data_5I11 # _entry.id 5I11 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5I11 pdb_00005i11 10.2210/pdb5i11/pdb WWPDB D_1000218076 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-09 2 'Structure model' 1 1 2017-09-06 3 'Structure model' 1 2 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5I11 _pdbx_database_status.recvd_initial_deposition_date 2016-02-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Camara-Artigas, A.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain T114S-Q128R mutant' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Camara-Artigas, A.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proto-oncogene tyrosine-protein kinase Src' 6920.537 1 2.7.10.2 'T114S, Q128R' ? ? 2 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 5 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 6 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-Src,pp60c-src,p60-Src' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMTFVALYDYESRTETDLSFKKGERLQIVNNSEGDWWLAHSLTTGRTGYIPSNYVAPSD _entity_poly.pdbx_seq_one_letter_code_can GSHMTFVALYDYESRTETDLSFKKGERLQIVNNSEGDWWLAHSLTTGRTGYIPSNYVAPSD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TRIETHYLENE GLYCOL' PGE 3 'SULFATE ION' SO4 4 'DI(HYDROXYETHYL)ETHER' PEG 5 'ACETATE ION' ACT 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 PHE n 1 7 VAL n 1 8 ALA n 1 9 LEU n 1 10 TYR n 1 11 ASP n 1 12 TYR n 1 13 GLU n 1 14 SER n 1 15 ARG n 1 16 THR n 1 17 GLU n 1 18 THR n 1 19 ASP n 1 20 LEU n 1 21 SER n 1 22 PHE n 1 23 LYS n 1 24 LYS n 1 25 GLY n 1 26 GLU n 1 27 ARG n 1 28 LEU n 1 29 GLN n 1 30 ILE n 1 31 VAL n 1 32 ASN n 1 33 ASN n 1 34 SER n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 TRP n 1 39 TRP n 1 40 LEU n 1 41 ALA n 1 42 HIS n 1 43 SER n 1 44 LEU n 1 45 THR n 1 46 THR n 1 47 GLY n 1 48 ARG n 1 49 THR n 1 50 GLY n 1 51 TYR n 1 52 ILE n 1 53 PRO n 1 54 SER n 1 55 ASN n 1 56 TYR n 1 57 VAL n 1 58 ALA n 1 59 PRO n 1 60 SER n 1 61 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 61 _entity_src_gen.gene_src_common_name Chicken _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SRC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector PET15B _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 81 ? ? ? A . n A 1 2 SER 2 82 ? ? ? A . n A 1 3 HIS 3 83 ? ? ? A . n A 1 4 MET 4 84 ? ? ? A . n A 1 5 THR 5 85 85 THR THR A . n A 1 6 PHE 6 86 86 PHE PHE A . n A 1 7 VAL 7 87 87 VAL VAL A . n A 1 8 ALA 8 88 88 ALA ALA A . n A 1 9 LEU 9 89 89 LEU LEU A . n A 1 10 TYR 10 90 90 TYR TYR A . n A 1 11 ASP 11 91 91 ASP ASP A . n A 1 12 TYR 12 92 92 TYR TYR A . n A 1 13 GLU 13 93 93 GLU GLU A . n A 1 14 SER 14 94 94 SER SER A . n A 1 15 ARG 15 95 95 ARG ARG A . n A 1 16 THR 16 96 96 THR THR A . n A 1 17 GLU 17 97 97 GLU GLU A . n A 1 18 THR 18 98 98 THR THR A . n A 1 19 ASP 19 99 99 ASP ASP A . n A 1 20 LEU 20 100 100 LEU LEU A . n A 1 21 SER 21 101 101 SER SER A . n A 1 22 PHE 22 102 102 PHE PHE A . n A 1 23 LYS 23 103 103 LYS LYS A . n A 1 24 LYS 24 104 104 LYS LYS A . n A 1 25 GLY 25 105 105 GLY GLY A . n A 1 26 GLU 26 106 106 GLU GLU A . n A 1 27 ARG 27 107 107 ARG ARG A . n A 1 28 LEU 28 108 108 LEU LEU A . n A 1 29 GLN 29 109 109 GLN GLN A . n A 1 30 ILE 30 110 110 ILE ILE A . n A 1 31 VAL 31 111 111 VAL VAL A . n A 1 32 ASN 32 112 112 ASN ASN A . n A 1 33 ASN 33 113 113 ASN ASN A . n A 1 34 SER 34 114 114 SER SER A . n A 1 35 GLU 35 115 115 GLU GLU A . n A 1 36 GLY 36 116 116 GLY GLY A . n A 1 37 ASP 37 117 117 ASP ASP A . n A 1 38 TRP 38 118 118 TRP TRP A . n A 1 39 TRP 39 119 119 TRP TRP A . n A 1 40 LEU 40 120 120 LEU LEU A . n A 1 41 ALA 41 121 121 ALA ALA A . n A 1 42 HIS 42 122 122 HIS HIS A . n A 1 43 SER 43 123 123 SER SER A . n A 1 44 LEU 44 124 124 LEU LEU A . n A 1 45 THR 45 125 125 THR THR A . n A 1 46 THR 46 126 126 THR THR A . n A 1 47 GLY 47 127 127 GLY GLY A . n A 1 48 ARG 48 128 128 ARG ARG A . n A 1 49 THR 49 129 129 THR THR A . n A 1 50 GLY 50 130 130 GLY GLY A . n A 1 51 TYR 51 131 131 TYR TYR A . n A 1 52 ILE 52 132 132 ILE ILE A . n A 1 53 PRO 53 133 133 PRO PRO A . n A 1 54 SER 54 134 134 SER SER A . n A 1 55 ASN 55 135 135 ASN ASN A . n A 1 56 TYR 56 136 136 TYR TYR A . n A 1 57 VAL 57 137 137 VAL VAL A . n A 1 58 ALA 58 138 138 ALA ALA A . n A 1 59 PRO 59 139 139 PRO PRO A . n A 1 60 SER 60 140 140 SER SER A . n A 1 61 ASP 61 141 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PGE 1 201 201 PGE PGE A . C 3 SO4 1 202 1 SO4 SO4 A . D 4 PEG 1 203 1 PEG PEG A . E 4 PEG 1 204 2 PEG PEG A . F 5 ACT 1 205 1 ACT ACT A . G 6 HOH 1 301 3 HOH HOH A . G 6 HOH 2 302 5 HOH HOH A . G 6 HOH 3 303 1 HOH HOH A . G 6 HOH 4 304 2 HOH HOH A . G 6 HOH 5 305 4 HOH HOH A . G 6 HOH 6 306 13 HOH HOH A . G 6 HOH 7 307 19 HOH HOH A . G 6 HOH 8 308 11 HOH HOH A . G 6 HOH 9 309 14 HOH HOH A . G 6 HOH 10 310 8 HOH HOH A . G 6 HOH 11 311 7 HOH HOH A . G 6 HOH 12 312 12 HOH HOH A . G 6 HOH 13 313 18 HOH HOH A . G 6 HOH 14 314 10 HOH HOH A . G 6 HOH 15 315 6 HOH HOH A . G 6 HOH 16 316 15 HOH HOH A . G 6 HOH 17 317 16 HOH HOH A . G 6 HOH 18 318 17 HOH HOH A . G 6 HOH 19 319 9 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 93 ? CG ? A GLU 13 CG 2 1 Y 1 A GLU 93 ? CD ? A GLU 13 CD 3 1 Y 1 A GLU 93 ? OE1 ? A GLU 13 OE1 4 1 Y 1 A GLU 93 ? OE2 ? A GLU 13 OE2 5 1 Y 1 A GLU 97 ? CG ? A GLU 17 CG 6 1 Y 1 A GLU 97 ? CD ? A GLU 17 CD 7 1 Y 1 A GLU 97 ? OE1 ? A GLU 17 OE1 8 1 Y 1 A GLU 97 ? OE2 ? A GLU 17 OE2 9 1 Y 1 A ARG 107 ? CG ? A ARG 27 CG 10 1 Y 1 A ARG 107 ? CD ? A ARG 27 CD 11 1 Y 1 A ARG 107 ? NE ? A ARG 27 NE 12 1 Y 1 A ARG 107 ? CZ ? A ARG 27 CZ 13 1 Y 1 A ARG 107 ? NH1 ? A ARG 27 NH1 14 1 Y 1 A ARG 107 ? NH2 ? A ARG 27 NH2 15 1 Y 1 A GLN 109 ? CG ? A GLN 29 CG 16 1 Y 1 A GLN 109 ? CD ? A GLN 29 CD 17 1 Y 1 A GLN 109 ? OE1 ? A GLN 29 OE1 18 1 Y 1 A GLN 109 ? NE2 ? A GLN 29 NE2 19 1 Y 1 A ASN 112 ? CG ? A ASN 32 CG 20 1 Y 1 A ASN 112 ? OD1 ? A ASN 32 OD1 21 1 Y 1 A ASN 112 ? ND2 ? A ASN 32 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.17 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5I11 _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.735 _cell.length_a_esd ? _cell.length_b 46.735 _cell.length_b_esd ? _cell.length_c 127.907 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5I11 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5I11 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1M SODIUM ACETATE, 1.9M AMMONIUM SULPHATE, 5% PEG 400, 10% GLYCEROL, PH 5.0 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'Pair of KB mirrors for adjustable focusing' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Channel-cut double crystal monochromator (CINEL), cryocooled, 6mm gap' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate 30.440 _reflns.entry_id 5I11 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.950 _reflns.d_resolution_low 19.990 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11377 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.600 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.950 _reflns_shell.d_res_low 2.000 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100.000 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.754 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.300 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 108.000 _refine.B_iso_mean 43.8468 _refine.B_iso_min 16.910 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5I11 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9500 _refine.ls_d_res_low 19.9880 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11377 _refine.ls_number_reflns_R_free 550 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 4.8300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1889 _refine.ls_R_factor_R_free 0.2182 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1874 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4jz3 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.9200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9500 _refine_hist.d_res_low 19.9880 _refine_hist.pdbx_number_atoms_ligand 70 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 520 _refine_hist.pdbx_number_residues_total 56 _refine_hist.pdbx_B_iso_mean_ligand 59.83 _refine_hist.pdbx_B_iso_mean_solvent 41.44 _refine_hist.pdbx_number_atoms_protein 431 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.018 ? 486 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.669 ? 654 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.090 ? 69 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 ? 80 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 10.427 ? 272 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9501 2.1461 2828 . 143 2685 100.0000 . . . 0.2551 . 0.2132 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.1461 2.4562 2860 . 108 2752 100.0000 . . . 0.2078 . 0.1880 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.4562 3.0927 2847 . 154 2693 100.0000 . . . 0.2564 . 0.2068 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.0927 19.9893 2842 . 145 2697 100.0000 . . . 0.1987 . 0.1750 . . . . . . 4 . . . # _struct.entry_id 5I11 _struct.title 'Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain T114S-Q128R mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5I11 _struct_keywords.text 'PROTEIN BINDING, SIGNALING PROTEIN, SH3 domain, INTERTWINED-DIMER, DOMAIN-SWAPPING' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SRC_CHICK _struct_ref.pdbx_db_accession P00523 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD _struct_ref.pdbx_align_begin 85 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5I11 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00523 _struct_ref_seq.db_align_beg 85 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 141 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 85 _struct_ref_seq.pdbx_auth_seq_align_end 141 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5I11 GLY A 1 ? UNP P00523 ? ? 'expression tag' 81 1 1 5I11 SER A 2 ? UNP P00523 ? ? 'expression tag' 82 2 1 5I11 HIS A 3 ? UNP P00523 ? ? 'expression tag' 83 3 1 5I11 MET A 4 ? UNP P00523 ? ? 'expression tag' 84 4 1 5I11 SER A 34 ? UNP P00523 THR 114 'engineered mutation' 114 5 1 5I11 ARG A 48 ? UNP P00523 GLN 128 'engineered mutation' 128 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5280 ? 1 MORE -53 ? 1 'SSA (A^2)' 7250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_554 y,x,-z-1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -42.6356666667 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 57 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 135 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 137 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 6 ? VAL A 7 ? PHE A 86 VAL A 87 AA1 2 ARG A 27 ? LEU A 28 ? ARG A 107 LEU A 108 AA2 1 TRP A 38 ? HIS A 42 ? TRP A 118 HIS A 122 AA2 2 THR A 49 ? PRO A 53 ? THR A 129 PRO A 133 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 6 ? N PHE A 86 O LEU A 28 ? O LEU A 108 AA2 1 2 N TRP A 39 ? N TRP A 119 O ILE A 52 ? O ILE A 132 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PGE 201 ? 10 'binding site for residue PGE A 201' AC2 Software A SO4 202 ? 4 'binding site for residue SO4 A 202' AC3 Software A PEG 203 ? 2 'binding site for residue PEG A 203' AC4 Software A PEG 204 ? 2 'binding site for residue PEG A 204' AC5 Software A ACT 205 ? 4 'binding site for residue ACT A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 ARG A 15 ? ARG A 95 . ? 1_555 ? 2 AC1 10 ARG A 15 ? ARG A 95 . ? 7_554 ? 3 AC1 10 THR A 18 ? THR A 98 . ? 7_554 ? 4 AC1 10 THR A 18 ? THR A 98 . ? 1_555 ? 5 AC1 10 ASP A 19 ? ASP A 99 . ? 1_555 ? 6 AC1 10 ASP A 19 ? ASP A 99 . ? 7_554 ? 7 AC1 10 TYR A 51 ? TYR A 131 . ? 1_555 ? 8 AC1 10 TYR A 51 ? TYR A 131 . ? 7_554 ? 9 AC1 10 HOH G . ? HOH A 302 . ? 1_555 ? 10 AC1 10 HOH G . ? HOH A 302 . ? 7_554 ? 11 AC2 4 THR A 16 ? THR A 96 . ? 1_555 ? 12 AC2 4 THR A 16 ? THR A 96 . ? 7_554 ? 13 AC2 4 GLU A 17 ? GLU A 97 . ? 1_555 ? 14 AC2 4 GLU A 17 ? GLU A 97 . ? 7_554 ? 15 AC3 2 TYR A 10 ? TYR A 90 . ? 7_554 ? 16 AC3 2 LYS A 24 ? LYS A 104 . ? 6_654 ? 17 AC4 2 LYS A 24 ? LYS A 104 . ? 1_555 ? 18 AC4 2 GLY A 25 ? GLY A 105 . ? 1_555 ? 19 AC5 4 SER A 14 ? SER A 94 . ? 1_555 ? 20 AC5 4 SER A 21 ? SER A 101 . ? 1_555 ? 21 AC5 4 ARG A 48 ? ARG A 128 . ? 7_554 ? 22 AC5 4 HOH G . ? HOH A 315 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 114 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HD22 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASN _pdbx_validate_close_contact.auth_seq_id_2 135 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.53 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SO4 _pdbx_struct_special_symmetry.auth_seq_id 202 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id SO4 _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 0.5585 17.6369 -10.0520 0.6228 0.2106 0.2893 0.2504 -0.0703 0.0454 0.4078 0.1696 0.5882 0.0520 -0.3702 0.1684 -0.1232 0.0632 -0.0871 0.1568 0.2324 0.0910 0.4076 -0.6452 -0.7107 'X-RAY DIFFRACTION' 2 ? refined -0.1086 9.8359 -12.9896 0.3380 0.1977 0.1588 0.1580 -0.0799 0.0194 1.7437 0.9403 0.2724 1.1652 -0.4630 -0.4775 -0.5176 0.3705 -0.1307 -0.0445 -0.1462 -0.0969 0.2492 -0.3402 -0.4180 'X-RAY DIFFRACTION' 3 ? refined 5.5158 16.4870 -4.2250 0.6108 0.2117 0.3397 0.0997 -0.0762 -0.0021 0.0130 0.0087 0.0464 -0.0065 -0.0119 0.0209 -0.1519 -0.0811 -0.0123 -0.0147 0.0216 -0.2704 0.0875 -0.2390 -0.1159 'X-RAY DIFFRACTION' 4 ? refined 15.9495 11.8852 -14.8224 0.4366 0.6411 0.4539 -0.0657 -0.0551 -0.0118 0.0158 0.0080 0.0349 -0.0143 -0.0182 0.0133 -0.0110 0.0215 -0.0002 0.2136 -0.0335 0.0219 -0.0447 0.0548 0.1306 'X-RAY DIFFRACTION' 5 ? refined 8.0855 11.9813 -31.1954 0.1928 0.4307 0.3090 -0.0508 -0.0509 0.0564 0.1369 0.0217 0.0071 0.0463 -0.0131 0.0166 -0.1665 -0.1066 -0.0006 0.0767 0.1507 -0.0289 -0.0421 -0.2300 0.6838 'X-RAY DIFFRACTION' 6 ? refined 12.5788 12.9431 -29.4884 -0.0065 0.5183 0.2432 -0.1366 -0.0468 0.0147 0.1064 0.0528 0.3754 -0.0477 0.0414 0.0974 -0.1279 0.0027 -0.1519 0.0053 0.0368 -0.0080 -0.1106 -0.4234 0.2923 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 85 A 94 ;chain 'A' and (resid 85 through 94 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 95 A 104 ;chain 'A' and (resid 95 through 104 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 105 A 109 ;chain 'A' and (resid 105 through 109 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 110 A 114 ;chain 'A' and (resid 110 through 114 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 115 A 128 ;chain 'A' and (resid 115 through 128 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 129 A 140 ;chain 'A' and (resid 129 through 140 ) ; ? ? ? ? ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 81 ? A GLY 1 2 1 Y 1 A SER 82 ? A SER 2 3 1 Y 1 A HIS 83 ? A HIS 3 4 1 Y 1 A MET 84 ? A MET 4 5 1 Y 1 A ASP 141 ? A ASP 61 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 GLN N N N N 81 GLN CA C N S 82 GLN C C N N 83 GLN O O N N 84 GLN CB C N N 85 GLN CG C N N 86 GLN CD C N N 87 GLN OE1 O N N 88 GLN NE2 N N N 89 GLN OXT O N N 90 GLN H H N N 91 GLN H2 H N N 92 GLN HA H N N 93 GLN HB2 H N N 94 GLN HB3 H N N 95 GLN HG2 H N N 96 GLN HG3 H N N 97 GLN HE21 H N N 98 GLN HE22 H N N 99 GLN HXT H N N 100 GLU N N N N 101 GLU CA C N S 102 GLU C C N N 103 GLU O O N N 104 GLU CB C N N 105 GLU CG C N N 106 GLU CD C N N 107 GLU OE1 O N N 108 GLU OE2 O N N 109 GLU OXT O N N 110 GLU H H N N 111 GLU H2 H N N 112 GLU HA H N N 113 GLU HB2 H N N 114 GLU HB3 H N N 115 GLU HG2 H N N 116 GLU HG3 H N N 117 GLU HE2 H N N 118 GLU HXT H N N 119 GLY N N N N 120 GLY CA C N N 121 GLY C C N N 122 GLY O O N N 123 GLY OXT O N N 124 GLY H H N N 125 GLY H2 H N N 126 GLY HA2 H N N 127 GLY HA3 H N N 128 GLY HXT H N N 129 HIS N N N N 130 HIS CA C N S 131 HIS C C N N 132 HIS O O N N 133 HIS CB C N N 134 HIS CG C Y N 135 HIS ND1 N Y N 136 HIS CD2 C Y N 137 HIS CE1 C Y N 138 HIS NE2 N Y N 139 HIS OXT O N N 140 HIS H H N N 141 HIS H2 H N N 142 HIS HA H N N 143 HIS HB2 H N N 144 HIS HB3 H N N 145 HIS HD1 H N N 146 HIS HD2 H N N 147 HIS HE1 H N N 148 HIS HE2 H N N 149 HIS HXT H N N 150 HOH O O N N 151 HOH H1 H N N 152 HOH H2 H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 PEG C1 C N N 243 PEG O1 O N N 244 PEG C2 C N N 245 PEG O2 O N N 246 PEG C3 C N N 247 PEG C4 C N N 248 PEG O4 O N N 249 PEG H11 H N N 250 PEG H12 H N N 251 PEG HO1 H N N 252 PEG H21 H N N 253 PEG H22 H N N 254 PEG H31 H N N 255 PEG H32 H N N 256 PEG H41 H N N 257 PEG H42 H N N 258 PEG HO4 H N N 259 PGE C1 C N N 260 PGE O1 O N N 261 PGE C2 C N N 262 PGE O2 O N N 263 PGE C3 C N N 264 PGE C4 C N N 265 PGE O4 O N N 266 PGE C6 C N N 267 PGE C5 C N N 268 PGE O3 O N N 269 PGE H1 H N N 270 PGE H12 H N N 271 PGE HO1 H N N 272 PGE H2 H N N 273 PGE H22 H N N 274 PGE H3 H N N 275 PGE H32 H N N 276 PGE H4 H N N 277 PGE H42 H N N 278 PGE HO4 H N N 279 PGE H6 H N N 280 PGE H62 H N N 281 PGE H5 H N N 282 PGE H52 H N N 283 PHE N N N N 284 PHE CA C N S 285 PHE C C N N 286 PHE O O N N 287 PHE CB C N N 288 PHE CG C Y N 289 PHE CD1 C Y N 290 PHE CD2 C Y N 291 PHE CE1 C Y N 292 PHE CE2 C Y N 293 PHE CZ C Y N 294 PHE OXT O N N 295 PHE H H N N 296 PHE H2 H N N 297 PHE HA H N N 298 PHE HB2 H N N 299 PHE HB3 H N N 300 PHE HD1 H N N 301 PHE HD2 H N N 302 PHE HE1 H N N 303 PHE HE2 H N N 304 PHE HZ H N N 305 PHE HXT H N N 306 PRO N N N N 307 PRO CA C N S 308 PRO C C N N 309 PRO O O N N 310 PRO CB C N N 311 PRO CG C N N 312 PRO CD C N N 313 PRO OXT O N N 314 PRO H H N N 315 PRO HA H N N 316 PRO HB2 H N N 317 PRO HB3 H N N 318 PRO HG2 H N N 319 PRO HG3 H N N 320 PRO HD2 H N N 321 PRO HD3 H N N 322 PRO HXT H N N 323 SER N N N N 324 SER CA C N S 325 SER C C N N 326 SER O O N N 327 SER CB C N N 328 SER OG O N N 329 SER OXT O N N 330 SER H H N N 331 SER H2 H N N 332 SER HA H N N 333 SER HB2 H N N 334 SER HB3 H N N 335 SER HG H N N 336 SER HXT H N N 337 SO4 S S N N 338 SO4 O1 O N N 339 SO4 O2 O N N 340 SO4 O3 O N N 341 SO4 O4 O N N 342 THR N N N N 343 THR CA C N S 344 THR C C N N 345 THR O O N N 346 THR CB C N R 347 THR OG1 O N N 348 THR CG2 C N N 349 THR OXT O N N 350 THR H H N N 351 THR H2 H N N 352 THR HA H N N 353 THR HB H N N 354 THR HG1 H N N 355 THR HG21 H N N 356 THR HG22 H N N 357 THR HG23 H N N 358 THR HXT H N N 359 TRP N N N N 360 TRP CA C N S 361 TRP C C N N 362 TRP O O N N 363 TRP CB C N N 364 TRP CG C Y N 365 TRP CD1 C Y N 366 TRP CD2 C Y N 367 TRP NE1 N Y N 368 TRP CE2 C Y N 369 TRP CE3 C Y N 370 TRP CZ2 C Y N 371 TRP CZ3 C Y N 372 TRP CH2 C Y N 373 TRP OXT O N N 374 TRP H H N N 375 TRP H2 H N N 376 TRP HA H N N 377 TRP HB2 H N N 378 TRP HB3 H N N 379 TRP HD1 H N N 380 TRP HE1 H N N 381 TRP HE3 H N N 382 TRP HZ2 H N N 383 TRP HZ3 H N N 384 TRP HH2 H N N 385 TRP HXT H N N 386 TYR N N N N 387 TYR CA C N S 388 TYR C C N N 389 TYR O O N N 390 TYR CB C N N 391 TYR CG C Y N 392 TYR CD1 C Y N 393 TYR CD2 C Y N 394 TYR CE1 C Y N 395 TYR CE2 C Y N 396 TYR CZ C Y N 397 TYR OH O N N 398 TYR OXT O N N 399 TYR H H N N 400 TYR H2 H N N 401 TYR HA H N N 402 TYR HB2 H N N 403 TYR HB3 H N N 404 TYR HD1 H N N 405 TYR HD2 H N N 406 TYR HE1 H N N 407 TYR HE2 H N N 408 TYR HH H N N 409 TYR HXT H N N 410 VAL N N N N 411 VAL CA C N S 412 VAL C C N N 413 VAL O O N N 414 VAL CB C N N 415 VAL CG1 C N N 416 VAL CG2 C N N 417 VAL OXT O N N 418 VAL H H N N 419 VAL H2 H N N 420 VAL HA H N N 421 VAL HB H N N 422 VAL HG11 H N N 423 VAL HG12 H N N 424 VAL HG13 H N N 425 VAL HG21 H N N 426 VAL HG22 H N N 427 VAL HG23 H N N 428 VAL HXT H N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 HOH O H1 sing N N 143 HOH O H2 sing N N 144 ILE N CA sing N N 145 ILE N H sing N N 146 ILE N H2 sing N N 147 ILE CA C sing N N 148 ILE CA CB sing N N 149 ILE CA HA sing N N 150 ILE C O doub N N 151 ILE C OXT sing N N 152 ILE CB CG1 sing N N 153 ILE CB CG2 sing N N 154 ILE CB HB sing N N 155 ILE CG1 CD1 sing N N 156 ILE CG1 HG12 sing N N 157 ILE CG1 HG13 sing N N 158 ILE CG2 HG21 sing N N 159 ILE CG2 HG22 sing N N 160 ILE CG2 HG23 sing N N 161 ILE CD1 HD11 sing N N 162 ILE CD1 HD12 sing N N 163 ILE CD1 HD13 sing N N 164 ILE OXT HXT sing N N 165 LEU N CA sing N N 166 LEU N H sing N N 167 LEU N H2 sing N N 168 LEU CA C sing N N 169 LEU CA CB sing N N 170 LEU CA HA sing N N 171 LEU C O doub N N 172 LEU C OXT sing N N 173 LEU CB CG sing N N 174 LEU CB HB2 sing N N 175 LEU CB HB3 sing N N 176 LEU CG CD1 sing N N 177 LEU CG CD2 sing N N 178 LEU CG HG sing N N 179 LEU CD1 HD11 sing N N 180 LEU CD1 HD12 sing N N 181 LEU CD1 HD13 sing N N 182 LEU CD2 HD21 sing N N 183 LEU CD2 HD22 sing N N 184 LEU CD2 HD23 sing N N 185 LEU OXT HXT sing N N 186 LYS N CA sing N N 187 LYS N H sing N N 188 LYS N H2 sing N N 189 LYS CA C sing N N 190 LYS CA CB sing N N 191 LYS CA HA sing N N 192 LYS C O doub N N 193 LYS C OXT sing N N 194 LYS CB CG sing N N 195 LYS CB HB2 sing N N 196 LYS CB HB3 sing N N 197 LYS CG CD sing N N 198 LYS CG HG2 sing N N 199 LYS CG HG3 sing N N 200 LYS CD CE sing N N 201 LYS CD HD2 sing N N 202 LYS CD HD3 sing N N 203 LYS CE NZ sing N N 204 LYS CE HE2 sing N N 205 LYS CE HE3 sing N N 206 LYS NZ HZ1 sing N N 207 LYS NZ HZ2 sing N N 208 LYS NZ HZ3 sing N N 209 LYS OXT HXT sing N N 210 MET N CA sing N N 211 MET N H sing N N 212 MET N H2 sing N N 213 MET CA C sing N N 214 MET CA CB sing N N 215 MET CA HA sing N N 216 MET C O doub N N 217 MET C OXT sing N N 218 MET CB CG sing N N 219 MET CB HB2 sing N N 220 MET CB HB3 sing N N 221 MET CG SD sing N N 222 MET CG HG2 sing N N 223 MET CG HG3 sing N N 224 MET SD CE sing N N 225 MET CE HE1 sing N N 226 MET CE HE2 sing N N 227 MET CE HE3 sing N N 228 MET OXT HXT sing N N 229 PEG C1 O1 sing N N 230 PEG C1 C2 sing N N 231 PEG C1 H11 sing N N 232 PEG C1 H12 sing N N 233 PEG O1 HO1 sing N N 234 PEG C2 O2 sing N N 235 PEG C2 H21 sing N N 236 PEG C2 H22 sing N N 237 PEG O2 C3 sing N N 238 PEG C3 C4 sing N N 239 PEG C3 H31 sing N N 240 PEG C3 H32 sing N N 241 PEG C4 O4 sing N N 242 PEG C4 H41 sing N N 243 PEG C4 H42 sing N N 244 PEG O4 HO4 sing N N 245 PGE C1 O1 sing N N 246 PGE C1 C2 sing N N 247 PGE C1 H1 sing N N 248 PGE C1 H12 sing N N 249 PGE O1 HO1 sing N N 250 PGE C2 O2 sing N N 251 PGE C2 H2 sing N N 252 PGE C2 H22 sing N N 253 PGE O2 C3 sing N N 254 PGE C3 C4 sing N N 255 PGE C3 H3 sing N N 256 PGE C3 H32 sing N N 257 PGE C4 O3 sing N N 258 PGE C4 H4 sing N N 259 PGE C4 H42 sing N N 260 PGE O4 C6 sing N N 261 PGE O4 HO4 sing N N 262 PGE C6 C5 sing N N 263 PGE C6 H6 sing N N 264 PGE C6 H62 sing N N 265 PGE C5 O3 sing N N 266 PGE C5 H5 sing N N 267 PGE C5 H52 sing N N 268 PHE N CA sing N N 269 PHE N H sing N N 270 PHE N H2 sing N N 271 PHE CA C sing N N 272 PHE CA CB sing N N 273 PHE CA HA sing N N 274 PHE C O doub N N 275 PHE C OXT sing N N 276 PHE CB CG sing N N 277 PHE CB HB2 sing N N 278 PHE CB HB3 sing N N 279 PHE CG CD1 doub Y N 280 PHE CG CD2 sing Y N 281 PHE CD1 CE1 sing Y N 282 PHE CD1 HD1 sing N N 283 PHE CD2 CE2 doub Y N 284 PHE CD2 HD2 sing N N 285 PHE CE1 CZ doub Y N 286 PHE CE1 HE1 sing N N 287 PHE CE2 CZ sing Y N 288 PHE CE2 HE2 sing N N 289 PHE CZ HZ sing N N 290 PHE OXT HXT sing N N 291 PRO N CA sing N N 292 PRO N CD sing N N 293 PRO N H sing N N 294 PRO CA C sing N N 295 PRO CA CB sing N N 296 PRO CA HA sing N N 297 PRO C O doub N N 298 PRO C OXT sing N N 299 PRO CB CG sing N N 300 PRO CB HB2 sing N N 301 PRO CB HB3 sing N N 302 PRO CG CD sing N N 303 PRO CG HG2 sing N N 304 PRO CG HG3 sing N N 305 PRO CD HD2 sing N N 306 PRO CD HD3 sing N N 307 PRO OXT HXT sing N N 308 SER N CA sing N N 309 SER N H sing N N 310 SER N H2 sing N N 311 SER CA C sing N N 312 SER CA CB sing N N 313 SER CA HA sing N N 314 SER C O doub N N 315 SER C OXT sing N N 316 SER CB OG sing N N 317 SER CB HB2 sing N N 318 SER CB HB3 sing N N 319 SER OG HG sing N N 320 SER OXT HXT sing N N 321 SO4 S O1 doub N N 322 SO4 S O2 doub N N 323 SO4 S O3 sing N N 324 SO4 S O4 sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Junta de Andalucia' Spain P09-CVI-5063 1 'Spanish Ministry of Economy and Competitiveness' Spain BIO2012-39922-C02-02 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4JZ3 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5I11 _atom_sites.fract_transf_matrix[1][1] 0.021397 _atom_sites.fract_transf_matrix[1][2] 0.012354 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024707 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007818 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_