data_5I10 # _entry.id 5I10 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5I10 pdb_00005i10 10.2210/pdb5i10/pdb WWPDB D_1000218075 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5I10 _pdbx_database_status.recvd_initial_deposition_date 2016-02-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lin, Y.-C.' 1 'Huang, S.-P.' 2 'Huang, B.-L.' 3 'Chen, Y.-H.' 4 'Chen, Y.-J.' 5 'Chiu, H.-T.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of spinosyn rhamnosyl 4'-O-methyltransferase spnh mutant T242Q from Saccharopolyspora Spinosa ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lin, Y.-C.' 1 ? primary 'Huang, S.-P.' 2 ? primary 'Huang, B.-L.' 3 ? primary 'Chen, Y.-H.' 4 ? primary 'Chen, Y.-J.' 5 ? primary 'Chiu, H.-T.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5I10 _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.776 _cell.length_a_esd ? _cell.length_b 54.776 _cell.length_b_esd ? _cell.length_c 306.532 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5I10 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable O-methyltransferase' 28108.504 1 ? T242Q ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 water nat water 18.015 97 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPSQNALYLDLLKKVLTNTIYSDRPHPNAWQDNTDYRQAARAKGTDWPTVAHTMIGLERLDNLQHCVEAVLADGVPGDFA ETGVWRGGACIFMRAVLQAFGDTGRTVWVVDSFQGMPESSAQDHQADQAMALHEYNDVLGVSLETVRQNFARYGLLDEQV RFLPGWFRDTLPTAPIQELAVLRLDGDLYESTMDSLRNLYPKLSPGGFVIIDDYFLPSCQDAVKGFRAELGITEPIHDID GQGAYWRRSW ; _entity_poly.pdbx_seq_one_letter_code_can ;MPSQNALYLDLLKKVLTNTIYSDRPHPNAWQDNTDYRQAARAKGTDWPTVAHTMIGLERLDNLQHCVEAVLADGVPGDFA ETGVWRGGACIFMRAVLQAFGDTGRTVWVVDSFQGMPESSAQDHQADQAMALHEYNDVLGVSLETVRQNFARYGLLDEQV RFLPGWFRDTLPTAPIQELAVLRLDGDLYESTMDSLRNLYPKLSPGGFVIIDDYFLPSCQDAVKGFRAELGITEPIHDID GQGAYWRRSW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 SER n 1 4 GLN n 1 5 ASN n 1 6 ALA n 1 7 LEU n 1 8 TYR n 1 9 LEU n 1 10 ASP n 1 11 LEU n 1 12 LEU n 1 13 LYS n 1 14 LYS n 1 15 VAL n 1 16 LEU n 1 17 THR n 1 18 ASN n 1 19 THR n 1 20 ILE n 1 21 TYR n 1 22 SER n 1 23 ASP n 1 24 ARG n 1 25 PRO n 1 26 HIS n 1 27 PRO n 1 28 ASN n 1 29 ALA n 1 30 TRP n 1 31 GLN n 1 32 ASP n 1 33 ASN n 1 34 THR n 1 35 ASP n 1 36 TYR n 1 37 ARG n 1 38 GLN n 1 39 ALA n 1 40 ALA n 1 41 ARG n 1 42 ALA n 1 43 LYS n 1 44 GLY n 1 45 THR n 1 46 ASP n 1 47 TRP n 1 48 PRO n 1 49 THR n 1 50 VAL n 1 51 ALA n 1 52 HIS n 1 53 THR n 1 54 MET n 1 55 ILE n 1 56 GLY n 1 57 LEU n 1 58 GLU n 1 59 ARG n 1 60 LEU n 1 61 ASP n 1 62 ASN n 1 63 LEU n 1 64 GLN n 1 65 HIS n 1 66 CYS n 1 67 VAL n 1 68 GLU n 1 69 ALA n 1 70 VAL n 1 71 LEU n 1 72 ALA n 1 73 ASP n 1 74 GLY n 1 75 VAL n 1 76 PRO n 1 77 GLY n 1 78 ASP n 1 79 PHE n 1 80 ALA n 1 81 GLU n 1 82 THR n 1 83 GLY n 1 84 VAL n 1 85 TRP n 1 86 ARG n 1 87 GLY n 1 88 GLY n 1 89 ALA n 1 90 CYS n 1 91 ILE n 1 92 PHE n 1 93 MET n 1 94 ARG n 1 95 ALA n 1 96 VAL n 1 97 LEU n 1 98 GLN n 1 99 ALA n 1 100 PHE n 1 101 GLY n 1 102 ASP n 1 103 THR n 1 104 GLY n 1 105 ARG n 1 106 THR n 1 107 VAL n 1 108 TRP n 1 109 VAL n 1 110 VAL n 1 111 ASP n 1 112 SER n 1 113 PHE n 1 114 GLN n 1 115 GLY n 1 116 MET n 1 117 PRO n 1 118 GLU n 1 119 SER n 1 120 SER n 1 121 ALA n 1 122 GLN n 1 123 ASP n 1 124 HIS n 1 125 GLN n 1 126 ALA n 1 127 ASP n 1 128 GLN n 1 129 ALA n 1 130 MET n 1 131 ALA n 1 132 LEU n 1 133 HIS n 1 134 GLU n 1 135 TYR n 1 136 ASN n 1 137 ASP n 1 138 VAL n 1 139 LEU n 1 140 GLY n 1 141 VAL n 1 142 SER n 1 143 LEU n 1 144 GLU n 1 145 THR n 1 146 VAL n 1 147 ARG n 1 148 GLN n 1 149 ASN n 1 150 PHE n 1 151 ALA n 1 152 ARG n 1 153 TYR n 1 154 GLY n 1 155 LEU n 1 156 LEU n 1 157 ASP n 1 158 GLU n 1 159 GLN n 1 160 VAL n 1 161 ARG n 1 162 PHE n 1 163 LEU n 1 164 PRO n 1 165 GLY n 1 166 TRP n 1 167 PHE n 1 168 ARG n 1 169 ASP n 1 170 THR n 1 171 LEU n 1 172 PRO n 1 173 THR n 1 174 ALA n 1 175 PRO n 1 176 ILE n 1 177 GLN n 1 178 GLU n 1 179 LEU n 1 180 ALA n 1 181 VAL n 1 182 LEU n 1 183 ARG n 1 184 LEU n 1 185 ASP n 1 186 GLY n 1 187 ASP n 1 188 LEU n 1 189 TYR n 1 190 GLU n 1 191 SER n 1 192 THR n 1 193 MET n 1 194 ASP n 1 195 SER n 1 196 LEU n 1 197 ARG n 1 198 ASN n 1 199 LEU n 1 200 TYR n 1 201 PRO n 1 202 LYS n 1 203 LEU n 1 204 SER n 1 205 PRO n 1 206 GLY n 1 207 GLY n 1 208 PHE n 1 209 VAL n 1 210 ILE n 1 211 ILE n 1 212 ASP n 1 213 ASP n 1 214 TYR n 1 215 PHE n 1 216 LEU n 1 217 PRO n 1 218 SER n 1 219 CYS n 1 220 GLN n 1 221 ASP n 1 222 ALA n 1 223 VAL n 1 224 LYS n 1 225 GLY n 1 226 PHE n 1 227 ARG n 1 228 ALA n 1 229 GLU n 1 230 LEU n 1 231 GLY n 1 232 ILE n 1 233 THR n 1 234 GLU n 1 235 PRO n 1 236 ILE n 1 237 HIS n 1 238 ASP n 1 239 ILE n 1 240 ASP n 1 241 GLY n 1 242 GLN n 1 243 GLY n 1 244 ALA n 1 245 TYR n 1 246 TRP n 1 247 ARG n 1 248 ARG n 1 249 SER n 1 250 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 250 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene spnH _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharopolyspora spinosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 60894 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-21B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9ALM9_9PSEU _struct_ref.pdbx_db_accession Q9ALM9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPSQNALYLDLLKKVLTNTIYSDRPHPNAWQDNTDYRQAARAKGTDWPTVAHTMIGLERLDNLQHCVEAVLADGVPGDFA ETGVWRGGACIFMRAVLQAFGDTGRTVWVVDSFQGMPESSAQDHQADQAMALHEYNDVLGVSLETVRQNFARYGLLDEQV RFLPGWFRDTLPTAPIQELAVLRLDGDLYESTMDSLRNLYPKLSPGGFVIIDDYFLPSCQDAVKGFRAELGITEPIHDID GTGAYWRRSW ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5I10 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 250 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ALM9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 250 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 250 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5I10 _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 242 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9ALM9 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 242 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 242 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5I10 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.9 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '18-24% (w/v) polyethylene glycol 3350, 100mM Tris, pH 7-9, 200mM magnesium chloride and 2.3mM SRPG' _exptl_crystal_grow.pdbx_pH_range 7-9 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'RH COATED MIRROWS' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'LN2-COOLED, FIXED-EXIT DOUBLE CRYSTAL MONOCHROMATOR' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate 34.20 _reflns.entry_id 5I10 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2 _reflns.d_resolution_low 27.6 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26486 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 1 _reflns.percent_possible_obs 99.45 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 38.4 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 39.04 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.06 _reflns_shell.d_res_low 2.15 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.23 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 94.52 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.88 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 35.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 46.10 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5I10 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.000 _refine.ls_d_res_low 27.6 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18526 _refine.ls_number_reflns_R_free 1396 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.22 _refine.ls_percent_reflns_R_free 7.54 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2297 _refine.ls_R_factor_R_free 0.2637 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2269 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4CDZ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.31 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.28 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1524 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 1622 _refine_hist.d_res_high 2.000 _refine_hist.d_res_low 27.6 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 1560 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.933 ? 2119 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.666 ? 558 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 233 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 273 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0000 2.0715 . . 127 1528 87.00 . . . 0.4300 . 0.3476 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0715 2.1544 . . 130 1647 94.00 . . . 0.3635 . 0.3024 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1544 2.2524 . . 113 1439 82.00 . . . 0.4842 . 0.3964 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2524 2.3711 . . 121 1468 82.00 . . . 0.4852 . 0.3588 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3711 2.5196 . . 144 1723 98.00 . . . 0.3011 . 0.2661 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5196 2.7140 . . 146 1797 100.00 . . . 0.2715 . 0.2489 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7140 2.9868 . . 147 1786 99.00 . . . 0.2737 . 0.2471 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9868 3.4183 . . 150 1844 100.00 . . . 0.2804 . 0.2393 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4183 4.3041 . . 153 1862 100.00 . . . 0.2234 . 0.1921 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3041 27.6692 . . 165 2036 100.00 . . . 0.2102 . 0.1836 . . . . . . . . . . # _struct.entry_id 5I10 _struct.title ;Crystal structure of spinosyn rhamnosyl 4'-O-methyltransferase spnh mutant T242Q from Saccharopolyspora Spinosa ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5I10 _struct_keywords.text TRANSFERASE _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 5 ? THR A 17 ? ASN A 5 THR A 17 1 ? 13 HELX_P HELX_P2 AA2 ILE A 55 ? ASP A 73 ? ILE A 55 ASP A 73 1 ? 19 HELX_P HELX_P3 AA3 GLY A 87 ? GLY A 101 ? GLY A 87 GLY A 101 1 ? 15 HELX_P HELX_P4 AA4 LEU A 143 ? TYR A 153 ? LEU A 143 TYR A 153 1 ? 11 HELX_P HELX_P5 AA5 TRP A 166 ? LEU A 171 ? TRP A 166 LEU A 171 1 ? 6 HELX_P HELX_P6 AA6 PRO A 172 ? ALA A 174 ? PRO A 172 ALA A 174 5 ? 3 HELX_P HELX_P7 AA7 LEU A 188 ? TYR A 200 ? LEU A 188 TYR A 200 1 ? 13 HELX_P HELX_P8 AA8 LEU A 216 ? GLY A 231 ? LEU A 216 GLY A 231 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 185 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 185 A MG 301 1_555 ? ? ? ? ? ? ? 2.629 ? ? metalc2 metalc ? ? A ASP 212 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 212 A MG 301 1_555 ? ? ? ? ? ? ? 2.462 ? ? metalc3 metalc ? ? A ASP 213 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 213 A MG 301 1_555 ? ? ? ? ? ? ? 2.553 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 409 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 420 1_555 ? ? ? ? ? ? ? 2.378 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 434 1_555 ? ? ? ? ? ? ? 2.215 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 160 ? PRO A 164 ? VAL A 160 PRO A 164 AA1 2 VAL A 107 ? ASP A 111 ? VAL A 107 ASP A 111 AA1 3 ASP A 78 ? THR A 82 ? ASP A 78 THR A 82 AA1 4 LEU A 179 ? LEU A 184 ? LEU A 179 LEU A 184 AA1 5 LEU A 203 ? ILE A 211 ? LEU A 203 ILE A 211 AA1 6 ALA A 244 ? ARG A 247 ? ALA A 244 ARG A 247 AA1 7 HIS A 237 ? ASP A 238 ? HIS A 237 ASP A 238 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 161 ? O ARG A 161 N VAL A 109 ? N VAL A 109 AA1 2 3 O TRP A 108 ? O TRP A 108 N PHE A 79 ? N PHE A 79 AA1 3 4 N ASP A 78 ? N ASP A 78 O ALA A 180 ? O ALA A 180 AA1 4 5 N LEU A 179 ? N LEU A 179 O SER A 204 ? O SER A 204 AA1 5 6 N ILE A 211 ? N ILE A 211 O ALA A 244 ? O ALA A 244 AA1 6 7 O TYR A 245 ? O TYR A 245 N HIS A 237 ? N HIS A 237 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MG _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue MG A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 185 ? ASP A 185 . ? 1_555 ? 2 AC1 6 ASP A 212 ? ASP A 212 . ? 1_555 ? 3 AC1 6 ASP A 213 ? ASP A 213 . ? 1_555 ? 4 AC1 6 HOH C . ? HOH A 409 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 420 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 434 . ? 1_555 ? # _atom_sites.entry_id 5I10 _atom_sites.fract_transf_matrix[1][1] 0.018256 _atom_sites.fract_transf_matrix[1][2] 0.010540 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021080 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003262 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 SER 22 22 ? ? ? A . n A 1 23 ASP 23 23 ? ? ? A . n A 1 24 ARG 24 24 ? ? ? A . n A 1 25 PRO 25 25 ? ? ? A . n A 1 26 HIS 26 26 ? ? ? A . n A 1 27 PRO 27 27 ? ? ? A . n A 1 28 ASN 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 TRP 30 30 ? ? ? A . n A 1 31 GLN 31 31 ? ? ? A . n A 1 32 ASP 32 32 ? ? ? A . n A 1 33 ASN 33 33 ? ? ? A . n A 1 34 THR 34 34 ? ? ? A . n A 1 35 ASP 35 35 ? ? ? A . n A 1 36 TYR 36 36 ? ? ? A . n A 1 37 ARG 37 37 ? ? ? A . n A 1 38 GLN 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 ALA 40 40 ? ? ? A . n A 1 41 ARG 41 41 ? ? ? A . n A 1 42 ALA 42 42 ? ? ? A . n A 1 43 LYS 43 43 ? ? ? A . n A 1 44 GLY 44 44 ? ? ? A . n A 1 45 THR 45 45 ? ? ? A . n A 1 46 ASP 46 46 ? ? ? A . n A 1 47 TRP 47 47 ? ? ? A . n A 1 48 PRO 48 48 ? ? ? A . n A 1 49 THR 49 49 ? ? ? A . n A 1 50 VAL 50 50 ? ? ? A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 GLN 114 114 ? ? ? A . n A 1 115 GLY 115 115 ? ? ? A . n A 1 116 MET 116 116 ? ? ? A . n A 1 117 PRO 117 117 ? ? ? A . n A 1 118 GLU 118 118 ? ? ? A . n A 1 119 SER 119 119 ? ? ? A . n A 1 120 SER 120 120 ? ? ? A . n A 1 121 ALA 121 121 ? ? ? A . n A 1 122 GLN 122 122 ? ? ? A . n A 1 123 ASP 123 123 ? ? ? A . n A 1 124 HIS 124 124 ? ? ? A . n A 1 125 GLN 125 125 ? ? ? A . n A 1 126 ALA 126 126 ? ? ? A . n A 1 127 ASP 127 127 ? ? ? A . n A 1 128 GLN 128 128 ? ? ? A . n A 1 129 ALA 129 129 ? ? ? A . n A 1 130 MET 130 130 ? ? ? A . n A 1 131 ALA 131 131 ? ? ? A . n A 1 132 LEU 132 132 ? ? ? A . n A 1 133 HIS 133 133 ? ? ? A . n A 1 134 GLU 134 134 ? ? ? A . n A 1 135 TYR 135 135 ? ? ? A . n A 1 136 ASN 136 136 ? ? ? A . n A 1 137 ASP 137 137 ? ? ? A . n A 1 138 VAL 138 138 ? ? ? A . n A 1 139 LEU 139 139 ? ? ? A . n A 1 140 GLY 140 140 ? ? ? A . n A 1 141 VAL 141 141 ? ? ? A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 TRP 166 166 166 TRP TRP A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 MET 193 193 193 MET MET A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 ARG 197 197 197 ARG ARG A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 CYS 219 219 219 CYS CYS A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 THR 233 233 233 THR THR A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 HIS 237 237 237 HIS HIS A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 TYR 245 245 245 TYR TYR A . n A 1 246 TRP 246 246 246 TRP TRP A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 ARG 248 248 248 ARG ARG A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 TRP 250 250 250 TRP TRP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 1 MG MG A . C 3 HOH 1 401 37 HOH HOH A . C 3 HOH 2 402 11 HOH HOH A . C 3 HOH 3 403 40 HOH HOH A . C 3 HOH 4 404 42 HOH HOH A . C 3 HOH 5 405 66 HOH HOH A . C 3 HOH 6 406 2 HOH HOH A . C 3 HOH 7 407 21 HOH HOH A . C 3 HOH 8 408 8 HOH HOH A . C 3 HOH 9 409 53 HOH HOH A . C 3 HOH 10 410 43 HOH HOH A . C 3 HOH 11 411 25 HOH HOH A . C 3 HOH 12 412 4 HOH HOH A . C 3 HOH 13 413 46 HOH HOH A . C 3 HOH 14 414 71 HOH HOH A . C 3 HOH 15 415 36 HOH HOH A . C 3 HOH 16 416 76 HOH HOH A . C 3 HOH 17 417 88 HOH HOH A . C 3 HOH 18 418 73 HOH HOH A . C 3 HOH 19 419 81 HOH HOH A . C 3 HOH 20 420 56 HOH HOH A . C 3 HOH 21 421 24 HOH HOH A . C 3 HOH 22 422 60 HOH HOH A . C 3 HOH 23 423 86 HOH HOH A . C 3 HOH 24 424 64 HOH HOH A . C 3 HOH 25 425 30 HOH HOH A . C 3 HOH 26 426 63 HOH HOH A . C 3 HOH 27 427 3 HOH HOH A . C 3 HOH 28 428 1 HOH HOH A . C 3 HOH 29 429 69 HOH HOH A . C 3 HOH 30 430 12 HOH HOH A . C 3 HOH 31 431 35 HOH HOH A . C 3 HOH 32 432 14 HOH HOH A . C 3 HOH 33 433 6 HOH HOH A . C 3 HOH 34 434 58 HOH HOH A . C 3 HOH 35 435 51 HOH HOH A . C 3 HOH 36 436 59 HOH HOH A . C 3 HOH 37 437 27 HOH HOH A . C 3 HOH 38 438 38 HOH HOH A . C 3 HOH 39 439 18 HOH HOH A . C 3 HOH 40 440 32 HOH HOH A . C 3 HOH 41 441 79 HOH HOH A . C 3 HOH 42 442 34 HOH HOH A . C 3 HOH 43 443 77 HOH HOH A . C 3 HOH 44 444 92 HOH HOH A . C 3 HOH 45 445 7 HOH HOH A . C 3 HOH 46 446 62 HOH HOH A . C 3 HOH 47 447 57 HOH HOH A . C 3 HOH 48 448 17 HOH HOH A . C 3 HOH 49 449 52 HOH HOH A . C 3 HOH 50 450 55 HOH HOH A . C 3 HOH 51 451 54 HOH HOH A . C 3 HOH 52 452 61 HOH HOH A . C 3 HOH 53 453 15 HOH HOH A . C 3 HOH 54 454 26 HOH HOH A . C 3 HOH 55 455 31 HOH HOH A . C 3 HOH 56 456 84 HOH HOH A . C 3 HOH 57 457 28 HOH HOH A . C 3 HOH 58 458 29 HOH HOH A . C 3 HOH 59 459 9 HOH HOH A . C 3 HOH 60 460 39 HOH HOH A . C 3 HOH 61 461 50 HOH HOH A . C 3 HOH 62 462 72 HOH HOH A . C 3 HOH 63 463 13 HOH HOH A . C 3 HOH 64 464 10 HOH HOH A . C 3 HOH 65 465 89 HOH HOH A . C 3 HOH 66 466 33 HOH HOH A . C 3 HOH 67 467 16 HOH HOH A . C 3 HOH 68 468 49 HOH HOH A . C 3 HOH 69 469 44 HOH HOH A . C 3 HOH 70 470 41 HOH HOH A . C 3 HOH 71 471 5 HOH HOH A . C 3 HOH 72 472 20 HOH HOH A . C 3 HOH 73 473 96 HOH HOH A . C 3 HOH 74 474 80 HOH HOH A . C 3 HOH 75 475 47 HOH HOH A . C 3 HOH 76 476 22 HOH HOH A . C 3 HOH 77 477 87 HOH HOH A . C 3 HOH 78 478 74 HOH HOH A . C 3 HOH 79 479 67 HOH HOH A . C 3 HOH 80 480 82 HOH HOH A . C 3 HOH 81 481 68 HOH HOH A . C 3 HOH 82 482 83 HOH HOH A . C 3 HOH 83 483 65 HOH HOH A . C 3 HOH 84 484 48 HOH HOH A . C 3 HOH 85 485 90 HOH HOH A . C 3 HOH 86 486 45 HOH HOH A . C 3 HOH 87 487 85 HOH HOH A . C 3 HOH 88 488 95 HOH HOH A . C 3 HOH 89 489 94 HOH HOH A . C 3 HOH 90 490 91 HOH HOH A . C 3 HOH 91 491 75 HOH HOH A . C 3 HOH 92 492 70 HOH HOH A . C 3 HOH 93 493 93 HOH HOH A . C 3 HOH 94 494 23 HOH HOH A . C 3 HOH 95 495 19 HOH HOH A . C 3 HOH 96 496 97 HOH HOH A . C 3 HOH 97 497 78 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -8 ? 1 'SSA (A^2)' 8930 ? 2 'ABSA (A^2)' 1730 ? 2 MORE -28 ? 2 'SSA (A^2)' 16330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_566 x,x-y+1,-z+7/6 0.5000000000 0.8660254038 0.0000000000 -27.3880000000 0.8660254038 -0.5000000000 0.0000000000 47.4374075177 0.0000000000 0.0000000000 -1.0000000000 357.6206666667 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 445 ? C HOH . 2 1 A HOH 482 ? C HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD2 ? A ASP 212 ? A ASP 212 ? 1_555 87.1 ? 2 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 213 ? A ASP 213 ? 1_555 144.9 ? 3 OD2 ? A ASP 212 ? A ASP 212 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 213 ? A ASP 213 ? 1_555 76.9 ? 4 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 409 ? 1_555 139.7 ? 5 OD2 ? A ASP 212 ? A ASP 212 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 409 ? 1_555 70.5 ? 6 OD1 ? A ASP 213 ? A ASP 213 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 409 ? 1_555 62.9 ? 7 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 420 ? 1_555 128.1 ? 8 OD2 ? A ASP 212 ? A ASP 212 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 420 ? 1_555 140.7 ? 9 OD1 ? A ASP 213 ? A ASP 213 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 420 ? 1_555 80.0 ? 10 O ? C HOH . ? A HOH 409 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 420 ? 1_555 70.7 ? 11 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 434 ? 1_555 68.3 ? 12 OD2 ? A ASP 212 ? A ASP 212 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 434 ? 1_555 95.2 ? 13 OD1 ? A ASP 213 ? A ASP 213 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 434 ? 1_555 143.2 ? 14 O ? C HOH . ? A HOH 409 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 434 ? 1_555 80.5 ? 15 O ? C HOH . ? A HOH 420 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 434 ? 1_555 84.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-08 2 'Structure model' 1 1 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 75 ? ? HH22 A ARG 105 ? ? 1.47 2 1 O A HOH 411 ? ? O A HOH 443 ? ? 1.95 3 1 O A HOH 451 ? ? O A HOH 463 ? ? 2.05 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 85 ? ? 58.57 -117.33 2 1 PRO A 175 ? ? -74.45 35.73 3 1 ASP A 185 ? ? -100.03 79.87 4 1 ASP A 240 ? ? -150.09 21.90 5 1 GLN A 242 ? ? -122.24 -57.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 22 ? A SER 22 3 1 Y 1 A ASP 23 ? A ASP 23 4 1 Y 1 A ARG 24 ? A ARG 24 5 1 Y 1 A PRO 25 ? A PRO 25 6 1 Y 1 A HIS 26 ? A HIS 26 7 1 Y 1 A PRO 27 ? A PRO 27 8 1 Y 1 A ASN 28 ? A ASN 28 9 1 Y 1 A ALA 29 ? A ALA 29 10 1 Y 1 A TRP 30 ? A TRP 30 11 1 Y 1 A GLN 31 ? A GLN 31 12 1 Y 1 A ASP 32 ? A ASP 32 13 1 Y 1 A ASN 33 ? A ASN 33 14 1 Y 1 A THR 34 ? A THR 34 15 1 Y 1 A ASP 35 ? A ASP 35 16 1 Y 1 A TYR 36 ? A TYR 36 17 1 Y 1 A ARG 37 ? A ARG 37 18 1 Y 1 A GLN 38 ? A GLN 38 19 1 Y 1 A ALA 39 ? A ALA 39 20 1 Y 1 A ALA 40 ? A ALA 40 21 1 Y 1 A ARG 41 ? A ARG 41 22 1 Y 1 A ALA 42 ? A ALA 42 23 1 Y 1 A LYS 43 ? A LYS 43 24 1 Y 1 A GLY 44 ? A GLY 44 25 1 Y 1 A THR 45 ? A THR 45 26 1 Y 1 A ASP 46 ? A ASP 46 27 1 Y 1 A TRP 47 ? A TRP 47 28 1 Y 1 A PRO 48 ? A PRO 48 29 1 Y 1 A THR 49 ? A THR 49 30 1 Y 1 A VAL 50 ? A VAL 50 31 1 Y 1 A GLN 114 ? A GLN 114 32 1 Y 1 A GLY 115 ? A GLY 115 33 1 Y 1 A MET 116 ? A MET 116 34 1 Y 1 A PRO 117 ? A PRO 117 35 1 Y 1 A GLU 118 ? A GLU 118 36 1 Y 1 A SER 119 ? A SER 119 37 1 Y 1 A SER 120 ? A SER 120 38 1 Y 1 A ALA 121 ? A ALA 121 39 1 Y 1 A GLN 122 ? A GLN 122 40 1 Y 1 A ASP 123 ? A ASP 123 41 1 Y 1 A HIS 124 ? A HIS 124 42 1 Y 1 A GLN 125 ? A GLN 125 43 1 Y 1 A ALA 126 ? A ALA 126 44 1 Y 1 A ASP 127 ? A ASP 127 45 1 Y 1 A GLN 128 ? A GLN 128 46 1 Y 1 A ALA 129 ? A ALA 129 47 1 Y 1 A MET 130 ? A MET 130 48 1 Y 1 A ALA 131 ? A ALA 131 49 1 Y 1 A LEU 132 ? A LEU 132 50 1 Y 1 A HIS 133 ? A HIS 133 51 1 Y 1 A GLU 134 ? A GLU 134 52 1 Y 1 A TYR 135 ? A TYR 135 53 1 Y 1 A ASN 136 ? A ASN 136 54 1 Y 1 A ASP 137 ? A ASP 137 55 1 Y 1 A VAL 138 ? A VAL 138 56 1 Y 1 A LEU 139 ? A LEU 139 57 1 Y 1 A GLY 140 ? A GLY 140 58 1 Y 1 A VAL 141 ? A VAL 141 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Science Council' _pdbx_audit_support.country Taiwan _pdbx_audit_support.grant_number NSC102-2113-M006-003-MY2 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4CDZ _pdbx_initial_refinement_model.details ? #