data_5I05 # _entry.id 5I05 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5I05 WWPDB D_1000215899 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Crystal structure of the orphan region of human endoglin/CD105' 5I04 unspecified PDB 'Crystal structure of the orphan region of human endoglin/CD105 in complex with BMP9' 5HZW unspecified PDB 'Crystal structure of the zona pellucida module of human endoglin/CD105' 5HZV unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5I05 _pdbx_database_status.recvd_initial_deposition_date 2016-02-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Saito, T.' 1 ? 'Bokhove, M.' 2 ? 'Jovine, L.' 3 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Cell Rep' ? ? 2211-1247 ? ? 19 ? 1917 1928 'Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.' 2017 ? 10.1016/j.celrep.2017.05.011 28564608 ? ? ? ? ? ? ? ? US ? ? 1 'J. Biol. Chem.' JBCHA3 0071 0021-9258 ? ? 280 ? 25111 25118 'Crystal structure of BMP-9 and functional interactions with pro-region and receptors.' 2005 ? 10.1074/jbc.M503328200 15851468 ? ? ? ? ? ? ? ? US ? ? 2 'Proc. Natl. Acad. Sci. U.S.A.' PNASA6 0040 1091-6490 ? ? 112 ? 3710 3715 'Structure of bone morphogenetic protein 9 procomplex.' 2015 ? 10.1073/pnas.1501303112 25751889 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Saito, T.' 1 primary 'Bokhove, M.' 2 primary 'Croci, R.' 3 primary 'Zamora-Caballero, S.' 4 primary 'Han, L.' 5 primary 'Letarte, M.' 6 primary 'de Sanctis, D.' 7 primary 'Jovine, L.' 8 1 'Brown, M.A.' 9 1 'Zhao, Q.' 10 1 'Baker, K.A.' 11 1 'Naik, C.' 12 1 'Chen, C.' 13 1 'Pukac, L.' 14 1 'Singh, M.' 15 1 'Tsareva, T.' 16 1 'Parice, Y.' 17 1 'Mahoney, A.' 18 1 'Roschke, V.' 19 1 'Sanyal, I.' 20 1 'Choe, S.' 21 2 'Mi, L.Z.' 22 2 'Brown, C.T.' 23 2 'Gao, Y.' 24 2 'Tian, Y.' 25 2 'Le, V.Q.' 26 2 'Walz, T.' 27 2 'Springer, T.A.' 28 # _cell.entry_id 5I05 _cell.length_a 71.060 _cell.length_b 71.060 _cell.length_c 145.670 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5I05 _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Growth/differentiation factor 2' 12102.971 1 ? ? 'UNP residues 320-429' 'Mature BMP9' 2 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 3 water nat water 18.015 52 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GDF-2,Bone morphogenetic protein 9,BMP-9' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS PISVLYKDDMGVPTLKYHYEGMSVAECGCR ; _entity_poly.pdbx_seq_one_letter_code_can ;SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS PISVLYKDDMGVPTLKYHYEGMSVAECGCR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 GLY n 1 4 ALA n 1 5 GLY n 1 6 SER n 1 7 HIS n 1 8 CYS n 1 9 GLN n 1 10 LYS n 1 11 THR n 1 12 SER n 1 13 LEU n 1 14 ARG n 1 15 VAL n 1 16 ASN n 1 17 PHE n 1 18 GLU n 1 19 ASP n 1 20 ILE n 1 21 GLY n 1 22 TRP n 1 23 ASP n 1 24 SER n 1 25 TRP n 1 26 ILE n 1 27 ILE n 1 28 ALA n 1 29 PRO n 1 30 LYS n 1 31 GLU n 1 32 TYR n 1 33 GLU n 1 34 ALA n 1 35 TYR n 1 36 GLU n 1 37 CYS n 1 38 LYS n 1 39 GLY n 1 40 GLY n 1 41 CYS n 1 42 PHE n 1 43 PHE n 1 44 PRO n 1 45 LEU n 1 46 ALA n 1 47 ASP n 1 48 ASP n 1 49 VAL n 1 50 THR n 1 51 PRO n 1 52 THR n 1 53 LYS n 1 54 HIS n 1 55 ALA n 1 56 ILE n 1 57 VAL n 1 58 GLN n 1 59 THR n 1 60 LEU n 1 61 VAL n 1 62 HIS n 1 63 LEU n 1 64 LYS n 1 65 PHE n 1 66 PRO n 1 67 THR n 1 68 LYS n 1 69 VAL n 1 70 GLY n 1 71 LYS n 1 72 ALA n 1 73 CYS n 1 74 CYS n 1 75 VAL n 1 76 PRO n 1 77 THR n 1 78 LYS n 1 79 LEU n 1 80 SER n 1 81 PRO n 1 82 ILE n 1 83 SER n 1 84 VAL n 1 85 LEU n 1 86 TYR n 1 87 LYS n 1 88 ASP n 1 89 ASP n 1 90 MET n 1 91 GLY n 1 92 VAL n 1 93 PRO n 1 94 THR n 1 95 LEU n 1 96 LYS n 1 97 TYR n 1 98 HIS n 1 99 TYR n 1 100 GLU n 1 101 GLY n 1 102 MET n 1 103 SER n 1 104 VAL n 1 105 ALA n 1 106 GLU n 1 107 CYS n 1 108 GLY n 1 109 CYS n 1 110 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 110 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GDF2, BMP9' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell Endothelial _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name Human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line HEK293S _entity_src_gen.pdbx_host_org_atcc CRL-3022 _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHLsec _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GDF2_HUMAN _struct_ref.pdbx_db_accession Q9UK05 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS PISVLYKDDMGVPTLKYHYEGMSVAECGCR ; _struct_ref.pdbx_align_begin 320 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5I05 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UK05 _struct_ref_seq.db_align_beg 320 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 429 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5I05 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.77 _exptl_crystal.description 'Rectangular Prism' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 3.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.0 M LiCl, 4% (v/v) PEG6000, 0.1 M NA-CITRATE' _exptl_crystal_grow.pdbx_pH_range 3.0-4.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si Single Crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5I05 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.87 _reflns.d_resolution_low 41.36 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15763 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.00 _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.95 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.87 _reflns_shell.d_res_low 1.92 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.39 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.79 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5I05 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 15756 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 41.360 _refine.ls_d_res_high 1.870 _refine.ls_percent_reflns_obs 99.40 _refine.ls_R_factor_obs 0.2155 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2135 _refine.ls_R_factor_R_free 0.2332 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.00 _refine.ls_number_reflns_R_free 1576 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.70 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 1KZK _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.23 _refine.pdbx_overall_phase_error 26.53 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 831 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 895 _refine_hist.d_res_high 1.870 _refine_hist.d_res_low 41.360 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.005 ? ? 874 'X-RAY DIFFRACTION' ? f_angle_d 0.734 ? ? 1186 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.726 ? ? 326 'X-RAY DIFFRACTION' ? f_chiral_restr 0.047 ? ? 128 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 148 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.8701 1.9305 1257 0.3572 100.00 0.3633 . . 139 . . . . 'X-RAY DIFFRACTION' . 1.9305 1.9995 1263 0.3343 100.00 0.3349 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.9995 2.0795 1264 0.2888 100.00 0.3201 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.0795 2.1742 1279 0.2539 100.00 0.2959 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.1742 2.2888 1282 0.2382 100.00 0.2957 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.2888 2.4322 1269 0.2165 99.00 0.2072 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.4322 2.6199 1287 0.2126 100.00 0.2655 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.6199 2.8835 1280 0.2092 100.00 0.2317 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.8835 3.3006 1304 0.2076 99.00 0.1929 . . 144 . . . . 'X-RAY DIFFRACTION' . 3.3006 4.1578 1320 0.1913 99.00 0.1982 . . 147 . . . . 'X-RAY DIFFRACTION' . 4.1578 41.3698 1375 0.1908 97.00 0.2256 . . 151 . . . . # _struct.entry_id 5I05 _struct.title 'Crystal structure of human BMP9 at 1.87 A resolution' _struct.pdbx_descriptor 'Growth/differentiation factor 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5I05 _struct_keywords.text 'GROWTH DIFFERENTIATION FACTOR 2, CELL PROLIFERATION SIGNAL, CYTOKINE, ANGIOGENESIS, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 46 ? THR A 50 ? ALA A 46 THR A 50 5 ? 5 HELX_P HELX_P2 AA2 THR A 52 ? PHE A 65 ? THR A 52 PHE A 65 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 74 SG ? ? A CYS 8 A CYS 74 1_555 ? ? ? ? ? ? ? 2.025 ? disulf2 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 107 SG ? ? A CYS 37 A CYS 107 1_555 ? ? ? ? ? ? ? 2.030 ? disulf3 disulf ? ? A CYS 41 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 41 A CYS 109 1_555 ? ? ? ? ? ? ? 2.033 ? disulf4 disulf ? ? A CYS 73 SG A ? ? 1_555 A CYS 73 SG A ? A CYS 73 A CYS 73 5_454 ? ? ? ? ? ? ? 2.031 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 28 A . ? ALA 28 A PRO 29 A ? PRO 29 A 1 -0.11 2 PHE 43 A . ? PHE 43 A PRO 44 A ? PRO 44 A 1 -0.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 9 ? THR A 11 ? GLN A 9 THR A 11 AA1 2 GLU A 36 ? LYS A 38 ? GLU A 36 LYS A 38 AA2 1 ARG A 14 ? ASN A 16 ? ARG A 14 ASN A 16 AA2 2 GLU A 31 ? GLU A 33 ? GLU A 31 GLU A 33 AA3 1 ILE A 26 ? ALA A 28 ? ILE A 26 ALA A 28 AA3 2 CYS A 74 ? LYS A 87 ? CYS A 74 LYS A 87 AA3 3 PRO A 93 ? CYS A 109 ? PRO A 93 CYS A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 11 ? N THR A 11 O GLU A 36 ? O GLU A 36 AA2 1 2 N VAL A 15 ? N VAL A 15 O TYR A 32 ? O TYR A 32 AA3 1 2 N ALA A 28 ? N ALA A 28 O LEU A 85 ? O LEU A 85 AA3 2 3 N ILE A 82 ? N ILE A 82 O TYR A 99 ? O TYR A 99 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 900 ? 6 'binding site for residue GOL A 900' AC2 Software A GOL 901 ? 3 'binding site for residue GOL A 901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 PRO A 81 ? PRO A 81 . ? 10_555 ? 2 AC1 6 ILE A 82 ? ILE A 82 . ? 10_555 ? 3 AC1 6 SER A 83 ? SER A 83 . ? 1_555 ? 4 AC1 6 SER A 83 ? SER A 83 . ? 10_555 ? 5 AC1 6 TYR A 97 ? TYR A 97 . ? 10_555 ? 6 AC1 6 HIS A 98 ? HIS A 98 . ? 10_555 ? 7 AC2 3 ALA A 4 ? ALA A 4 . ? 1_555 ? 8 AC2 3 GLY A 5 ? GLY A 5 . ? 1_555 ? 9 AC2 3 HIS A 7 ? HIS A 7 . ? 1_555 ? # _atom_sites.entry_id 5I05 _atom_sites.fract_transf_matrix[1][1] 0.014073 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014073 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006865 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 ARG 110 110 110 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 900 900 GOL GOL A . C 2 GOL 1 901 901 GOL GOL A . D 3 HOH 1 1001 23 HOH HOH A . D 3 HOH 2 1002 43 HOH HOH A . D 3 HOH 3 1003 1 HOH HOH A . D 3 HOH 4 1004 14 HOH HOH A . D 3 HOH 5 1005 6 HOH HOH A . D 3 HOH 6 1006 27 HOH HOH A . D 3 HOH 7 1007 20 HOH HOH A . D 3 HOH 8 1008 4 HOH HOH A . D 3 HOH 9 1009 22 HOH HOH A . D 3 HOH 10 1010 36 HOH HOH A . D 3 HOH 11 1011 9 HOH HOH A . D 3 HOH 12 1012 28 HOH HOH A . D 3 HOH 13 1013 21 HOH HOH A . D 3 HOH 14 1014 13 HOH HOH A . D 3 HOH 15 1015 10 HOH HOH A . D 3 HOH 16 1016 49 HOH HOH A . D 3 HOH 17 1017 25 HOH HOH A . D 3 HOH 18 1018 8 HOH HOH A . D 3 HOH 19 1019 31 HOH HOH A . D 3 HOH 20 1020 2 HOH HOH A . D 3 HOH 21 1021 26 HOH HOH A . D 3 HOH 22 1022 7 HOH HOH A . D 3 HOH 23 1023 5 HOH HOH A . D 3 HOH 24 1024 15 HOH HOH A . D 3 HOH 25 1025 32 HOH HOH A . D 3 HOH 26 1026 3 HOH HOH A . D 3 HOH 27 1027 38 HOH HOH A . D 3 HOH 28 1028 48 HOH HOH A . D 3 HOH 29 1029 30 HOH HOH A . D 3 HOH 30 1030 35 HOH HOH A . D 3 HOH 31 1031 37 HOH HOH A . D 3 HOH 32 1032 51 HOH HOH A . D 3 HOH 33 1033 33 HOH HOH A . D 3 HOH 34 1034 24 HOH HOH A . D 3 HOH 35 1035 18 HOH HOH A . D 3 HOH 36 1036 46 HOH HOH A . D 3 HOH 37 1037 19 HOH HOH A . D 3 HOH 38 1038 45 HOH HOH A . D 3 HOH 39 1039 40 HOH HOH A . D 3 HOH 40 1040 39 HOH HOH A . D 3 HOH 41 1041 47 HOH HOH A . D 3 HOH 42 1042 42 HOH HOH A . D 3 HOH 43 1043 50 HOH HOH A . D 3 HOH 44 1044 44 HOH HOH A . D 3 HOH 45 1045 41 HOH HOH A . D 3 HOH 46 1046 11 HOH HOH A . D 3 HOH 47 1047 52 HOH HOH A . D 3 HOH 48 1048 34 HOH HOH A . D 3 HOH 49 1049 17 HOH HOH A . D 3 HOH 50 1050 16 HOH HOH A . D 3 HOH 51 1051 29 HOH HOH A . D 3 HOH 52 1052 12 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3360 ? 1 MORE -26 ? 1 'SSA (A^2)' 11790 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_454 -x-1/2,y,-z-1/4 -1.0000000000 0.0000000000 0.0000000000 -35.5300000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -36.4175000000 # _pdbx_point_symmetry.entry_id 5I05 _pdbx_point_symmetry.Schoenflies_symbol C _pdbx_point_symmetry.circular_symmetry 2 _pdbx_point_symmetry.H-M_notation ? # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 1047 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-07 2 'Structure model' 1 1 2017-06-14 3 'Structure model' 1 2 2017-09-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_DOI' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_pdbx_audit_support.funding_organization' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -10.6333 _pdbx_refine_tls.origin_y -10.9840 _pdbx_refine_tls.origin_z -23.2336 _pdbx_refine_tls.T[1][1] 0.3300 _pdbx_refine_tls.T[2][2] 0.2932 _pdbx_refine_tls.T[3][3] 0.3098 _pdbx_refine_tls.T[1][2] -0.0651 _pdbx_refine_tls.T[1][3] -0.0389 _pdbx_refine_tls.T[2][3] -0.0134 _pdbx_refine_tls.L[1][1] 3.2836 _pdbx_refine_tls.L[2][2] 0.8659 _pdbx_refine_tls.L[3][3] 1.4834 _pdbx_refine_tls.L[1][2] 0.9207 _pdbx_refine_tls.L[1][3] -1.2534 _pdbx_refine_tls.L[2][3] 0.0352 _pdbx_refine_tls.S[1][1] -0.3516 _pdbx_refine_tls.S[1][2] -0.0036 _pdbx_refine_tls.S[1][3] 0.0002 _pdbx_refine_tls.S[2][1] -0.2575 _pdbx_refine_tls.S[2][2] 0.2491 _pdbx_refine_tls.S[2][3] -0.0565 _pdbx_refine_tls.S[3][1] 0.0250 _pdbx_refine_tls.S[3][2] 0.3822 _pdbx_refine_tls.S[3][3] 0.0100 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details 'chain A and (not resi 900:901)' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? '(November 3, 2014)' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? '(November 3, 2014 BUILT=20141103)' 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? '(2.56)' 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id TYR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 35 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 50.61 _pdbx_validate_torsion.psi -163.14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLY 3 ? A GLY 3 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Karolinska Institutet' Sweden ? 1 'Center for Biosciences' Sweden ? 2 'Swedish Research Council' Sweden 2012-5093 3 'Gustafsson Foundation for Research in Natural Sciences and Medicine' Sweden ? 4 'Sven and Ebba-Christina Hagberg foundation' Sweden ? 5 'European Molecular Biology Organization' ? ? 6 'European Union' ? 'ERC 260759' 7 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH #