data_5ICG # _entry.id 5ICG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ICG pdb_00005icg 10.2210/pdb5icg/pdb WWPDB D_1000218607 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-08 2 'Structure model' 1 1 2016-10-12 3 'Structure model' 1 2 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ICG _pdbx_database_status.recvd_initial_deposition_date 2016-02-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5ICC PDB . unspecified 5ICE PDB . unspecified 5ICF PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Robin, A.Y.' 1 'Graindorge, M.' 2 'Giustini, C.' 3 'Dumas, R.' 4 'Matringe, M.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plant J.' _citation.journal_id_ASTM PLJUED _citation.journal_id_CSD 2117 _citation.journal_id_ISSN 1365-313X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 87 _citation.language ? _citation.page_first 641 _citation.page_last 653 _citation.title ;Crystal structure of norcoclaurine-6-O-methyltransferase, a key rate-limiting step in the synthesis of benzylisoquinoline alkaloids. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/tpj.13225 _citation.pdbx_database_id_PubMed 27232113 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Robin, A.Y.' 1 ? primary 'Giustini, C.' 2 ? primary 'Graindorge, M.' 3 ? primary 'Matringe, M.' 4 ? primary 'Dumas, R.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '(S)-norcoclaurine 6-O-methyltransferase' 39531.660 1 2.1.1.128 ? ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 3 water nat water 18.015 51 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMVMINKENLSSQAKLWNFIYGFADSLVLKSAVQLDLANIIHNHGSPMTLSELSLHLPSQPVNQDALYRVLRYLVHMKL FTKSSIDGELRYGLAPPAKFLVKGWDKCMLGAILTITDKDFMAPWHYLKEGILNDGSTSTAFEKALGTNIWDYMAEHPEK NQLFNEGMANDTRLIMSALVKECSSMFDGITTIVDVGGGTGTAVRNIAKAFPHIKCTVYDLPHVIADSPGYTEINSIQGD MFKYIPNADAIMMKCILHDWDDKECIEILKRCKDAVPRDGGKVIIIDIILDVKSEHPYTKMRLTLDLDMMLNTGGKERTE EEWKKLIHDAGYKGYKITHISAVQSVIEAYPY ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMVMINKENLSSQAKLWNFIYGFADSLVLKSAVQLDLANIIHNHGSPMTLSELSLHLPSQPVNQDALYRVLRYLVHMKL FTKSSIDGELRYGLAPPAKFLVKGWDKCMLGAILTITDKDFMAPWHYLKEGILNDGSTSTAFEKALGTNIWDYMAEHPEK NQLFNEGMANDTRLIMSALVKECSSMFDGITTIVDVGGGTGTAVRNIAKAFPHIKCTVYDLPHVIADSPGYTEINSIQGD MFKYIPNADAIMMKCILHDWDDKECIEILKRCKDAVPRDGGKVIIIDIILDVKSEHPYTKMRLTLDLDMMLNTGGKERTE EEWKKLIHDAGYKGYKITHISAVQSVIEAYPY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 VAL n 1 5 MET n 1 6 ILE n 1 7 ASN n 1 8 LYS n 1 9 GLU n 1 10 ASN n 1 11 LEU n 1 12 SER n 1 13 SER n 1 14 GLN n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 TRP n 1 19 ASN n 1 20 PHE n 1 21 ILE n 1 22 TYR n 1 23 GLY n 1 24 PHE n 1 25 ALA n 1 26 ASP n 1 27 SER n 1 28 LEU n 1 29 VAL n 1 30 LEU n 1 31 LYS n 1 32 SER n 1 33 ALA n 1 34 VAL n 1 35 GLN n 1 36 LEU n 1 37 ASP n 1 38 LEU n 1 39 ALA n 1 40 ASN n 1 41 ILE n 1 42 ILE n 1 43 HIS n 1 44 ASN n 1 45 HIS n 1 46 GLY n 1 47 SER n 1 48 PRO n 1 49 MET n 1 50 THR n 1 51 LEU n 1 52 SER n 1 53 GLU n 1 54 LEU n 1 55 SER n 1 56 LEU n 1 57 HIS n 1 58 LEU n 1 59 PRO n 1 60 SER n 1 61 GLN n 1 62 PRO n 1 63 VAL n 1 64 ASN n 1 65 GLN n 1 66 ASP n 1 67 ALA n 1 68 LEU n 1 69 TYR n 1 70 ARG n 1 71 VAL n 1 72 LEU n 1 73 ARG n 1 74 TYR n 1 75 LEU n 1 76 VAL n 1 77 HIS n 1 78 MET n 1 79 LYS n 1 80 LEU n 1 81 PHE n 1 82 THR n 1 83 LYS n 1 84 SER n 1 85 SER n 1 86 ILE n 1 87 ASP n 1 88 GLY n 1 89 GLU n 1 90 LEU n 1 91 ARG n 1 92 TYR n 1 93 GLY n 1 94 LEU n 1 95 ALA n 1 96 PRO n 1 97 PRO n 1 98 ALA n 1 99 LYS n 1 100 PHE n 1 101 LEU n 1 102 VAL n 1 103 LYS n 1 104 GLY n 1 105 TRP n 1 106 ASP n 1 107 LYS n 1 108 CYS n 1 109 MET n 1 110 LEU n 1 111 GLY n 1 112 ALA n 1 113 ILE n 1 114 LEU n 1 115 THR n 1 116 ILE n 1 117 THR n 1 118 ASP n 1 119 LYS n 1 120 ASP n 1 121 PHE n 1 122 MET n 1 123 ALA n 1 124 PRO n 1 125 TRP n 1 126 HIS n 1 127 TYR n 1 128 LEU n 1 129 LYS n 1 130 GLU n 1 131 GLY n 1 132 ILE n 1 133 LEU n 1 134 ASN n 1 135 ASP n 1 136 GLY n 1 137 SER n 1 138 THR n 1 139 SER n 1 140 THR n 1 141 ALA n 1 142 PHE n 1 143 GLU n 1 144 LYS n 1 145 ALA n 1 146 LEU n 1 147 GLY n 1 148 THR n 1 149 ASN n 1 150 ILE n 1 151 TRP n 1 152 ASP n 1 153 TYR n 1 154 MET n 1 155 ALA n 1 156 GLU n 1 157 HIS n 1 158 PRO n 1 159 GLU n 1 160 LYS n 1 161 ASN n 1 162 GLN n 1 163 LEU n 1 164 PHE n 1 165 ASN n 1 166 GLU n 1 167 GLY n 1 168 MET n 1 169 ALA n 1 170 ASN n 1 171 ASP n 1 172 THR n 1 173 ARG n 1 174 LEU n 1 175 ILE n 1 176 MET n 1 177 SER n 1 178 ALA n 1 179 LEU n 1 180 VAL n 1 181 LYS n 1 182 GLU n 1 183 CYS n 1 184 SER n 1 185 SER n 1 186 MET n 1 187 PHE n 1 188 ASP n 1 189 GLY n 1 190 ILE n 1 191 THR n 1 192 THR n 1 193 ILE n 1 194 VAL n 1 195 ASP n 1 196 VAL n 1 197 GLY n 1 198 GLY n 1 199 GLY n 1 200 THR n 1 201 GLY n 1 202 THR n 1 203 ALA n 1 204 VAL n 1 205 ARG n 1 206 ASN n 1 207 ILE n 1 208 ALA n 1 209 LYS n 1 210 ALA n 1 211 PHE n 1 212 PRO n 1 213 HIS n 1 214 ILE n 1 215 LYS n 1 216 CYS n 1 217 THR n 1 218 VAL n 1 219 TYR n 1 220 ASP n 1 221 LEU n 1 222 PRO n 1 223 HIS n 1 224 VAL n 1 225 ILE n 1 226 ALA n 1 227 ASP n 1 228 SER n 1 229 PRO n 1 230 GLY n 1 231 TYR n 1 232 THR n 1 233 GLU n 1 234 ILE n 1 235 ASN n 1 236 SER n 1 237 ILE n 1 238 GLN n 1 239 GLY n 1 240 ASP n 1 241 MET n 1 242 PHE n 1 243 LYS n 1 244 TYR n 1 245 ILE n 1 246 PRO n 1 247 ASN n 1 248 ALA n 1 249 ASP n 1 250 ALA n 1 251 ILE n 1 252 MET n 1 253 MET n 1 254 LYS n 1 255 CYS n 1 256 ILE n 1 257 LEU n 1 258 HIS n 1 259 ASP n 1 260 TRP n 1 261 ASP n 1 262 ASP n 1 263 LYS n 1 264 GLU n 1 265 CYS n 1 266 ILE n 1 267 GLU n 1 268 ILE n 1 269 LEU n 1 270 LYS n 1 271 ARG n 1 272 CYS n 1 273 LYS n 1 274 ASP n 1 275 ALA n 1 276 VAL n 1 277 PRO n 1 278 ARG n 1 279 ASP n 1 280 GLY n 1 281 GLY n 1 282 LYS n 1 283 VAL n 1 284 ILE n 1 285 ILE n 1 286 ILE n 1 287 ASP n 1 288 ILE n 1 289 ILE n 1 290 LEU n 1 291 ASP n 1 292 VAL n 1 293 LYS n 1 294 SER n 1 295 GLU n 1 296 HIS n 1 297 PRO n 1 298 TYR n 1 299 THR n 1 300 LYS n 1 301 MET n 1 302 ARG n 1 303 LEU n 1 304 THR n 1 305 LEU n 1 306 ASP n 1 307 LEU n 1 308 ASP n 1 309 MET n 1 310 MET n 1 311 LEU n 1 312 ASN n 1 313 THR n 1 314 GLY n 1 315 GLY n 1 316 LYS n 1 317 GLU n 1 318 ARG n 1 319 THR n 1 320 GLU n 1 321 GLU n 1 322 GLU n 1 323 TRP n 1 324 LYS n 1 325 LYS n 1 326 LEU n 1 327 ILE n 1 328 HIS n 1 329 ASP n 1 330 ALA n 1 331 GLY n 1 332 TYR n 1 333 LYS n 1 334 GLY n 1 335 TYR n 1 336 LYS n 1 337 ILE n 1 338 THR n 1 339 HIS n 1 340 ILE n 1 341 SER n 1 342 ALA n 1 343 VAL n 1 344 GLN n 1 345 SER n 1 346 VAL n 1 347 ILE n 1 348 GLU n 1 349 ALA n 1 350 TYR n 1 351 PRO n 1 352 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 352 _entity_src_gen.gene_src_common_name 'Yellow meadow rue' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thalictrum flavum subsp. glaucum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 150095 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 ALA 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 VAL 4 2 ? ? ? A . n A 1 5 MET 5 3 ? ? ? A . n A 1 6 ILE 6 4 ? ? ? A . n A 1 7 ASN 7 5 ? ? ? A . n A 1 8 LYS 8 6 ? ? ? A . n A 1 9 GLU 9 7 ? ? ? A . n A 1 10 ASN 10 8 8 ASN ASN A . n A 1 11 LEU 11 9 9 LEU LEU A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 SER 13 11 11 SER SER A . n A 1 14 GLN 14 12 12 GLN GLN A . n A 1 15 ALA 15 13 13 ALA ALA A . n A 1 16 LYS 16 14 14 LYS LYS A . n A 1 17 LEU 17 15 15 LEU LEU A . n A 1 18 TRP 18 16 16 TRP TRP A . n A 1 19 ASN 19 17 17 ASN ASN A . n A 1 20 PHE 20 18 18 PHE PHE A . n A 1 21 ILE 21 19 19 ILE ILE A . n A 1 22 TYR 22 20 20 TYR TYR A . n A 1 23 GLY 23 21 21 GLY GLY A . n A 1 24 PHE 24 22 22 PHE PHE A . n A 1 25 ALA 25 23 23 ALA ALA A . n A 1 26 ASP 26 24 24 ASP ASP A . n A 1 27 SER 27 25 25 SER SER A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 VAL 29 27 27 VAL VAL A . n A 1 30 LEU 30 28 28 LEU LEU A . n A 1 31 LYS 31 29 29 LYS LYS A . n A 1 32 SER 32 30 30 SER SER A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 VAL 34 32 32 VAL VAL A . n A 1 35 GLN 35 33 33 GLN GLN A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 ASP 37 35 35 ASP ASP A . n A 1 38 LEU 38 36 36 LEU LEU A . n A 1 39 ALA 39 37 37 ALA ALA A . n A 1 40 ASN 40 38 38 ASN ASN A . n A 1 41 ILE 41 39 39 ILE ILE A . n A 1 42 ILE 42 40 40 ILE ILE A . n A 1 43 HIS 43 41 41 HIS HIS A . n A 1 44 ASN 44 42 42 ASN ASN A . n A 1 45 HIS 45 43 43 HIS HIS A . n A 1 46 GLY 46 44 44 GLY GLY A . n A 1 47 SER 47 45 45 SER SER A . n A 1 48 PRO 48 46 46 PRO PRO A . n A 1 49 MET 49 47 47 MET MET A . n A 1 50 THR 50 48 48 THR THR A . n A 1 51 LEU 51 49 49 LEU LEU A . n A 1 52 SER 52 50 50 SER SER A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 LEU 54 52 52 LEU LEU A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 LEU 56 54 54 LEU LEU A . n A 1 57 HIS 57 55 55 HIS HIS A . n A 1 58 LEU 58 56 56 LEU LEU A . n A 1 59 PRO 59 57 57 PRO PRO A . n A 1 60 SER 60 58 58 SER SER A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 PRO 62 60 60 PRO PRO A . n A 1 63 VAL 63 61 61 VAL VAL A . n A 1 64 ASN 64 62 62 ASN ASN A . n A 1 65 GLN 65 63 63 GLN GLN A . n A 1 66 ASP 66 64 64 ASP ASP A . n A 1 67 ALA 67 65 65 ALA ALA A . n A 1 68 LEU 68 66 66 LEU LEU A . n A 1 69 TYR 69 67 67 TYR TYR A . n A 1 70 ARG 70 68 68 ARG ARG A . n A 1 71 VAL 71 69 69 VAL VAL A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 ARG 73 71 71 ARG ARG A . n A 1 74 TYR 74 72 72 TYR TYR A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 VAL 76 74 74 VAL VAL A . n A 1 77 HIS 77 75 75 HIS HIS A . n A 1 78 MET 78 76 76 MET MET A . n A 1 79 LYS 79 77 77 LYS LYS A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 PHE 81 79 79 PHE PHE A . n A 1 82 THR 82 80 80 THR THR A . n A 1 83 LYS 83 81 81 LYS LYS A . n A 1 84 SER 84 82 82 SER SER A . n A 1 85 SER 85 83 83 SER SER A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 ASP 87 85 85 ASP ASP A . n A 1 88 GLY 88 86 86 GLY GLY A . n A 1 89 GLU 89 87 87 GLU GLU A . n A 1 90 LEU 90 88 88 LEU LEU A . n A 1 91 ARG 91 89 89 ARG ARG A . n A 1 92 TYR 92 90 90 TYR TYR A . n A 1 93 GLY 93 91 91 GLY GLY A . n A 1 94 LEU 94 92 92 LEU LEU A . n A 1 95 ALA 95 93 93 ALA ALA A . n A 1 96 PRO 96 94 94 PRO PRO A . n A 1 97 PRO 97 95 95 PRO PRO A . n A 1 98 ALA 98 96 96 ALA ALA A . n A 1 99 LYS 99 97 97 LYS LYS A . n A 1 100 PHE 100 98 98 PHE PHE A . n A 1 101 LEU 101 99 99 LEU LEU A . n A 1 102 VAL 102 100 100 VAL VAL A . n A 1 103 LYS 103 101 101 LYS LYS A . n A 1 104 GLY 104 102 102 GLY GLY A . n A 1 105 TRP 105 103 103 TRP TRP A . n A 1 106 ASP 106 104 104 ASP ASP A . n A 1 107 LYS 107 105 105 LYS LYS A . n A 1 108 CYS 108 106 106 CYS CYS A . n A 1 109 MET 109 107 107 MET MET A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 GLY 111 109 109 GLY GLY A . n A 1 112 ALA 112 110 110 ALA ALA A . n A 1 113 ILE 113 111 111 ILE ILE A . n A 1 114 LEU 114 112 112 LEU LEU A . n A 1 115 THR 115 113 113 THR THR A . n A 1 116 ILE 116 114 114 ILE ILE A . n A 1 117 THR 117 115 115 THR THR A . n A 1 118 ASP 118 116 116 ASP ASP A . n A 1 119 LYS 119 117 117 LYS LYS A . n A 1 120 ASP 120 118 118 ASP ASP A . n A 1 121 PHE 121 119 119 PHE PHE A . n A 1 122 MET 122 120 120 MET MET A . n A 1 123 ALA 123 121 121 ALA ALA A . n A 1 124 PRO 124 122 122 PRO PRO A . n A 1 125 TRP 125 123 123 TRP TRP A . n A 1 126 HIS 126 124 124 HIS HIS A . n A 1 127 TYR 127 125 125 TYR TYR A . n A 1 128 LEU 128 126 126 LEU LEU A . n A 1 129 LYS 129 127 127 LYS LYS A . n A 1 130 GLU 130 128 128 GLU GLU A . n A 1 131 GLY 131 129 129 GLY GLY A . n A 1 132 ILE 132 130 130 ILE ILE A . n A 1 133 LEU 133 131 131 LEU LEU A . n A 1 134 ASN 134 132 132 ASN ASN A . n A 1 135 ASP 135 133 133 ASP ASP A . n A 1 136 GLY 136 134 ? ? ? A . n A 1 137 SER 137 135 135 SER SER A . n A 1 138 THR 138 136 136 THR THR A . n A 1 139 SER 139 137 137 SER SER A . n A 1 140 THR 140 138 138 THR THR A . n A 1 141 ALA 141 139 139 ALA ALA A . n A 1 142 PHE 142 140 140 PHE PHE A . n A 1 143 GLU 143 141 141 GLU GLU A . n A 1 144 LYS 144 142 142 LYS LYS A . n A 1 145 ALA 145 143 143 ALA ALA A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 GLY 147 145 145 GLY GLY A . n A 1 148 THR 148 146 146 THR THR A . n A 1 149 ASN 149 147 147 ASN ASN A . n A 1 150 ILE 150 148 148 ILE ILE A . n A 1 151 TRP 151 149 149 TRP TRP A . n A 1 152 ASP 152 150 150 ASP ASP A . n A 1 153 TYR 153 151 151 TYR TYR A . n A 1 154 MET 154 152 152 MET MET A . n A 1 155 ALA 155 153 153 ALA ALA A . n A 1 156 GLU 156 154 154 GLU GLU A . n A 1 157 HIS 157 155 155 HIS HIS A . n A 1 158 PRO 158 156 156 PRO PRO A . n A 1 159 GLU 159 157 157 GLU GLU A . n A 1 160 LYS 160 158 158 LYS LYS A . n A 1 161 ASN 161 159 159 ASN ASN A . n A 1 162 GLN 162 160 160 GLN GLN A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 PHE 164 162 162 PHE PHE A . n A 1 165 ASN 165 163 163 ASN ASN A . n A 1 166 GLU 166 164 164 GLU GLU A . n A 1 167 GLY 167 165 165 GLY GLY A . n A 1 168 MET 168 166 166 MET MET A . n A 1 169 ALA 169 167 167 ALA ALA A . n A 1 170 ASN 170 168 168 ASN ASN A . n A 1 171 ASP 171 169 169 ASP ASP A . n A 1 172 THR 172 170 170 THR THR A . n A 1 173 ARG 173 171 171 ARG ARG A . n A 1 174 LEU 174 172 172 LEU LEU A . n A 1 175 ILE 175 173 173 ILE ILE A . n A 1 176 MET 176 174 174 MET MET A . n A 1 177 SER 177 175 175 SER SER A . n A 1 178 ALA 178 176 176 ALA ALA A . n A 1 179 LEU 179 177 177 LEU LEU A . n A 1 180 VAL 180 178 178 VAL VAL A . n A 1 181 LYS 181 179 179 LYS LYS A . n A 1 182 GLU 182 180 180 GLU GLU A . n A 1 183 CYS 183 181 181 CYS CYS A . n A 1 184 SER 184 182 182 SER SER A . n A 1 185 SER 185 183 183 SER SER A . n A 1 186 MET 186 184 184 MET MET A . n A 1 187 PHE 187 185 185 PHE PHE A . n A 1 188 ASP 188 186 186 ASP ASP A . n A 1 189 GLY 189 187 187 GLY GLY A . n A 1 190 ILE 190 188 188 ILE ILE A . n A 1 191 THR 191 189 189 THR THR A . n A 1 192 THR 192 190 190 THR THR A . n A 1 193 ILE 193 191 191 ILE ILE A . n A 1 194 VAL 194 192 192 VAL VAL A . n A 1 195 ASP 195 193 193 ASP ASP A . n A 1 196 VAL 196 194 194 VAL VAL A . n A 1 197 GLY 197 195 195 GLY GLY A . n A 1 198 GLY 198 196 196 GLY GLY A . n A 1 199 GLY 199 197 197 GLY GLY A . n A 1 200 THR 200 198 198 THR THR A . n A 1 201 GLY 201 199 199 GLY GLY A . n A 1 202 THR 202 200 200 THR THR A . n A 1 203 ALA 203 201 201 ALA ALA A . n A 1 204 VAL 204 202 202 VAL VAL A . n A 1 205 ARG 205 203 203 ARG ARG A . n A 1 206 ASN 206 204 204 ASN ASN A . n A 1 207 ILE 207 205 205 ILE ILE A . n A 1 208 ALA 208 206 206 ALA ALA A . n A 1 209 LYS 209 207 207 LYS LYS A . n A 1 210 ALA 210 208 208 ALA ALA A . n A 1 211 PHE 211 209 209 PHE PHE A . n A 1 212 PRO 212 210 210 PRO PRO A . n A 1 213 HIS 213 211 211 HIS HIS A . n A 1 214 ILE 214 212 212 ILE ILE A . n A 1 215 LYS 215 213 213 LYS LYS A . n A 1 216 CYS 216 214 214 CYS CYS A . n A 1 217 THR 217 215 215 THR THR A . n A 1 218 VAL 218 216 216 VAL VAL A . n A 1 219 TYR 219 217 217 TYR TYR A . n A 1 220 ASP 220 218 218 ASP ASP A . n A 1 221 LEU 221 219 219 LEU LEU A . n A 1 222 PRO 222 220 220 PRO PRO A . n A 1 223 HIS 223 221 221 HIS HIS A . n A 1 224 VAL 224 222 222 VAL VAL A . n A 1 225 ILE 225 223 223 ILE ILE A . n A 1 226 ALA 226 224 ? ? ? A . n A 1 227 ASP 227 225 ? ? ? A . n A 1 228 SER 228 226 ? ? ? A . n A 1 229 PRO 229 227 ? ? ? A . n A 1 230 GLY 230 228 ? ? ? A . n A 1 231 TYR 231 229 ? ? ? A . n A 1 232 THR 232 230 ? ? ? A . n A 1 233 GLU 233 231 ? ? ? A . n A 1 234 ILE 234 232 ? ? ? A . n A 1 235 ASN 235 233 ? ? ? A . n A 1 236 SER 236 234 ? ? ? A . n A 1 237 ILE 237 235 ? ? ? A . n A 1 238 GLN 238 236 ? ? ? A . n A 1 239 GLY 239 237 ? ? ? A . n A 1 240 ASP 240 238 ? ? ? A . n A 1 241 MET 241 239 ? ? ? A . n A 1 242 PHE 242 240 ? ? ? A . n A 1 243 LYS 243 241 ? ? ? A . n A 1 244 TYR 244 242 ? ? ? A . n A 1 245 ILE 245 243 243 ILE ALA A . n A 1 246 PRO 246 244 244 PRO PRO A . n A 1 247 ASN 247 245 245 ASN ASN A . n A 1 248 ALA 248 246 246 ALA ALA A . n A 1 249 ASP 249 247 247 ASP ASP A . n A 1 250 ALA 250 248 248 ALA ALA A . n A 1 251 ILE 251 249 249 ILE ILE A . n A 1 252 MET 252 250 250 MET MET A . n A 1 253 MET 253 251 251 MET MET A . n A 1 254 LYS 254 252 252 LYS LYS A . n A 1 255 CYS 255 253 253 CYS CYS A . n A 1 256 ILE 256 254 254 ILE ILE A . n A 1 257 LEU 257 255 255 LEU LEU A . n A 1 258 HIS 258 256 256 HIS HIS A . n A 1 259 ASP 259 257 257 ASP ASP A . n A 1 260 TRP 260 258 258 TRP TRP A . n A 1 261 ASP 261 259 259 ASP ASP A . n A 1 262 ASP 262 260 260 ASP ASP A . n A 1 263 LYS 263 261 261 LYS LYS A . n A 1 264 GLU 264 262 262 GLU GLU A . n A 1 265 CYS 265 263 263 CYS CYS A . n A 1 266 ILE 266 264 264 ILE ILE A . n A 1 267 GLU 267 265 265 GLU GLU A . n A 1 268 ILE 268 266 266 ILE ILE A . n A 1 269 LEU 269 267 267 LEU LEU A . n A 1 270 LYS 270 268 268 LYS LYS A . n A 1 271 ARG 271 269 269 ARG ARG A . n A 1 272 CYS 272 270 270 CYS CYS A . n A 1 273 LYS 273 271 271 LYS LYS A . n A 1 274 ASP 274 272 272 ASP ASP A . n A 1 275 ALA 275 273 273 ALA ALA A . n A 1 276 VAL 276 274 274 VAL VAL A . n A 1 277 PRO 277 275 275 PRO PRO A . n A 1 278 ARG 278 276 276 ARG ARG A . n A 1 279 ASP 279 277 277 ASP ASP A . n A 1 280 GLY 280 278 278 GLY GLY A . n A 1 281 GLY 281 279 279 GLY GLY A . n A 1 282 LYS 282 280 280 LYS LYS A . n A 1 283 VAL 283 281 281 VAL VAL A . n A 1 284 ILE 284 282 282 ILE ILE A . n A 1 285 ILE 285 283 283 ILE ILE A . n A 1 286 ILE 286 284 284 ILE ILE A . n A 1 287 ASP 287 285 285 ASP ASP A . n A 1 288 ILE 288 286 286 ILE ILE A . n A 1 289 ILE 289 287 287 ILE ILE A . n A 1 290 LEU 290 288 288 LEU LEU A . n A 1 291 ASP 291 289 289 ASP ASP A . n A 1 292 VAL 292 290 290 VAL VAL A . n A 1 293 LYS 293 291 291 LYS LYS A . n A 1 294 SER 294 292 292 SER SER A . n A 1 295 GLU 295 293 293 GLU GLU A . n A 1 296 HIS 296 294 294 HIS HIS A . n A 1 297 PRO 297 295 295 PRO PRO A . n A 1 298 TYR 298 296 296 TYR TYR A . n A 1 299 THR 299 297 297 THR THR A . n A 1 300 LYS 300 298 298 LYS LYS A . n A 1 301 MET 301 299 299 MET MET A . n A 1 302 ARG 302 300 300 ARG ARG A . n A 1 303 LEU 303 301 301 LEU LEU A . n A 1 304 THR 304 302 302 THR THR A . n A 1 305 LEU 305 303 303 LEU LEU A . n A 1 306 ASP 306 304 304 ASP ASP A . n A 1 307 LEU 307 305 305 LEU LEU A . n A 1 308 ASP 308 306 306 ASP ASP A . n A 1 309 MET 309 307 307 MET MET A . n A 1 310 MET 310 308 308 MET MET A . n A 1 311 LEU 311 309 309 LEU LEU A . n A 1 312 ASN 312 310 310 ASN ASN A . n A 1 313 THR 313 311 311 THR THR A . n A 1 314 GLY 314 312 312 GLY GLY A . n A 1 315 GLY 315 313 313 GLY GLY A . n A 1 316 LYS 316 314 314 LYS LYS A . n A 1 317 GLU 317 315 315 GLU GLU A . n A 1 318 ARG 318 316 316 ARG ARG A . n A 1 319 THR 319 317 317 THR THR A . n A 1 320 GLU 320 318 318 GLU GLU A . n A 1 321 GLU 321 319 319 GLU GLU A . n A 1 322 GLU 322 320 320 GLU GLU A . n A 1 323 TRP 323 321 321 TRP TRP A . n A 1 324 LYS 324 322 322 LYS LYS A . n A 1 325 LYS 325 323 323 LYS LYS A . n A 1 326 LEU 326 324 324 LEU LEU A . n A 1 327 ILE 327 325 325 ILE ILE A . n A 1 328 HIS 328 326 326 HIS HIS A . n A 1 329 ASP 329 327 327 ASP ASP A . n A 1 330 ALA 330 328 328 ALA ALA A . n A 1 331 GLY 331 329 329 GLY GLY A . n A 1 332 TYR 332 330 330 TYR TYR A . n A 1 333 LYS 333 331 331 LYS LYS A . n A 1 334 GLY 334 332 332 GLY GLY A . n A 1 335 TYR 335 333 333 TYR TYR A . n A 1 336 LYS 336 334 334 LYS LYS A . n A 1 337 ILE 337 335 335 ILE ILE A . n A 1 338 THR 338 336 336 THR THR A . n A 1 339 HIS 339 337 337 HIS HIS A . n A 1 340 ILE 340 338 338 ILE ILE A . n A 1 341 SER 341 339 339 SER SER A . n A 1 342 ALA 342 340 340 ALA ALA A . n A 1 343 VAL 343 341 341 VAL VAL A . n A 1 344 GLN 344 342 342 GLN GLN A . n A 1 345 SER 345 343 343 SER SER A . n A 1 346 VAL 346 344 344 VAL VAL A . n A 1 347 ILE 347 345 345 ILE ILE A . n A 1 348 GLU 348 346 346 GLU GLU A . n A 1 349 ALA 349 347 347 ALA ALA A . n A 1 350 TYR 350 348 348 TYR TYR A . n A 1 351 PRO 351 349 349 PRO PRO A . n A 1 352 TYR 352 350 350 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 401 351 K K A . C 3 HOH 1 501 6 HOH HOH A . C 3 HOH 2 502 28 HOH HOH A . C 3 HOH 3 503 21 HOH HOH A . C 3 HOH 4 504 36 HOH HOH A . C 3 HOH 5 505 19 HOH HOH A . C 3 HOH 6 506 11 HOH HOH A . C 3 HOH 7 507 26 HOH HOH A . C 3 HOH 8 508 40 HOH HOH A . C 3 HOH 9 509 10 HOH HOH A . C 3 HOH 10 510 33 HOH HOH A . C 3 HOH 11 511 18 HOH HOH A . C 3 HOH 12 512 13 HOH HOH A . C 3 HOH 13 513 3 HOH HOH A . C 3 HOH 14 514 8 HOH HOH A . C 3 HOH 15 515 1 HOH HOH A . C 3 HOH 16 516 24 HOH HOH A . C 3 HOH 17 517 5 HOH HOH A . C 3 HOH 18 518 23 HOH HOH A . C 3 HOH 19 519 14 HOH HOH A . C 3 HOH 20 520 37 HOH HOH A . C 3 HOH 21 521 51 HOH HOH A . C 3 HOH 22 522 43 HOH HOH A . C 3 HOH 23 523 22 HOH HOH A . C 3 HOH 24 524 35 HOH HOH A . C 3 HOH 25 525 4 HOH HOH A . C 3 HOH 26 526 16 HOH HOH A . C 3 HOH 27 527 15 HOH HOH A . C 3 HOH 28 528 38 HOH HOH A . C 3 HOH 29 529 32 HOH HOH A . C 3 HOH 30 530 25 HOH HOH A . C 3 HOH 31 531 2 HOH HOH A . C 3 HOH 32 532 9 HOH HOH A . C 3 HOH 33 533 31 HOH HOH A . C 3 HOH 34 534 12 HOH HOH A . C 3 HOH 35 535 34 HOH HOH A . C 3 HOH 36 536 44 HOH HOH A . C 3 HOH 37 537 48 HOH HOH A . C 3 HOH 38 538 41 HOH HOH A . C 3 HOH 39 539 39 HOH HOH A . C 3 HOH 40 540 47 HOH HOH A . C 3 HOH 41 541 45 HOH HOH A . C 3 HOH 42 542 29 HOH HOH A . C 3 HOH 43 543 46 HOH HOH A . C 3 HOH 44 544 17 HOH HOH A . C 3 HOH 45 545 27 HOH HOH A . C 3 HOH 46 546 30 HOH HOH A . C 3 HOH 47 547 7 HOH HOH A . C 3 HOH 48 548 50 HOH HOH A . C 3 HOH 49 549 42 HOH HOH A . C 3 HOH 50 550 20 HOH HOH A . C 3 HOH 51 551 49 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 8 ? CG ? A ASN 10 CG 2 1 Y 1 A ASN 8 ? OD1 ? A ASN 10 OD1 3 1 Y 1 A ASN 8 ? ND2 ? A ASN 10 ND2 4 1 Y 1 A ASP 85 ? CG ? A ASP 87 CG 5 1 Y 1 A ASP 85 ? OD1 ? A ASP 87 OD1 6 1 Y 1 A ASP 85 ? OD2 ? A ASP 87 OD2 7 1 Y 1 A GLU 87 ? CG ? A GLU 89 CG 8 1 Y 1 A GLU 87 ? CD ? A GLU 89 CD 9 1 Y 1 A GLU 87 ? OE1 ? A GLU 89 OE1 10 1 Y 1 A GLU 87 ? OE2 ? A GLU 89 OE2 11 1 Y 1 A ASN 132 ? CG ? A ASN 134 CG 12 1 Y 1 A ASN 132 ? OD1 ? A ASN 134 OD1 13 1 Y 1 A ASN 132 ? ND2 ? A ASN 134 ND2 14 1 Y 1 A ASP 133 ? CG ? A ASP 135 CG 15 1 Y 1 A ASP 133 ? OD1 ? A ASP 135 OD1 16 1 Y 1 A ASP 133 ? OD2 ? A ASP 135 OD2 17 1 Y 1 A GLN 160 ? CG ? A GLN 162 CG 18 1 Y 1 A GLN 160 ? CD ? A GLN 162 CD 19 1 Y 1 A GLN 160 ? OE1 ? A GLN 162 OE1 20 1 Y 1 A GLN 160 ? NE2 ? A GLN 162 NE2 21 1 Y 1 A LYS 179 ? CD ? A LYS 181 CD 22 1 Y 1 A LYS 179 ? CE ? A LYS 181 CE 23 1 Y 1 A LYS 179 ? NZ ? A LYS 181 NZ 24 1 Y 1 A TYR 217 ? CG ? A TYR 219 CG 25 1 Y 1 A TYR 217 ? CD1 ? A TYR 219 CD1 26 1 Y 1 A TYR 217 ? CD2 ? A TYR 219 CD2 27 1 Y 1 A TYR 217 ? CE1 ? A TYR 219 CE1 28 1 Y 1 A TYR 217 ? CE2 ? A TYR 219 CE2 29 1 Y 1 A TYR 217 ? CZ ? A TYR 219 CZ 30 1 Y 1 A TYR 217 ? OH ? A TYR 219 OH 31 1 Y 1 A ILE 243 ? CG1 ? A ILE 245 CG1 32 1 Y 1 A ILE 243 ? CG2 ? A ILE 245 CG2 33 1 Y 1 A ILE 243 ? CD1 ? A ILE 245 CD1 34 1 Y 1 A LYS 261 ? CG ? A LYS 263 CG 35 1 Y 1 A LYS 261 ? CD ? A LYS 263 CD 36 1 Y 1 A LYS 261 ? CE ? A LYS 263 CE 37 1 Y 1 A LYS 261 ? NZ ? A LYS 263 NZ 38 1 Y 1 A ARG 276 ? NE ? A ARG 278 NE 39 1 Y 1 A ARG 276 ? CZ ? A ARG 278 CZ 40 1 Y 1 A ARG 276 ? NH1 ? A ARG 278 NH1 41 1 Y 1 A ARG 276 ? NH2 ? A ARG 278 NH2 42 1 Y 1 A ASP 277 ? CG ? A ASP 279 CG 43 1 Y 1 A ASP 277 ? OD1 ? A ASP 279 OD1 44 1 Y 1 A ASP 277 ? OD2 ? A ASP 279 OD2 45 1 Y 1 A LYS 291 ? CG ? A LYS 293 CG 46 1 Y 1 A LYS 291 ? CD ? A LYS 293 CD 47 1 Y 1 A LYS 291 ? CE ? A LYS 293 CE 48 1 Y 1 A LYS 291 ? NZ ? A LYS 293 NZ 49 1 Y 1 A GLU 293 ? CG ? A GLU 295 CG 50 1 Y 1 A GLU 293 ? CD ? A GLU 295 CD 51 1 Y 1 A GLU 293 ? OE1 ? A GLU 295 OE1 52 1 Y 1 A GLU 293 ? OE2 ? A GLU 295 OE2 53 1 Y 1 A THR 311 ? OG1 ? A THR 313 OG1 54 1 Y 1 A THR 311 ? CG2 ? A THR 313 CG2 55 1 Y 1 A LYS 331 ? CE ? A LYS 333 CE 56 1 Y 1 A LYS 331 ? NZ ? A LYS 333 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.14 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.5_2 7 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5ICG _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.380 _cell.length_a_esd ? _cell.length_b 99.310 _cell.length_b_esd ? _cell.length_c 102.040 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ICG _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ICG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MPD, Sodium Acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-07-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.7109 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE BM30A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.7109 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BM30A _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 45.587 _reflns.entry_id 5ICG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 49.655 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17348 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.5 _reflns.pdbx_Rmerge_I_obs 0.090 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.710 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.300 2.400 ? 3.070 ? ? ? ? ? 99.500 ? ? ? ? 1.136 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? 2.400 2.600 ? 6.870 ? ? ? ? ? 100.000 ? ? ? ? 0.614 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 ? ? 2.600 2.900 ? 14.770 ? ? ? ? ? 100.000 ? ? ? ? 0.269 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 ? ? 2.900 3.300 ? 29.040 ? ? ? ? ? 100.000 ? ? ? ? 0.106 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 ? ? 3.300 4.300 ? 50.110 ? ? ? ? ? 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 ? ? 4.300 6.300 ? 61.220 ? ? ? ? ? 100.000 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 ? ? 6.300 9.300 ? 69.270 ? ? ? ? ? 100.000 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 ? ? 9.300 ? ? 71.120 ? ? ? ? ? 99.000 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 ? ? # _refine.aniso_B[1][1] -4.0254 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 9.0183 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -4.9929 _refine.B_iso_max 101.480 _refine.B_iso_mean 39.8286 _refine.B_iso_min 7.690 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ICG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 49.6550 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12081 _refine.ls_number_reflns_R_free 604 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9800 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2058 _refine.ls_R_factor_R_free 0.2570 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2030 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol 38.9900 _refine.solvent_model_param_ksol 0.3350 _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.010 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5ICC _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.2400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 49.6550 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 2545 _refine_hist.pdbx_number_residues_total 323 _refine_hist.pdbx_B_iso_mean_ligand 25.29 _refine_hist.pdbx_B_iso_mean_solvent 27.28 _refine_hist.pdbx_number_atoms_protein 2493 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # _struct.entry_id 5ICG _struct.title 'Crystal structure of apo (S)-norcoclaurine 6-O-methyltransferase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5ICG _struct_keywords.text 'methyltransferase, benzylisoquinoline alkaloid, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5C9L7_THLFG _struct_ref.pdbx_db_accession Q5C9L7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NLSSQAKLWNFIYGFADSLVLKSAVQLDLANIIHNHGSPMTLSELSLHLPSQPVNQDALYRVLRYLVHMKLFTKSSIDGE LRYGLAPPAKFLVKGWDKCMLGAILTITDKDFMAPWHYLKEGILNDGSTSTAFEKALGTNIWDYMAEHPEKNQLFNEGMA NDTRLIMSALVKECSSMFDGITTIVDVGGGTGTAVRNIAKAFPHIKCTVYDLPHVIADSPGYTEINSIQGDMFKYIPNAD AIMMKCILHDWDDKECIEILKRCKDAVPRDGGKVIIIDIILDVKSEHPYTKMRLTLDLDMMLNTGGKERTEEEWKKLIHD AGYKGYKITHISAVQSVIEAYPY ; _struct_ref.pdbx_align_begin 8 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ICG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 352 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5C9L7 _struct_ref_seq.db_align_beg 8 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 350 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 350 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ICG GLY A 1 ? UNP Q5C9L7 ? ? 'expression tag' -1 1 1 5ICG ALA A 2 ? UNP Q5C9L7 ? ? 'expression tag' 0 2 1 5ICG MET A 3 ? UNP Q5C9L7 ? ? 'expression tag' 1 3 1 5ICG VAL A 4 ? UNP Q5C9L7 ? ? 'expression tag' 2 4 1 5ICG MET A 5 ? UNP Q5C9L7 ? ? 'expression tag' 3 5 1 5ICG ILE A 6 ? UNP Q5C9L7 ? ? 'expression tag' 4 6 1 5ICG ASN A 7 ? UNP Q5C9L7 ? ? 'expression tag' 5 7 1 5ICG LYS A 8 ? UNP Q5C9L7 ? ? 'expression tag' 6 8 1 5ICG GLU A 9 ? UNP Q5C9L7 ? ? 'expression tag' 7 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8510 ? 1 MORE -69 ? 1 'SSA (A^2)' 28600 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 51.0200000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 11 ? TYR A 22 ? LEU A 9 TYR A 20 1 ? 12 HELX_P HELX_P2 AA2 TYR A 22 ? LEU A 36 ? TYR A 20 LEU A 34 1 ? 15 HELX_P HELX_P3 AA3 ASP A 37 ? GLY A 46 ? ASP A 35 GLY A 44 1 ? 10 HELX_P HELX_P4 AA4 LEU A 51 ? HIS A 57 ? LEU A 49 HIS A 55 1 ? 7 HELX_P HELX_P5 AA5 ASN A 64 ? MET A 78 ? ASN A 62 MET A 76 1 ? 15 HELX_P HELX_P6 AA6 PRO A 96 ? VAL A 102 ? PRO A 94 VAL A 100 5 ? 7 HELX_P HELX_P7 AA7 MET A 109 ? THR A 117 ? MET A 107 THR A 115 1 ? 9 HELX_P HELX_P8 AA8 ASP A 118 ? ALA A 123 ? ASP A 116 ALA A 121 1 ? 6 HELX_P HELX_P9 AA9 PRO A 124 ? HIS A 126 ? PRO A 122 HIS A 124 5 ? 3 HELX_P HELX_P10 AB1 TYR A 127 ? LEU A 133 ? TYR A 125 LEU A 131 1 ? 7 HELX_P HELX_P11 AB2 THR A 140 ? GLY A 147 ? THR A 138 GLY A 145 1 ? 8 HELX_P HELX_P12 AB3 ASN A 149 ? HIS A 157 ? ASN A 147 HIS A 155 1 ? 9 HELX_P HELX_P13 AB4 HIS A 157 ? CYS A 183 ? HIS A 155 CYS A 181 1 ? 27 HELX_P HELX_P14 AB5 SER A 184 ? ASP A 188 ? SER A 182 ASP A 186 5 ? 5 HELX_P HELX_P15 AB6 GLY A 201 ? PHE A 211 ? GLY A 199 PHE A 209 1 ? 11 HELX_P HELX_P16 AB7 ILE A 256 ? TRP A 260 ? ILE A 254 TRP A 258 5 ? 5 HELX_P HELX_P17 AB8 ASP A 261 ? VAL A 276 ? ASP A 259 VAL A 274 1 ? 16 HELX_P HELX_P18 AB9 TYR A 298 ? THR A 313 ? TYR A 296 THR A 311 1 ? 16 HELX_P HELX_P19 AC1 GLU A 320 ? ALA A 330 ? GLU A 318 ALA A 328 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B K . K ? ? ? 1_555 C HOH . O ? ? A K 401 A HOH 512 1_555 ? ? ? ? ? ? ? 3.275 ? ? metalc2 metalc ? ? B K . K ? ? ? 1_555 C HOH . O ? ? A K 401 A HOH 512 3_555 ? ? ? ? ? ? ? 3.275 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id C _pdbx_struct_conn_angle.ptnr1_label_comp_id HOH _pdbx_struct_conn_angle.ptnr1_label_seq_id . _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr1_auth_seq_id 512 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id K _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id K _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id K _pdbx_struct_conn_angle.ptnr2_auth_seq_id 401 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id C _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 512 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 3_555 _pdbx_struct_conn_angle.value 80.2 _pdbx_struct_conn_angle.value_esd ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 61 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 59 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 62 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 60 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.19 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 6 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 49 ? THR A 50 ? MET A 47 THR A 48 AA1 2 GLU A 89 ? LEU A 94 ? GLU A 87 LEU A 92 AA1 3 PHE A 81 ? ILE A 86 ? PHE A 79 ILE A 84 AA2 1 LYS A 215 ? TYR A 219 ? LYS A 213 TYR A 217 AA2 2 THR A 192 ? VAL A 196 ? THR A 190 VAL A 194 AA2 3 ALA A 250 ? LYS A 254 ? ALA A 248 LYS A 252 AA2 4 LYS A 282 ? ASP A 287 ? LYS A 280 ASP A 285 AA2 5 SER A 345 ? TYR A 350 ? SER A 343 TYR A 348 AA2 6 GLY A 334 ? HIS A 339 ? GLY A 332 HIS A 337 AA3 1 ILE A 289 ? LEU A 290 ? ILE A 287 LEU A 288 AA3 2 ARG A 318 ? THR A 319 ? ARG A 316 THR A 317 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 49 ? N MET A 47 O TYR A 92 ? O TYR A 90 AA1 2 3 O ARG A 91 ? O ARG A 89 N SER A 84 ? N SER A 82 AA2 1 2 O THR A 217 ? O THR A 215 N ASP A 195 ? N ASP A 193 AA2 2 3 N VAL A 194 ? N VAL A 192 O MET A 252 ? O MET A 250 AA2 3 4 N ILE A 251 ? N ILE A 249 O ILE A 284 ? O ILE A 282 AA2 4 5 N ILE A 285 ? N ILE A 283 O ILE A 347 ? O ILE A 345 AA2 5 6 O VAL A 346 ? O VAL A 344 N THR A 338 ? N THR A 336 AA3 1 2 N LEU A 290 ? N LEU A 288 O ARG A 318 ? O ARG A 316 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id K _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue K A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 HIS A 126 ? HIS A 124 . ? 3_555 ? 2 AC1 2 HIS A 126 ? HIS A 124 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 85 ? ? 58.87 -139.26 2 1 LYS A 291 ? ? -85.05 30.28 3 1 ASN A 310 ? ? -121.77 -51.24 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id K _pdbx_struct_special_symmetry.auth_seq_id 401 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id K _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -9.2515 12.2026 16.4411 0.0900 0.1371 0.0784 0.0174 -0.0234 -0.0092 0.0935 0.3646 1.6399 0.0017 -0.1123 -0.2213 0.0025 -0.0701 0.0646 0.0310 -0.0111 -0.0721 -0.0080 -0.0313 -0.3413 'X-RAY DIFFRACTION' 2 ? refined 14.4854 -4.6995 24.4289 0.2100 0.0580 0.0685 0.3346 -0.0189 -0.0095 0.3840 0.0015 0.2834 -0.0251 0.3350 -0.0149 0.1436 -0.3096 0.1258 -0.0114 -0.0327 -0.0367 -0.3541 -0.3299 -0.2286 'X-RAY DIFFRACTION' 3 ? refined 19.4322 9.4759 0.9599 0.2255 0.1069 0.1293 -0.0373 0.0286 0.0074 0.1004 0.4322 1.0426 0.1593 0.0408 0.0176 -0.0550 0.0397 0.0197 0.0260 0.0088 0.1236 -0.0340 0.1201 0.1300 'X-RAY DIFFRACTION' 4 ? refined 30.3470 13.4081 10.5010 0.0559 0.1457 0.0947 -0.0175 0.0499 0.0108 0.2436 0.5755 3.2637 -0.0971 0.7077 -0.2738 0.2597 -0.0868 -0.1298 0.1723 0.1170 0.1756 0.0355 0.1557 0.5511 'X-RAY DIFFRACTION' 5 ? refined 13.8960 13.7086 19.9865 0.1193 0.1033 0.0816 -0.0281 0.0126 -0.0031 0.7947 0.8947 0.2991 -0.1255 -0.0722 0.0125 0.1637 -0.1253 -0.0431 -0.0915 0.0609 0.0086 -0.0550 -0.0385 0.0350 'X-RAY DIFFRACTION' 6 ? refined 28.1099 20.5408 13.0730 0.1052 0.1426 0.0856 -0.1123 0.0133 -0.0276 0.3898 1.7531 1.3449 0.3533 -0.7064 -0.3802 -0.0010 0.0671 -0.0508 -0.0481 0.0290 0.2102 -0.0155 -0.0802 0.3189 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 8 A 127 '(chain A and resid 8:127)' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 128 A 149 '(chain A and resid 128:149)' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 150 A 255 '(chain A and resid 150:255)' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 256 A 290 '(chain A and resid 256:290)' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 291 A 315 '(chain A and resid 291:315)' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 316 A 350 '(chain A and resid 316:350)' ? ? ? ? ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A ALA 0 ? A ALA 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A VAL 2 ? A VAL 4 5 1 Y 1 A MET 3 ? A MET 5 6 1 Y 1 A ILE 4 ? A ILE 6 7 1 Y 1 A ASN 5 ? A ASN 7 8 1 Y 1 A LYS 6 ? A LYS 8 9 1 Y 1 A GLU 7 ? A GLU 9 10 1 Y 1 A GLY 134 ? A GLY 136 11 1 Y 1 A ALA 224 ? A ALA 226 12 1 Y 1 A ASP 225 ? A ASP 227 13 1 Y 1 A SER 226 ? A SER 228 14 1 Y 1 A PRO 227 ? A PRO 229 15 1 Y 1 A GLY 228 ? A GLY 230 16 1 Y 1 A TYR 229 ? A TYR 231 17 1 Y 1 A THR 230 ? A THR 232 18 1 Y 1 A GLU 231 ? A GLU 233 19 1 Y 1 A ILE 232 ? A ILE 234 20 1 Y 1 A ASN 233 ? A ASN 235 21 1 Y 1 A SER 234 ? A SER 236 22 1 Y 1 A ILE 235 ? A ILE 237 23 1 Y 1 A GLN 236 ? A GLN 238 24 1 Y 1 A GLY 237 ? A GLY 239 25 1 Y 1 A ASP 238 ? A ASP 240 26 1 Y 1 A MET 239 ? A MET 241 27 1 Y 1 A PHE 240 ? A PHE 242 28 1 Y 1 A LYS 241 ? A LYS 243 29 1 Y 1 A TYR 242 ? A TYR 244 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 K K K N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'INRA (French National Institute for Agricultural Research)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number P-BV-2 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5ICC _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5ICG _atom_sites.fract_transf_matrix[1][1] 0.013266 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010069 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009800 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C K N O S # loop_