n A 1 49 LYS 49 84 84 LYS LYS A . n A 1 50 VAL 50 85 85 VAL VAL A . n A 1 51 SER 51 86 86 SER SER A . n A 1 52 HIS 52 87 87 HIS HIS A . n A 1 53 LYS 53 88 88 LYS LYS A . n A 1 54 PRO 54 89 89 PRO PRO A . n A 1 55 SER 55 90 90 SER SER A . n A 1 56 GLY 56 91 91 GLY GLY A . n A 1 57 LEU 57 92 92 LEU LEU A . n A 1 58 VAL 58 93 93 VAL VAL A . n A 1 59 MET 59 94 94 MET MET A . n A 1 60 ALA 60 95 95 ALA ALA A . n A 1 61 ARG 61 96 96 ARG ARG A . n A 1 62 LYS 62 97 97 LYS LYS A . n A 1 63 LEU 63 98 98 LEU LEU A . n A 1 64 ILE 64 99 99 ILE ILE A . n A 1 65 HIS 65 100 100 HIS HIS A . n A 1 66 LEU 66 101 101 LEU LEU A . n A 1 67 GLU 67 102 102 GLU GLU A . n A 1 68 ILE 68 103 103 ILE ILE A . n A 1 69 LYS 69 104 104 LYS LYS A . n A 1 70 PRO 70 105 105 PRO PRO A . n A 1 71 ALA 71 106 106 ALA ALA A . n A 1 72 ILE 72 107 107 ILE ILE A . n A 1 73 ARG 73 108 108 ARG ARG A . n A 1 74 ASN 74 109 109 ASN ASN A . n A 1 75 GLN 75 110 110 GLN GLN A . n A 1 76 ILE 76 111 111 ILE ILE A . n A 1 77 ILE 77 112 112 ILE ILE A . n A 1 78 ARG 78 113 113 ARG ARG A . n A 1 79 GLU 79 114 114 GLU GLU A . n A 1 80 LEU 80 115 115 LEU LEU A . n A 1 81 GLN 81 116 116 GLN GLN A . n A 1 82 VAL 82 117 117 VAL VAL A . n A 1 83 LEU 83 118 118 LEU LEU A . n A 1 84 HIS 84 119 119 HIS HIS A . n A 1 85 GLU 85 120 120 GLU GLU A . n A 1 86 CYS 86 121 121 CYS CYS A . n A 1 87 ASN 87 122 122 ASN ASN A . n A 1 88 SER 88 123 123 SER SER A . n A 1 89 PRO 89 124 124 PRO PRO A . n A 1 90 TYR 90 125 125 TYR TYR A . n A 1 91 ILE 91 126 126 ILE ILE A . n A 1 92 VAL 92 127 127 VAL VAL A . n A 1 93 GLY 93 128 128 GLY GLY A . n A 1 94 PHE 94 129 129 PHE PHE A . n A 1 95 TYR 95 130 130 TYR TYR A . n A 1 96 GLY 96 131 131 GLY GLY A . n A 1 97 ALA 97 132 132 ALA ALA A . n A 1 98 PHE 98 133 133 PHE PHE A . n A 1 99 TYR 99 134 134 TYR TYR A . n A 1 100 SER 100 135 135 SER SER A . n A 1 101 ASP 101 136 136 ASP ASP A . n A 1 102 GLY 102 137 137 GLY GLY A . n A 1 103 GLU 103 138 138 GLU GLU A . n A 1 104 ILE 104 139 139 ILE ILE A . n A 1 105 SER 105 140 140 SER SER A . n A 1 106 ILE 106 141 141 ILE ILE A . n A 1 107 CYS 107 142 142 CYS CYS A . n A 1 108 MET 108 143 143 MET MET A . n A 1 109 GLU 109 144 144 GLU GLU A . n A 1 110 HIS 110 145 145 HIS HIS A . n A 1 111 MET 111 146 146 MET MET A . n A 1 112 ASP 112 147 147 ASP ASP A . n A 1 113 GLY 113 148 148 GLY GLY A . n A 1 114 GLY 114 149 149 GLY GLY A . n A 1 115 SER 115 150 150 SER SER A . n A 1 116 LEU 116 151 151 LEU LEU A . n A 1 117 ASP 117 152 152 ASP ASP A . n A 1 118 GLN 118 153 153 GLN GLN A . n A 1 119 VAL 119 154 154 VAL VAL A . n A 1 120 LEU 120 155 155 LEU LEU A . n A 1 121 LYS 121 156 156 LYS LYS A . n A 1 122 LYS 122 157 157 LYS LYS A . n A 1 123 ALA 123 158 158 ALA ALA A . n A 1 124 GLY 124 159 159 GLY GLY A . n A 1 125 ARG 125 160 160 ARG ARG A . n A 1 126 ILE 126 161 161 ILE ILE A . n A 1 127 PRO 127 162 162 PRO PRO A . n A 1 128 GLU 128 163 163 GLU GLU A . n A 1 129 GLN 129 164 164 GLN GLN A . n A 1 130 ILE 130 165 165 ILE ILE A . n A 1 131 LEU 131 166 166 LEU LEU A . n A 1 132 GLY 132 167 167 GLY GLY A . n A 1 133 LYS 133 168 168 LYS LYS A . n A 1 134 VAL 134 169 169 VAL VAL A . n A 1 135 SER 135 170 170 SER SER A . n A 1 136 ILE 136 171 171 ILE ILE A . n A 1 137 ALA 137 172 172 ALA ALA A . n A 1 138 VAL 138 173 173 VAL VAL A . n A 1 139 ILE 139 174 174 ILE ILE A . n A 1 140 LYS 140 175 175 LYS LYS A . n A 1 141 GLY 141 176 176 GLY GLY A . n A 1 142 LEU 142 177 177 LEU LEU A . n A 1 143 THR 143 178 178 THR THR A . n A 1 144 TYR 144 179 179 TYR TYR A . n A 1 145 LEU 145 180 180 LEU LEU A . n A 1 146 ARG 146 181 181 ARG ARG A . n A 1 147 GLU 147 182 182 GLU GLU A . n A 1 148 LYS 148 183 183 LYS LYS A . n A 1 149 HIS 149 184 184 HIS HIS A . n A 1 150 LYS 150 185 ? ? ? A . n A 1 151 ILE 151 186 ? ? ? A . n A 1 152 MET 152 187 ? ? ? A . n A 1 153 HIS 153 188 ? ? ? A . n A 1 154 ARG 154 189 189 ARG ARG A . n A 1 155 ASP 155 190 190 ASP ASP A . n A 1 156 VAL 156 191 191 VAL VAL A . n A 1 157 LYS 157 192 192 LYS LYS A . n A 1 158 PRO 158 193 193 PRO PRO A . n A 1 159 SER 159 194 194 SER SER A . n A 1 160 ASN 160 195 195 ASN ASN A . n A 1 161 ILE 161 196 196 ILE ILE A . n A 1 162 LEU 162 197 197 LEU LEU A . n A 1 163 VAL 163 198 198 VAL VAL A . n A 1 164 ASN 164 199 199 ASN ASN A . n A 1 165 SER 165 200 200 SER SER A . n A 1 166 ARG 166 201 201 ARG ARG A . n A 1 167 GLY 167 202 202 GLY GLY A . n A 1 168 GLU 168 203 203 GLU GLU A . n A 1 169 ILE 169 204 204 ILE ILE A . n A 1 170 LYS 170 205 205 LYS LYS A . n A 1 171 LEU 171 206 206 LEU LEU A . n A 1 172 CYS 172 207 207 CYS CYS A . n A 1 173 ASP 173 208 208 ASP ASP A . n A 1 174 PHE 174 209 209 PHE PHE A . n A 1 175 GLY 175 210 210 GLY GLY A . n A 1 176 VAL 176 211 211 VAL VAL A . n A 1 177 SER 177 212 212 SER SER A . n A 1 178 GLY 178 213 213 GLY GLY A . n A 1 179 GLN 179 214 214 GLN GLN A . n A 1 180 LEU 180 215 215 LEU LEU A . n A 1 181 ILE 181 216 216 ILE ILE A . n A 1 182 ASP 182 217 217 ASP ASP A . n A 1 183 SER 183 218 218 SER SER A . n A 1 184 MET 184 219 219 MET MET A . n A 1 185 ALA 185 220 220 ALA ALA A . n A 1 186 ASN 186 221 221 ASN ASN A . n A 1 187 SER 187 222 222 SER SER A . n A 1 188 PHE 188 223 223 PHE PHE A . n A 1 189 VAL 189 224 224 VAL VAL A . n A 1 190 GLY 190 225 225 GLY GLY A . n A 1 191 THR 191 226 226 THR THR A . n A 1 192 ARG 192 227 227 ARG ARG A . n A 1 193 SER 193 228 228 SER SER A . n A 1 194 TYR 194 229 229 TYR TYR A . n A 1 195 MET 195 230 230 MET MET A . n A 1 196 SER 196 231 231 SER SER A . n A 1 197 PRO 197 232 232 PRO PRO A . n A 1 198 GLU 198 233 233 GLU GLU A . n A 1 199 ARG 199 234 234 ARG ARG A . n A 1 200 LEU 200 235 235 LEU LEU A . n A 1 201 GLN 201 236 236 GLN GLN A . n A 1 202 GLY 202 237 237 GLY GLY A . n A 1 203 THR 203 238 238 THR THR A . n A 1 204 HIS 204 239 239 HIS HIS A . n A 1 205 TYR 205 240 240 TYR TYR A . n A 1 206 SER 206 241 241 SER SER A . n A 1 207 VAL 207 242 242 VAL VAL A . n A 1 208 GLN 208 243 243 GLN GLN A . n A 1 209 SER 209 244 244 SER SER A . n A 1 210 ASP 210 245 245 ASP ASP A . n A 1 211 ILE 211 246 246 ILE ILE A . n A 1 212 TRP 212 247 247 TRP TRP A . n A 1 213 SER 213 248 248 SER SER A . n A 1 214 MET 214 249 249 MET MET A . n A 1 215 GLY 215 250 250 GLY GLY A . n A 1 216 LEU 216 251 251 LEU LEU A . n A 1 217 SER 217 252 252 SER SER A . n A 1 218 LEU 218 253 253 LEU LEU A . n A 1 219 VAL 219 254 254 VAL VAL A . n A 1 220 GLU 220 255 255 GLU GLU A . n A 1 221 MET 221 256 256 MET MET A . n A 1 222 ALA 222 257 257 ALA ALA A . n A 1 223 VAL 223 258 258 VAL VAL A . n A 1 224 GLY 224 259 259 GLY GLY A . n A 1 225 ARG 225 260 260 ARG ARG A . n A 1 226 TYR 226 261 261 TYR TYR A . n A 1 227 PRO 227 262 262 PRO PRO A . n A 1 228 ILE 228 263 263 ILE ILE A . n A 1 229 PRO 229 264 264 PRO PRO A . n A 1 230 PRO 230 265 265 PRO PRO A . n A 1 231 PRO 231 266 266 PRO PRO A . n A 1 232 ASP 232 267 267 ASP ASP A . n A 1 233 ALA 233 268 268 ALA ALA A . n A 1 234 LYS 234 269 269 LYS LYS A . n A 1 235 GLU 235 270 270 GLU GLU A . n A 1 236 LEU 236 271 271 LEU LEU A . n A 1 237 GLU 237 272 272 GLU GLU A . n A 1 238 LEU 238 273 273 LEU LEU A . n A 1 239 MET 239 274 274 MET MET A . n A 1 240 PHE 240 275 275 PHE PHE A . n A 1 241 GLY 241 276 ? ? ? A . n A 1 242 CYS 242 277 ? ? ? A . n A 1 243 GLN 243 278 ? ? ? A . n A 1 244 VAL 244 279 ? ? ? A . n A 1 245 GLU 245 280 ? ? ? A . n A 1 246 GLY 246 281 ? ? ? A . n A 1 247 ASP 247 282 ? ? ? A . n A 1 248 ALA 248 283 ? ? ? A . n A 1 249 ALA 249 284 ? ? ? A . n A 1 250 GLU 250 285 ? ? ? A . n A 1 251 THR 251 286 ? ? ? A . n A 1 252 PRO 252 287 ? ? ? A . n A 1 253 PRO 253 288 ? ? ? A . n A 1 254 ARG 254 289 ? ? ? A . n A 1 255 PRO 255 290 ? ? ? A . n A 1 256 ARG 256 291 ? ? ? A . n A 1 257 THR 257 292 ? ? ? A . n A 1 258 PRO 258 293 ? ? ? A . n A 1 259 GLY 259 294 ? ? ? A . n A 1 260 ARG 260 295 ? ? ? A . n A 1 261 PRO 261 296 ? ? ? A . n A 1 262 LEU 262 297 ? ? ? A . n A 1 263 ASN 263 298 ? ? ? A . n A 1 264 LYS 264 299 ? ? ? A . n A 1 265 PHE 265 300 ? ? ? A . n A 1 266 GLY 266 301 ? ? ? A . n A 1 267 MET 267 302 ? ? ? A . n A 1 268 ASP 268 303 ? ? ? A . n A 1 269 SER 269 304 ? ? ? A . n A 1 270 ARG 270 305 ? ? ? A . n A 1 271 PRO 271 306 ? ? ? A . n A 1 272 PRO 272 307 307 PRO PRO A . n A 1 273 MET 273 308 308 MET MET A . n A 1 274 ALA 274 309 309 ALA ALA A . n A 1 275 ILE 275 310 310 ILE ILE A . n A 1 276 PHE 276 311 311 PHE PHE A . n A 1 277 GLU 277 312 312 GLU GLU A . n A 1 278 LEU 278 313 313 LEU LEU A . n A 1 279 LEU 279 314 314 LEU LEU A . n A 1 280 ASP 280 315 315 ASP ASP A . n A 1 281 TYR 281 316 316 TYR TYR A . n A 1 282 ILE 282 317 317 ILE ILE A . n A 1 283 VAL 283 318 318 VAL VAL A . n A 1 284 ASN 284 319 319 ASN ASN A . n A 1 285 GLU 285 320 320 GLU GLU A . n A 1 286 PRO 286 321 321 PRO PRO A . n A 1 287 PRO 287 322 322 PRO PRO A . n A 1 288 PRO 288 323 323 PRO PRO A . n A 1 289 LYS 289 324 324 LYS LYS A . n A 1 290 LEU 290 325 325 LEU LEU A . n A 1 291 PRO 291 326 326 PRO PRO A . n A 1 292 SER 292 327 327 SER SER A . n A 1 293 GLY 293 328 328 GLY GLY A . n A 1 294 VAL 294 329 329 VAL VAL A . n A 1 295 PHE 295 330 330 PHE PHE A . n A 1 296 SER 296 331 331 SER SER A . n A 1 297 LEU 297 332 332 LEU LEU A . n A 1 298 GLU 298 333 333 GLU GLU A . n A 1 299 PHE 299 334 334 PHE PHE A . n A 1 300 GLN 300 335 335 GLN GLN A . n A 1 301 ASP 301 336 336 ASP ASP A . n A 1 302 PHE 302 337 337 PHE PHE A . n A 1 303 VAL 303 338 338 VAL VAL A . n A 1 304 ASN 304 339 339 ASN ASN A . n A 1 305 LYS 305 340 340 LYS LYS A . n A 1 306 CYS 306 341 341 CYS CYS A . n A 1 307 LEU 307 342 342 LEU LEU A . n A 1 308 ILE 308 343 343 ILE ILE A . n A 1 309 LYS 309 344 344 LYS LYS A . n A 1 310 ASN 310 345 345 ASN ASN A . n A 1 311 PRO 311 346 346 PRO PRO A . n A 1 312 ALA 312 347 347 ALA ALA A . n A 1 313 GLU 313 348 348 GLU GLU A . n A 1 314 ARG 314 349 349 ARG ARG A . n A 1 315 ALA 315 350 350 ALA ALA A . n A 1 316 ASP 316 351 351 ASP ASP A . n A 1 317 LEU 317 352 352 LEU LEU A . n A 1 318 LYS 318 353 353 LYS LYS A . n A 1 319 GLN 319 354 354 GLN GLN A . n A 1 320 LEU 320 355 355 LEU LEU A . n A 1 321 MET 321 356 356 MET MET A . n A 1 322 VAL 322 357 357 VAL VAL A . n A 1 323 HIS 323 358 358 HIS HIS A . n A 1 324 ALA 324 359 359 ALA ALA A . n A 1 325 PHE 325 360 360 PHE PHE A . n A 1 326 ILE 326 361 361 ILE ILE A . n A 1 327 LYS 327 362 362 LYS LYS A . n A 1 328 ARG 328 363 363 ARG ARG A . n A 1 329 SER 329 364 364 SER SER A . n A 1 330 ASP 330 365 365 ASP ASP A . n A 1 331 ALA 331 366 366 ALA ALA A . n A 1 332 GLU 332 367 367 GLU GLU A . n A 1 333 GLU 333 368 368 GLU GLU A . n A 1 334 VAL 334 369 369 VAL VAL A . n A 1 335 ASP 335 370 370 ASP ASP A . n A 1 336 PHE 336 371 371 PHE PHE A . n A 1 337 ALA 337 372 372 ALA ALA A . n A 1 338 GLY 338 373 373 GLY GLY A . n A 1 339 TRP 339 374 374 TRP TRP A . n A 1 340 LEU 340 375 375 LEU LEU A . n A 1 341 CYS 341 376 376 CYS CYS A . n A 1 342 SER 342 377 377 SER SER A . n A 1 343 THR 343 378 378 THR THR A . n A 1 344 ILE 344 379 379 ILE ILE A . n A 1 345 GLY 345 380 380 GLY GLY A . n A 1 346 LEU 346 381 381 LEU LEU A . n A 1 347 ASN 347 382 382 ASN ASN A . n A 1 348 GLN 348 383 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 E62 1 401 1 E62 DRG A . C 3 MG 1 402 1 MG MG A . D 3 MG 1 403 2 MG MG A . E 4 HOH 1 501 1 HOH HOH A . E 4 HOH 2 502 31 HOH HOH A . E 4 HOH 3 503 16 HOH HOH A . E 4 HOH 4 504 14 HOH HOH A . E 4 HOH 5 505 17 HOH HOH A . E 4 HOH 6 506 19 HOH HOH A . E 4 HOH 7 507 20 HOH HOH A . E 4 HOH 8 508 24 HOH HOH A . E 4 HOH 9 509 18 HOH HOH A . E 4 HOH 10 510 33 HOH HOH A . E 4 HOH 11 511 32 HOH HOH A . E 4 HOH 12 512 7 HOH HOH A . E 4 HOH 13 513 4 HOH HOH A . E 4 HOH 14 514 10 HOH HOH A . E 4 HOH 15 515 22 HOH HOH A . E 4 HOH 16 516 8 HOH HOH A . E 4 HOH 17 517 9 HOH HOH A . E 4 HOH 18 518 3 HOH HOH A . E 4 HOH 19 519 6 HOH HOH A . E 4 HOH 20 520 30 HOH HOH A . E 4 HOH 21 521 28 HOH HOH A . E 4 HOH 22 522 11 HOH HOH A . E 4 HOH 23 523 13 HOH HOH A . E 4 HOH 24 524 5 HOH HOH A . E 4 HOH 25 525 12 HOH HOH A . E 4 HOH 26 526 15 HOH HOH A . E 4 HOH 27 527 2 HOH HOH A . E 4 HOH 28 528 34 HOH HOH A . E 4 HOH 29 529 25 HOH HOH A . E 4 HOH 30 530 29 HOH HOH A . E 4 HOH 31 531 21 HOH HOH A . E 4 HOH 32 532 23 HOH HOH A . E 4 HOH 33 533 27 HOH HOH A . E 4 HOH 34 534 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 0.0 ? 2 OD1 ? A ASP 30 ? A ASP 65 ? 1_555 MG ? C MG . ? A MG 402 ? 12_565 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 59.1 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2017-05-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 66 ? ? MG A MG 402 ? ? 1.65 2 1 O A MET 219 ? ? OG A SER 222 ? ? 2.13 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 532 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 532 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 9_554 _pdbx_validate_symm_contact.dist 1.64 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 65 ? ? CG A ASP 65 ? ? OD1 A ASP 65 ? ? 124.26 118.30 5.96 0.90 N 2 1 N A SER 241 ? ? CA A SER 241 ? ? C A SER 241 ? ? 94.61 111.00 -16.39 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 78 ? ? 66.42 -157.52 2 1 HIS A 239 ? ? 96.04 167.20 3 1 ALA A 268 ? ? 168.99 -169.58 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 47 ? CG ? A ARG 12 CG 2 1 Y 1 A ARG 47 ? CD ? A ARG 12 CD 3 1 Y 1 A ARG 47 ? NE ? A ARG 12 NE 4 1 Y 1 A ARG 47 ? CZ ? A ARG 12 CZ 5 1 Y 1 A ARG 47 ? NH1 ? A ARG 12 NH1 6 1 Y 1 A ARG 47 ? NH2 ? A ARG 12 NH2 7 1 Y 1 A LYS 48 ? CG ? A LYS 13 CG 8 1 Y 1 A LYS 48 ? CD ? A LYS 13 CD 9 1 Y 1 A LYS 48 ? CE ? A LYS 13 CE 10 1 Y 1 A LYS 48 ? NZ ? A LYS 13 NZ 11 1 Y 1 A GLU 62 ? CG ? A GLU 27 CG 12 1 Y 1 A GLU 62 ? CD ? A GLU 27 CD 13 1 Y 1 A GLU 62 ? OE1 ? A GLU 27 OE1 14 1 Y 1 A GLU 62 ? OE2 ? A GLU 27 OE2 15 1 Y 1 A LYS 183 ? CG ? A LYS 148 CG 16 1 Y 1 A LYS 183 ? CD ? A LYS 148 CD 17 1 Y 1 A LYS 183 ? CE ? A LYS 148 CE 18 1 Y 1 A LYS 183 ? NZ ? A LYS 148 NZ 19 1 Y 1 A HIS 239 ? CG ? A HIS 204 CG 20 1 Y 1 A HIS 239 ? ND1 ? A HIS 204 ND1 21 1 Y 1 A HIS 239 ? CD2 ? A HIS 204 CD2 22 1 Y 1 A HIS 239 ? CE1 ? A HIS 204 CE1 23 1 Y 1 A HIS 239 ? NE2 ? A HIS 204 NE2 24 1 Y 1 A TYR 240 ? CG ? A TYR 205 CG 25 1 Y 1 A TYR 240 ? CD1 ? A TYR 205 CD1 26 1 Y 1 A TYR 240 ? CD2 ? A TYR 205 CD2 27 1 Y 1 A TYR 240 ? CE1 ? A TYR 205 CE1 28 1 Y 1 A TYR 240 ? CE2 ? A TYR 205 CE2 29 1 Y 1 A TYR 240 ? CZ ? A TYR 205 CZ 30 1 Y 1 A TYR 240 ? OH ? A TYR 205 OH 31 1 Y 1 A LYS 269 ? CG ? A LYS 234 CG 32 1 Y 1 A LYS 269 ? CD ? A LYS 234 CD 33 1 Y 1 A LYS 269 ? CE ? A LYS 234 CE 34 1 Y 1 A LYS 269 ? NZ ? A LYS 234 NZ 35 1 Y 1 A LYS 353 ? CG ? A LYS 318 CG 36 1 Y 1 A LYS 353 ? CD ? A LYS 318 CD 37 1 Y 1 A LYS 353 ? CE ? A LYS 318 CE 38 1 Y 1 A LYS 353 ? NZ ? A LYS 318 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 36 ? A GLY 1 2 1 Y 1 A LEU 37 ? A LEU 2 3 1 Y 1 A GLU 38 ? A GLU 3 4 1 Y 1 A GLU 39 ? A GLU 4 5 1 Y 1 A LEU 40 ? A LEU 5 6 1 Y 1 A GLU 41 ? A GLU 6 7 1 Y 1 A LEU 42 ? A LEU 7 8 1 Y 1 A LYS 185 ? A LYS 150 9 1 Y 1 A ILE 186 ? A ILE 151 10 1 Y 1 A MET 187 ? A MET 152 11 1 Y 1 A HIS 188 ? A HIS 153 12 1 Y 1 A GLY 276 ? A GLY 241 13 1 Y 1 A CYS 277 ? A CYS 242 14 1 Y 1 A GLN 278 ? A GLN 243 15 1 Y 1 A VAL 279 ? A VAL 244 16 1 Y 1 A GLU 280 ? A GLU 245 17 1 Y 1 A GLY 281 ? A GLY 246 18 1 Y 1 A ASP 282 ? A ASP 247 19 1 Y 1 A ALA 283 ? A ALA 248 20 1 Y 1 A ALA 284 ? A ALA 249 21 1 Y 1 A GLU 285 ? A GLU 250 22 1 Y 1 A THR 286 ? A THR 251 23 1 Y 1 A PRO 287 ? A PRO 252 24 1 Y 1 A PRO 288 ? A PRO 253 25 1 Y 1 A ARG 289 ? A ARG 254 26 1 Y 1 A PRO 290 ? A PRO 255 27 1 Y 1 A ARG 291 ? A ARG 256 28 1 Y 1 A THR 292 ? A THR 257 29 1 Y 1 A PRO 293 ? A PRO 258 30 1 Y 1 A GLY 294 ? A GLY 259 31 1 Y 1 A ARG 295 ? A ARG 260 32 1 Y 1 A PRO 296 ? A PRO 261 33 1 Y 1 A LEU 297 ? A LEU 262 34 1 Y 1 A ASN 298 ? A ASN 263 35 1 Y 1 A LYS 299 ? A LYS 264 36 1 Y 1 A PHE 300 ? A PHE 265 37 1 Y 1 A GLY 301 ? A GLY 266 38 1 Y 1 A MET 302 ? A MET 267 39 1 Y 1 A ASP 303 ? A ASP 268 40 1 Y 1 A SER 304 ? A SER 269 41 1 Y 1 A ARG 305 ? A ARG 270 42 1 Y 1 A PRO 306 ? A PRO 271 43 1 Y 1 A GLN 383 ? A GLN 348 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(3S,4R,8S,9S,11E)-8,9,16-trihydroxy-3,4-dimethyl-14-(methylamino)-3,4,5,6,9,10-hexahydro-1H-2-benzoxacyclotetradecine-1,7(8H)-dione' E62 3 'MAGNESIUM ION' MG 4 water HOH #