data_5IAR # _entry.id 5IAR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5IAR WWPDB D_1000218550 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IAR _pdbx_database_status.recvd_initial_deposition_date 2016-02-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Maciag, J.J.' 1 'Mackenzie, S.H.' 2 'Tucker, M.B.' 3 'Schipper, J.L.' 4 'Swartz, P.D.' 5 'Clark, A.C.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first E6080 _citation.page_last E6088 _citation.title 'Tunable allosteric library of caspase-3 identifies coupling between conserved water molecules and conformational selection.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1603549113 _citation.pdbx_database_id_PubMed 27681633 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Maciag, J.J.' 1 primary 'Mackenzie, S.H.' 2 primary 'Tucker, M.B.' 3 primary 'Schipper, J.L.' 4 primary 'Swartz, P.' 5 primary 'Clark, A.C.' 6 # _cell.entry_id 5IAR _cell.length_a 68.871 _cell.length_b 84.628 _cell.length_c 96.237 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IAR _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Caspase-3 31852.176 1 3.4.22.56 V266W ? ? 2 polymer syn ACE-ASP-GLU-VAL-ASK 534.946 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 2,3-DIHYDROXY-1,4-DITHIOBUTANE 154.251 1 ? ? ? ? 5 water nat water 18.015 218 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CASP-3,Apopain,Cysteine protease CPP32,CPP-32,Protein Yama,SREBP cleavage activity 1,SCA-1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRN LKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII QACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN RKVATEFESFSFDATFHAKKQIPCIWSMLTKELYFYHL ; ;MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRN LKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII QACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN RKVATEFESFSFDATFHAKKQIPCIWSMLTKELYFYHL ; A ? 2 'polypeptide(L)' no yes '(ACE)DEVD(0QE)' XDEVDX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASN n 1 4 THR n 1 5 GLU n 1 6 ASN n 1 7 SER n 1 8 VAL n 1 9 ASP n 1 10 SER n 1 11 LYS n 1 12 SER n 1 13 ILE n 1 14 LYS n 1 15 ASN n 1 16 LEU n 1 17 GLU n 1 18 PRO n 1 19 LYS n 1 20 ILE n 1 21 ILE n 1 22 HIS n 1 23 GLY n 1 24 SER n 1 25 GLU n 1 26 SER n 1 27 MET n 1 28 ASP n 1 29 SER n 1 30 GLY n 1 31 ILE n 1 32 SER n 1 33 LEU n 1 34 ASP n 1 35 ASN n 1 36 SER n 1 37 TYR n 1 38 LYS n 1 39 MET n 1 40 ASP n 1 41 TYR n 1 42 PRO n 1 43 GLU n 1 44 MET n 1 45 GLY n 1 46 LEU n 1 47 CYS n 1 48 ILE n 1 49 ILE n 1 50 ILE n 1 51 ASN n 1 52 ASN n 1 53 LYS n 1 54 ASN n 1 55 PHE n 1 56 HIS n 1 57 LYS n 1 58 SER n 1 59 THR n 1 60 GLY n 1 61 MET n 1 62 THR n 1 63 SER n 1 64 ARG n 1 65 SER n 1 66 GLY n 1 67 THR n 1 68 ASP n 1 69 VAL n 1 70 ASP n 1 71 ALA n 1 72 ALA n 1 73 ASN n 1 74 LEU n 1 75 ARG n 1 76 GLU n 1 77 THR n 1 78 PHE n 1 79 ARG n 1 80 ASN n 1 81 LEU n 1 82 LYS n 1 83 TYR n 1 84 GLU n 1 85 VAL n 1 86 ARG n 1 87 ASN n 1 88 LYS n 1 89 ASN n 1 90 ASP n 1 91 LEU n 1 92 THR n 1 93 ARG n 1 94 GLU n 1 95 GLU n 1 96 ILE n 1 97 VAL n 1 98 GLU n 1 99 LEU n 1 100 MET n 1 101 ARG n 1 102 ASP n 1 103 VAL n 1 104 SER n 1 105 LYS n 1 106 GLU n 1 107 ASP n 1 108 HIS n 1 109 SER n 1 110 LYS n 1 111 ARG n 1 112 SER n 1 113 SER n 1 114 PHE n 1 115 VAL n 1 116 CYS n 1 117 VAL n 1 118 LEU n 1 119 LEU n 1 120 SER n 1 121 HIS n 1 122 GLY n 1 123 GLU n 1 124 GLU n 1 125 GLY n 1 126 ILE n 1 127 ILE n 1 128 PHE n 1 129 GLY n 1 130 THR n 1 131 ASN n 1 132 GLY n 1 133 PRO n 1 134 VAL n 1 135 ASP n 1 136 LEU n 1 137 LYS n 1 138 LYS n 1 139 ILE n 1 140 THR n 1 141 ASN n 1 142 PHE n 1 143 PHE n 1 144 ARG n 1 145 GLY n 1 146 ASP n 1 147 ARG n 1 148 CYS n 1 149 ARG n 1 150 SER n 1 151 LEU n 1 152 THR n 1 153 GLY n 1 154 LYS n 1 155 PRO n 1 156 LYS n 1 157 LEU n 1 158 PHE n 1 159 ILE n 1 160 ILE n 1 161 GLN n 1 162 ALA n 1 163 CYS n 1 164 ARG n 1 165 GLY n 1 166 THR n 1 167 GLU n 1 168 LEU n 1 169 ASP n 1 170 CYS n 1 171 GLY n 1 172 ILE n 1 173 GLU n 1 174 THR n 1 175 ASP n 1 176 SER n 1 177 GLY n 1 178 VAL n 1 179 ASP n 1 180 ASP n 1 181 ASP n 1 182 MET n 1 183 ALA n 1 184 CYS n 1 185 HIS n 1 186 LYS n 1 187 ILE n 1 188 PRO n 1 189 VAL n 1 190 GLU n 1 191 ALA n 1 192 ASP n 1 193 PHE n 1 194 LEU n 1 195 TYR n 1 196 ALA n 1 197 TYR n 1 198 SER n 1 199 THR n 1 200 ALA n 1 201 PRO n 1 202 GLY n 1 203 TYR n 1 204 TYR n 1 205 SER n 1 206 TRP n 1 207 ARG n 1 208 ASN n 1 209 SER n 1 210 LYS n 1 211 ASP n 1 212 GLY n 1 213 SER n 1 214 TRP n 1 215 PHE n 1 216 ILE n 1 217 GLN n 1 218 SER n 1 219 LEU n 1 220 CYS n 1 221 ALA n 1 222 MET n 1 223 LEU n 1 224 LYS n 1 225 GLN n 1 226 TYR n 1 227 ALA n 1 228 ASP n 1 229 LYS n 1 230 LEU n 1 231 GLU n 1 232 PHE n 1 233 MET n 1 234 HIS n 1 235 ILE n 1 236 LEU n 1 237 THR n 1 238 ARG n 1 239 VAL n 1 240 ASN n 1 241 ARG n 1 242 LYS n 1 243 VAL n 1 244 ALA n 1 245 THR n 1 246 GLU n 1 247 PHE n 1 248 GLU n 1 249 SER n 1 250 PHE n 1 251 SER n 1 252 PHE n 1 253 ASP n 1 254 ALA n 1 255 THR n 1 256 PHE n 1 257 HIS n 1 258 ALA n 1 259 LYS n 1 260 LYS n 1 261 GLN n 1 262 ILE n 1 263 PRO n 1 264 CYS n 1 265 ILE n 1 266 TRP n 1 267 SER n 1 268 MET n 1 269 LEU n 1 270 THR n 1 271 LYS n 1 272 GLU n 1 273 LEU n 1 274 TYR n 1 275 PHE n 1 276 TYR n 1 277 HIS n 1 278 LEU n 2 1 ACE n 2 2 ASP n 2 3 GLU n 2 4 VAL n 2 5 ASP n 2 6 0QE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 278 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CASP3, CPP32' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 6 _pdbx_entity_src_syn.organism_scientific unidentified _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32644 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CASP3_HUMAN P42574 ? 1 ;MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRN LKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII QACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH ; 1 2 PDB 5IAR 5IAR ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5IAR A 1 ? 277 ? P42574 1 ? 277 ? 1 277 2 2 5IAR B 1 ? 6 ? 5IAR 1 ? 6 ? 1 6 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5IAR TRP A 266 ? UNP P42574 VAL 266 'engineered mutation' 266 1 1 5IAR LEU A 278 ? UNP P42574 ? ? 'expression tag' 278 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0QE non-polymer . chloromethane 'Chloro Methyl group' 'C H3 Cl' 50.488 ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DTT non-polymer . 2,3-DIHYDROXY-1,4-DITHIOBUTANE 1,4-DITHIOTHREITOL 'C4 H10 O2 S2' 154.251 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IAR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Caspase-3 variants were crystallized in the presence of Ac-DEVD-CMK. PROTEINS WERE DIALYZED IN A BUFFER OF 10 MM TRIS-HCL, PH 8.5, 1 MM DTT. THE PROTEIN WAS CONCENTRATED TO 10 MG/ML USING AMICON ULTRAFREE CENTRIFUGAL FILTER DEVICES, AND INHIBITOR, AC-DEVD-CMK RECONSTITUTED IN DMSO, WAS THEN ADDED AT 5:1 WT:WT, INHIBITOR TO PEPTIDE. THE PROTEIN WAS DILUTED TO A CONCENTRATION OF 8 MG/ML BY ADDING 10 MM TRIS-HCL, PH 8.5, CONCENTRATED DTT AND CONCENTRATED NAN3 SO THAT THE FINAL BUFFER WAS 10 MM TRIS-HCL, PH 8.5, 10 MM DTT, 3 MM NAN3. 2 UL OF CONCENTRATED PROTEIN WAS MIXED 1:1 WITH WELL BUFFER THAT CONTAINED 100 MM SODIUM CITRATE, PH 5, 3 MM NAN3, 10 MM DTT AND 17% PEG 6000 W/V. SOLUTIONS WERE INCUBATED AT 18 DEG C USING THE HANGING DROP METHOD. CRYSTALS GREW WITHIN THREE DAYS FOR WILD- TYPE CASPASE-3 AND WITHIN TWO WEEKS FOR THE MUTANTS. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-10-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5IAR _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 31.776 _reflns.d_resolution_high 1.761 _reflns.number_obs 28121 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 1.3500 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.200 # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5IAR _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 28121 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 31.78 _refine.ls_d_res_high 1.76 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.161 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.159 _refine.ls_R_factor_R_free 0.185 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.110 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;Authors state that there is a fundamental incompatibility in the naming of the inhibitor structure and the refinement program cannot be made to establish a bond that exists between the inhibitor and the protein at the active site cysteine. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.150 _refine.pdbx_overall_phase_error 17.400 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1977 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 218 _refine_hist.number_atoms_total 2204 _refine_hist.d_res_high 1.76 _refine_hist.d_res_low 31.78 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 2153 'X-RAY DIFFRACTION' ? f_angle_d 0.926 ? ? 2916 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.237 ? ? 1324 'X-RAY DIFFRACTION' ? f_chiral_restr 0.058 ? ? 314 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 371 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.7608 1.8048 1754 0.2136 96.00 0.2332 . . 134 . . . . 'X-RAY DIFFRACTION' . 1.8048 1.8536 1861 0.1934 100.00 0.2037 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.8536 1.9082 1852 0.1769 100.00 0.2552 . . 143 . . . . 'X-RAY DIFFRACTION' . 1.9082 1.9698 1851 0.1706 100.00 0.2092 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.9698 2.0402 1827 0.1573 100.00 0.1881 . . 140 . . . . 'X-RAY DIFFRACTION' . 2.0402 2.1218 1856 0.1542 100.00 0.2040 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.1218 2.2184 1868 0.1611 100.00 0.1841 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.2184 2.3353 1862 0.1505 100.00 0.1753 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.3353 2.4815 1852 0.1567 100.00 0.1803 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.4815 2.6731 1866 0.1601 100.00 0.2102 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.6731 2.9419 1879 0.1600 100.00 0.2242 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.9419 3.3672 1888 0.1659 100.00 0.1740 . . 145 . . . . 'X-RAY DIFFRACTION' . 3.3672 4.2407 1918 0.1404 100.00 0.1358 . . 146 . . . . 'X-RAY DIFFRACTION' . 4.2407 31.7808 1987 0.1575 100.00 0.1822 . . 153 . . . . # _struct.entry_id 5IAR _struct.title 'Caspase 3 V266W' _struct.pdbx_descriptor 'Caspase-3 (E.C.3.4.22.56), ACE-ASP-GLU-VAL-ASK' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IAR _struct_keywords.text ;Allostery, saturation mutagenesis, conformational selection, native ensemble, protein solvation, protein structure, protein dynamics, Hydrolase-Hydrolase Inhibitor complex ; _struct_keywords.pdbx_keywords 'Hydrolase/Hydrolase Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 56 ? GLY A 60 ? HIS A 56 GLY A 60 5 ? 5 HELX_P HELX_P2 AA2 GLY A 66 ? LEU A 81 ? GLY A 66 LEU A 81 1 ? 16 HELX_P HELX_P3 AA3 THR A 92 ? LYS A 105 ? THR A 92 LYS A 105 1 ? 14 HELX_P HELX_P4 AA4 LEU A 136 ? PHE A 142 ? LEU A 136 PHE A 142 1 ? 7 HELX_P HELX_P5 AA5 CYS A 148 ? THR A 152 ? CYS A 148 THR A 152 5 ? 5 HELX_P HELX_P6 AA6 TRP A 214 ? ALA A 227 ? TRP A 214 ALA A 227 1 ? 14 HELX_P HELX_P7 AA7 GLU A 231 ? PHE A 247 ? GLU A 231 PHE A 247 1 ? 17 HELX_P HELX_P8 AA8 ASP A 253 ? HIS A 257 ? ASP A 253 HIS A 257 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A GLN 161 OE1 ? ? ? 1_555 C NA . NA ? ? A GLN 161 A NA 301 1_555 ? ? ? ? ? ? ? 2.728 ? metalc2 metalc ? ? A SER 205 OG ? ? ? 1_555 C NA . NA ? ? A SER 205 A NA 301 1_555 ? ? ? ? ? ? ? 3.170 ? metalc3 metalc ? ? A TRP 206 O ? ? ? 1_555 C NA . NA ? ? A TRP 206 A NA 301 1_555 ? ? ? ? ? ? ? 2.831 ? covale1 covale both ? B ACE 1 C ? ? ? 1_555 B ASP 2 N ? ? B ACE 1 B ASP 2 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale both ? B ASP 5 C ? ? ? 1_555 B 0QE 6 C1 ? ? B ASP 5 B 0QE 6 1_555 ? ? ? ? ? ? ? 1.507 ? covale3 covale none ? B ASP 5 O ? ? ? 1_555 D DTT . S1 ? ? B ASP 5 B DTT 101 1_555 ? ? ? ? ? ? ? 1.486 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 84 ? ASN A 89 ? GLU A 84 ASN A 89 AA1 2 GLU A 43 ? ASN A 51 ? GLU A 43 ASN A 51 AA1 3 ARG A 111 ? LEU A 119 ? ARG A 111 LEU A 119 AA1 4 LYS A 156 ? GLN A 161 ? LYS A 156 GLN A 161 AA1 5 PHE A 193 ? TYR A 197 ? PHE A 193 TYR A 197 AA1 6 CYS A 264 ? SER A 267 ? CYS A 264 SER A 267 AA2 1 GLY A 122 ? GLU A 123 ? GLY A 122 GLU A 123 AA2 2 ILE A 126 ? GLY A 129 ? ILE A 126 GLY A 129 AA2 3 GLY A 132 ? ASP A 135 ? GLY A 132 ASP A 135 AA3 1 GLY A 212 ? SER A 213 ? GLY A 212 SER A 213 AA3 2 TRP A 206 ? ASN A 208 ? TRP A 206 ASN A 208 AA3 3 GLU B 3 ? VAL B 4 ? GLU B 3 VAL B 4 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 88 ? O LYS A 88 N ASN A 51 ? N ASN A 51 AA1 2 3 N ILE A 48 ? N ILE A 48 O VAL A 117 ? O VAL A 117 AA1 3 4 N PHE A 114 ? N PHE A 114 O LEU A 157 ? O LEU A 157 AA1 4 5 N PHE A 158 ? N PHE A 158 O LEU A 194 ? O LEU A 194 AA1 5 6 N TYR A 195 ? N TYR A 195 O TRP A 266 ? O TRP A 266 AA2 1 2 N GLU A 123 ? N GLU A 123 O ILE A 126 ? O ILE A 126 AA2 2 3 N ILE A 127 ? N ILE A 127 O VAL A 134 ? O VAL A 134 AA3 1 2 O GLY A 212 ? O GLY A 212 N ASN A 208 ? N ASN A 208 AA3 2 3 N ARG A 207 ? N ARG A 207 O GLU B 3 ? O GLU B 3 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NA 301 ? 6 'binding site for residue NA A 301' AC2 Software B DTT 101 ? 7 'binding site for residue DTT B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLN A 161 ? GLN A 161 . ? 1_555 ? 2 AC1 6 SER A 205 ? SER A 205 . ? 1_555 ? 3 AC1 6 TRP A 206 ? TRP A 206 . ? 1_555 ? 4 AC1 6 TRP A 214 ? TRP A 214 . ? 1_555 ? 5 AC1 6 PHE A 215 ? PHE A 215 . ? 1_555 ? 6 AC1 6 GLN A 261 ? GLN A 261 . ? 1_555 ? 7 AC2 7 GLY A 122 ? GLY A 122 . ? 1_555 ? 8 AC2 7 PHE A 128 ? PHE A 128 . ? 1_555 ? 9 AC2 7 CYS A 163 ? CYS A 163 . ? 1_555 ? 10 AC2 7 HOH E . ? HOH A 511 . ? 2_555 ? 11 AC2 7 ASP B 5 ? ASP B 5 . ? 1_555 ? 12 AC2 7 0QE B 6 ? 0QE B 6 . ? 1_555 ? 13 AC2 7 HOH F . ? HOH B 201 . ? 1_555 ? # _atom_sites.entry_id 5IAR _atom_sites.fract_transf_matrix[1][1] 0.014520 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011816 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010391 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S # loop_ _database_PDB_caveat.text ;Caspase should be connected to the chloromethyl ketone residual terminus of the inhibitor through hemithioacetal bond, but the model does not reflect the ideal hemithioacetal geometry. ; # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 ASP 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 ILE 13 13 ? ? ? A . n A 1 14 LYS 14 14 ? ? ? A . n A 1 15 ASN 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 GLU 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 ILE 20 20 ? ? ? A . n A 1 21 ILE 21 21 ? ? ? A . n A 1 22 HIS 22 22 ? ? ? A . n A 1 23 GLY 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 GLU 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 MET 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 CYS 148 148 148 CYS CYS A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 CYS 163 163 163 CYS CYS A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 CYS 170 170 170 CYS CYS A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 ASP 175 175 ? ? ? A . n A 1 176 SER 176 176 ? ? ? A . n A 1 177 GLY 177 177 ? ? ? A . n A 1 178 VAL 178 178 ? ? ? A . n A 1 179 ASP 179 179 ? ? ? A . n A 1 180 ASP 180 180 ? ? ? A . n A 1 181 ASP 181 181 ? ? ? A . n A 1 182 MET 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 CYS 184 184 ? ? ? A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 TYR 195 195 195 TYR TYR A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 TRP 206 206 206 TRP TRP A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 ASN 208 208 208 ASN ASN A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 TRP 214 214 214 TRP TRP A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 CYS 220 220 220 CYS CYS A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 GLN 225 225 225 GLN GLN A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 PHE 232 232 232 PHE PHE A . n A 1 233 MET 233 233 233 MET MET A . n A 1 234 HIS 234 234 234 HIS HIS A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 ASN 240 240 240 ASN ASN A . n A 1 241 ARG 241 241 241 ARG ARG A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 VAL 243 243 243 VAL VAL A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 THR 245 245 245 THR THR A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 PHE 247 247 247 PHE PHE A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 PHE 252 252 252 PHE PHE A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 HIS 257 257 257 HIS HIS A . n A 1 258 ALA 258 258 258 ALA ALA A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 GLN 261 261 261 GLN GLN A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 CYS 264 264 264 CYS CYS A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 TRP 266 266 266 TRP TRP A . n A 1 267 SER 267 267 267 SER SER A . n A 1 268 MET 268 268 268 MET MET A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 THR 270 270 270 THR THR A . n A 1 271 LYS 271 271 271 LYS LYS A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 TYR 274 274 274 TYR TYR A . n A 1 275 PHE 275 275 275 PHE PHE A . n A 1 276 TYR 276 276 276 TYR TYR A . n A 1 277 HIS 277 277 277 HIS HIS A . n A 1 278 LEU 278 278 278 LEU LEU A . n B 2 1 ACE 1 1 1 ACE ACE B . n B 2 2 ASP 2 2 2 ASP ASP B . n B 2 3 GLU 3 3 3 GLU GLU B . n B 2 4 VAL 4 4 4 VAL VAL B . n B 2 5 ASP 5 5 5 ASP ASP B . n B 2 6 0QE 6 6 6 0QE 0QE B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NA 1 301 1 NA NA A . D 4 DTT 1 101 573 DTT DTT B . E 5 HOH 1 401 215 HOH HOH A . E 5 HOH 2 402 32 HOH HOH A . E 5 HOH 3 403 88 HOH HOH A . E 5 HOH 4 404 186 HOH HOH A . E 5 HOH 5 405 46 HOH HOH A . E 5 HOH 6 406 78 HOH HOH A . E 5 HOH 7 407 199 HOH HOH A . E 5 HOH 8 408 174 HOH HOH A . E 5 HOH 9 409 80 HOH HOH A . E 5 HOH 10 410 150 HOH HOH A . E 5 HOH 11 411 160 HOH HOH A . E 5 HOH 12 412 37 HOH HOH A . E 5 HOH 13 413 11 HOH HOH A . E 5 HOH 14 414 175 HOH HOH A . E 5 HOH 15 415 91 HOH HOH A . E 5 HOH 16 416 178 HOH HOH A . E 5 HOH 17 417 98 HOH HOH A . E 5 HOH 18 418 182 HOH HOH A . E 5 HOH 19 419 62 HOH HOH A . E 5 HOH 20 420 77 HOH HOH A . E 5 HOH 21 421 7 HOH HOH A . E 5 HOH 22 422 60 HOH HOH A . E 5 HOH 23 423 83 HOH HOH A . E 5 HOH 24 424 100 HOH HOH A . E 5 HOH 25 425 70 HOH HOH A . E 5 HOH 26 426 125 HOH HOH A . E 5 HOH 27 427 140 HOH HOH A . E 5 HOH 28 428 202 HOH HOH A . E 5 HOH 29 429 95 HOH HOH A . E 5 HOH 30 430 201 HOH HOH A . E 5 HOH 31 431 16 HOH HOH A . E 5 HOH 32 432 31 HOH HOH A . E 5 HOH 33 433 108 HOH HOH A . E 5 HOH 34 434 13 HOH HOH A . E 5 HOH 35 435 79 HOH HOH A . E 5 HOH 36 436 145 HOH HOH A . E 5 HOH 37 437 17 HOH HOH A . E 5 HOH 38 438 56 HOH HOH A . E 5 HOH 39 439 8 HOH HOH A . E 5 HOH 40 440 33 HOH HOH A . E 5 HOH 41 441 15 HOH HOH A . E 5 HOH 42 442 4 HOH HOH A . E 5 HOH 43 443 12 HOH HOH A . E 5 HOH 44 444 76 HOH HOH A . E 5 HOH 45 445 92 HOH HOH A . E 5 HOH 46 446 3 HOH HOH A . E 5 HOH 47 447 154 HOH HOH A . E 5 HOH 48 448 35 HOH HOH A . E 5 HOH 49 449 87 HOH HOH A . E 5 HOH 50 450 45 HOH HOH A . E 5 HOH 51 451 55 HOH HOH A . E 5 HOH 52 452 195 HOH HOH A . E 5 HOH 53 453 104 HOH HOH A . E 5 HOH 54 454 169 HOH HOH A . E 5 HOH 55 455 189 HOH HOH A . E 5 HOH 56 456 90 HOH HOH A . E 5 HOH 57 457 26 HOH HOH A . E 5 HOH 58 458 24 HOH HOH A . E 5 HOH 59 459 6 HOH HOH A . E 5 HOH 60 460 28 HOH HOH A . E 5 HOH 61 461 180 HOH HOH A . E 5 HOH 62 462 57 HOH HOH A . E 5 HOH 63 463 124 HOH HOH A . E 5 HOH 64 464 71 HOH HOH A . E 5 HOH 65 465 181 HOH HOH A . E 5 HOH 66 466 105 HOH HOH A . E 5 HOH 67 467 20 HOH HOH A . E 5 HOH 68 468 63 HOH HOH A . E 5 HOH 69 469 29 HOH HOH A . E 5 HOH 70 470 38 HOH HOH A . E 5 HOH 71 471 61 HOH HOH A . E 5 HOH 72 472 128 HOH HOH A . E 5 HOH 73 473 93 HOH HOH A . E 5 HOH 74 474 82 HOH HOH A . E 5 HOH 75 475 50 HOH HOH A . E 5 HOH 76 476 22 HOH HOH A . E 5 HOH 77 477 48 HOH HOH A . E 5 HOH 78 478 157 HOH HOH A . E 5 HOH 79 479 143 HOH HOH A . E 5 HOH 80 480 5 HOH HOH A . E 5 HOH 81 481 170 HOH HOH A . E 5 HOH 82 482 44 HOH HOH A . E 5 HOH 83 483 19 HOH HOH A . E 5 HOH 84 484 30 HOH HOH A . E 5 HOH 85 485 109 HOH HOH A . E 5 HOH 86 486 75 HOH HOH A . E 5 HOH 87 487 121 HOH HOH A . E 5 HOH 88 488 21 HOH HOH A . E 5 HOH 89 489 18 HOH HOH A . E 5 HOH 90 490 167 HOH HOH A . E 5 HOH 91 491 72 HOH HOH A . E 5 HOH 92 492 49 HOH HOH A . E 5 HOH 93 493 190 HOH HOH A . E 5 HOH 94 494 159 HOH HOH A . E 5 HOH 95 495 173 HOH HOH A . E 5 HOH 96 496 39 HOH HOH A . E 5 HOH 97 497 216 HOH HOH A . E 5 HOH 98 498 25 HOH HOH A . E 5 HOH 99 499 9 HOH HOH A . E 5 HOH 100 500 85 HOH HOH A . E 5 HOH 101 501 107 HOH HOH A . E 5 HOH 102 502 47 HOH HOH A . E 5 HOH 103 503 135 HOH HOH A . E 5 HOH 104 504 86 HOH HOH A . E 5 HOH 105 505 81 HOH HOH A . E 5 HOH 106 506 68 HOH HOH A . E 5 HOH 107 507 123 HOH HOH A . E 5 HOH 108 508 101 HOH HOH A . E 5 HOH 109 509 10 HOH HOH A . E 5 HOH 110 510 59 HOH HOH A . E 5 HOH 111 511 209 HOH HOH A . E 5 HOH 112 512 219 HOH HOH A . E 5 HOH 113 513 127 HOH HOH A . E 5 HOH 114 514 51 HOH HOH A . E 5 HOH 115 515 162 HOH HOH A . E 5 HOH 116 516 172 HOH HOH A . E 5 HOH 117 517 208 HOH HOH A . E 5 HOH 118 518 53 HOH HOH A . E 5 HOH 119 519 52 HOH HOH A . E 5 HOH 120 520 211 HOH HOH A . E 5 HOH 121 521 171 HOH HOH A . E 5 HOH 122 522 217 HOH HOH A . E 5 HOH 123 523 66 HOH HOH A . E 5 HOH 124 524 73 HOH HOH A . E 5 HOH 125 525 200 HOH HOH A . E 5 HOH 126 526 129 HOH HOH A . E 5 HOH 127 527 163 HOH HOH A . E 5 HOH 128 528 89 HOH HOH A . E 5 HOH 129 529 225 HOH HOH A . E 5 HOH 130 530 136 HOH HOH A . E 5 HOH 131 531 161 HOH HOH A . E 5 HOH 132 532 58 HOH HOH A . E 5 HOH 133 533 119 HOH HOH A . E 5 HOH 134 534 67 HOH HOH A . E 5 HOH 135 535 179 HOH HOH A . E 5 HOH 136 536 213 HOH HOH A . E 5 HOH 137 537 42 HOH HOH A . E 5 HOH 138 538 122 HOH HOH A . E 5 HOH 139 539 36 HOH HOH A . E 5 HOH 140 540 210 HOH HOH A . E 5 HOH 141 541 106 HOH HOH A . E 5 HOH 142 542 158 HOH HOH A . E 5 HOH 143 543 192 HOH HOH A . E 5 HOH 144 544 147 HOH HOH A . E 5 HOH 145 545 40 HOH HOH A . E 5 HOH 146 546 152 HOH HOH A . E 5 HOH 147 547 69 HOH HOH A . E 5 HOH 148 548 227 HOH HOH A . E 5 HOH 149 549 74 HOH HOH A . E 5 HOH 150 550 164 HOH HOH A . E 5 HOH 151 551 27 HOH HOH A . E 5 HOH 152 552 139 HOH HOH A . E 5 HOH 153 553 99 HOH HOH A . E 5 HOH 154 554 34 HOH HOH A . E 5 HOH 155 555 149 HOH HOH A . E 5 HOH 156 556 2 HOH HOH A . E 5 HOH 157 557 188 HOH HOH A . E 5 HOH 158 558 116 HOH HOH A . E 5 HOH 159 559 212 HOH HOH A . E 5 HOH 160 560 218 HOH HOH A . E 5 HOH 161 561 54 HOH HOH A . E 5 HOH 162 562 41 HOH HOH A . E 5 HOH 163 563 222 HOH HOH A . E 5 HOH 164 564 111 HOH HOH A . E 5 HOH 165 565 214 HOH HOH A . E 5 HOH 166 566 183 HOH HOH A . E 5 HOH 167 567 184 HOH HOH A . E 5 HOH 168 568 141 HOH HOH A . E 5 HOH 169 569 14 HOH HOH A . E 5 HOH 170 570 126 HOH HOH A . E 5 HOH 171 571 117 HOH HOH A . E 5 HOH 172 572 148 HOH HOH A . E 5 HOH 173 573 110 HOH HOH A . E 5 HOH 174 574 194 HOH HOH A . E 5 HOH 175 575 224 HOH HOH A . E 5 HOH 176 576 96 HOH HOH A . E 5 HOH 177 577 144 HOH HOH A . E 5 HOH 178 578 185 HOH HOH A . E 5 HOH 179 579 166 HOH HOH A . E 5 HOH 180 580 103 HOH HOH A . E 5 HOH 181 581 176 HOH HOH A . E 5 HOH 182 582 165 HOH HOH A . E 5 HOH 183 583 221 HOH HOH A . E 5 HOH 184 584 198 HOH HOH A . E 5 HOH 185 585 23 HOH HOH A . E 5 HOH 186 586 223 HOH HOH A . E 5 HOH 187 587 155 HOH HOH A . E 5 HOH 188 588 102 HOH HOH A . E 5 HOH 189 589 94 HOH HOH A . E 5 HOH 190 590 97 HOH HOH A . E 5 HOH 191 591 156 HOH HOH A . E 5 HOH 192 592 151 HOH HOH A . E 5 HOH 193 593 137 HOH HOH A . E 5 HOH 194 594 142 HOH HOH A . E 5 HOH 195 595 138 HOH HOH A . E 5 HOH 196 596 197 HOH HOH A . E 5 HOH 197 597 196 HOH HOH A . E 5 HOH 198 598 191 HOH HOH A . E 5 HOH 199 599 118 HOH HOH A . E 5 HOH 200 600 206 HOH HOH A . E 5 HOH 201 601 120 HOH HOH A . E 5 HOH 202 602 112 HOH HOH A . E 5 HOH 203 603 226 HOH HOH A . E 5 HOH 204 604 114 HOH HOH A . E 5 HOH 205 605 84 HOH HOH A . E 5 HOH 206 606 193 HOH HOH A . E 5 HOH 207 607 113 HOH HOH A . E 5 HOH 208 608 177 HOH HOH A . E 5 HOH 209 609 43 HOH HOH A . E 5 HOH 210 610 220 HOH HOH A . F 5 HOH 1 201 64 HOH HOH B . F 5 HOH 2 202 130 HOH HOH B . F 5 HOH 3 203 65 HOH HOH B . F 5 HOH 4 204 131 HOH HOH B . F 5 HOH 5 205 133 HOH HOH B . F 5 HOH 6 206 168 HOH HOH B . F 5 HOH 7 207 132 HOH HOH B . F 5 HOH 8 208 134 HOH HOH B . # _pdbx_molecule_features.prd_id PRD_000238 _pdbx_molecule_features.name Ac-Asp-Glu-Val-Asp-CMK _pdbx_molecule_features.type Peptide-like _pdbx_molecule_features.class Inhibitor _pdbx_molecule_features.details ? # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_000238 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7480 ? 1 MORE -26 ? 1 'SSA (A^2)' 19360 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 570 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLN 161 ? A GLN 161 ? 1_555 NA ? C NA . ? A NA 301 ? 1_555 OG ? A SER 205 ? A SER 205 ? 1_555 66.9 ? 2 OE1 ? A GLN 161 ? A GLN 161 ? 1_555 NA ? C NA . ? A NA 301 ? 1_555 O ? A TRP 206 ? A TRP 206 ? 1_555 110.9 ? 3 OG ? A SER 205 ? A SER 205 ? 1_555 NA ? C NA . ? A NA 301 ? 1_555 O ? A TRP 206 ? A TRP 206 ? 1_555 91.1 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-10-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 80 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 5 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 5 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 5 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.93 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.63 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 64 ? ? -103.24 72.42 2 1 LYS A 229 ? ? -136.15 -40.07 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 53 ? N A A LYS 53 N 2 1 Y 0 A LYS 53 ? CA A A LYS 53 CA 3 1 Y 0 A LYS 53 ? C A A LYS 53 C 4 1 Y 0 A LYS 53 ? O A A LYS 53 O 5 1 Y 0 A LYS 53 ? CB A A LYS 53 CB 6 1 Y 0 A LYS 53 ? CG A A LYS 53 CG 7 1 Y 0 A LYS 53 ? CD A A LYS 53 CD 8 1 Y 0 A LYS 53 ? CE A A LYS 53 CE 9 1 Y 0 A LYS 53 ? NZ A A LYS 53 NZ 10 1 Y 1 A LEU 278 ? CG ? A LEU 278 CG 11 1 Y 1 A LEU 278 ? CD1 ? A LEU 278 CD1 12 1 Y 1 A LEU 278 ? CD2 ? A LEU 278 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A ASP 9 ? A ASP 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A ILE 13 ? A ILE 13 14 1 Y 1 A LYS 14 ? A LYS 14 15 1 Y 1 A ASN 15 ? A ASN 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A GLU 17 ? A GLU 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A ILE 20 ? A ILE 20 21 1 Y 1 A ILE 21 ? A ILE 21 22 1 Y 1 A HIS 22 ? A HIS 22 23 1 Y 1 A GLY 23 ? A GLY 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A GLU 25 ? A GLU 25 26 1 Y 1 A SER 26 ? A SER 26 27 1 Y 1 A MET 27 ? A MET 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A ASP 175 ? A ASP 175 30 1 Y 1 A SER 176 ? A SER 176 31 1 Y 1 A GLY 177 ? A GLY 177 32 1 Y 1 A VAL 178 ? A VAL 178 33 1 Y 1 A ASP 179 ? A ASP 179 34 1 Y 1 A ASP 180 ? A ASP 180 35 1 Y 1 A ASP 181 ? A ASP 181 36 1 Y 1 A MET 182 ? A MET 182 37 1 Y 1 A ALA 183 ? A ALA 183 38 1 Y 1 A CYS 184 ? A CYS 184 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SODIUM ION' NA 4 2,3-DIHYDROXY-1,4-DITHIOBUTANE DTT 5 water HOH #