data_5IDL # _entry.id 5IDL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IDL pdb_00005idl 10.2210/pdb5idl/pdb WWPDB D_1000218632 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IDL _pdbx_database_status.recvd_initial_deposition_date 2016-02-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Julien, J.P.' 1 'Ereno-Orbea, J.' 2 'Jardine, J.G.' 3 'Schief, W.R.' 4 'Wilson, I.A.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 351 _citation.language ? _citation.page_first 1458 _citation.page_last 1463 _citation.title 'HIV-1 broadly neutralizing antibody precursor B cells revealed by germline-targeting immunogen.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.aad9195 _citation.pdbx_database_id_PubMed 27013733 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jardine, J.G.' 1 ? primary 'Kulp, D.W.' 2 ? primary 'Havenar-Daughton, C.' 3 ? primary 'Sarkar, A.' 4 ? primary 'Briney, B.' 5 ? primary 'Sok, D.' 6 ? primary 'Sesterhenn, F.' 7 ? primary 'Ereno-Orbea, J.' 8 ? primary 'Kalyuzhniy, O.' 9 ? primary 'Deresa, I.' 10 ? primary 'Hu, X.' 11 ? primary 'Spencer, S.' 12 ? primary 'Jones, M.' 13 ? primary 'Georgeson, E.' 14 ? primary 'Adachi, Y.' 15 ? primary 'Kubitz, M.' 16 ? primary 'deCamp, A.C.' 17 ? primary 'Julien, J.P.' 18 ? primary 'Wilson, I.A.' 19 ? primary 'Burton, D.R.' 20 ? primary 'Crotty, S.' 21 ? primary 'Schief, W.R.' 22 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5IDL _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.330 _cell.length_a_esd ? _cell.length_b 53.060 _cell.length_b_esd ? _cell.length_c 77.990 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IDL _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Germline-targeting HIV-1 gp120 engineered outer domain, eOD-GT8' 19731.150 1 ? ? ? ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DTITLPCRPAPPPHCSSNITGLILTRQGGYSNANTVIFRPSGGDWRDIARCQIAGTVVSTQLFLNGSLAEEEVVIRSEDW RDNAKSICVQLATSVEIACTGAGHCAISRAKWANTLKQIASKLREQYGAKTIIFKPSSGGDPEFVNHSFNCGGEFFYCAS TQLFASTWFASTGTKHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;DTITLPCRPAPPPHCSSNITGLILTRQGGYSNANTVIFRPSGGDWRDIARCQIAGTVVSTQLFLNGSLAEEEVVIRSEDW RDNAKSICVQLATSVEIACTGAGHCAISRAKWANTLKQIASKLREQYGAKTIIFKPSSGGDPEFVNHSFNCGGEFFYCAS TQLFASTWFASTGTKHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 THR n 1 3 ILE n 1 4 THR n 1 5 LEU n 1 6 PRO n 1 7 CYS n 1 8 ARG n 1 9 PRO n 1 10 ALA n 1 11 PRO n 1 12 PRO n 1 13 PRO n 1 14 HIS n 1 15 CYS n 1 16 SER n 1 17 SER n 1 18 ASN n 1 19 ILE n 1 20 THR n 1 21 GLY n 1 22 LEU n 1 23 ILE n 1 24 LEU n 1 25 THR n 1 26 ARG n 1 27 GLN n 1 28 GLY n 1 29 GLY n 1 30 TYR n 1 31 SER n 1 32 ASN n 1 33 ALA n 1 34 ASN n 1 35 THR n 1 36 VAL n 1 37 ILE n 1 38 PHE n 1 39 ARG n 1 40 PRO n 1 41 SER n 1 42 GLY n 1 43 GLY n 1 44 ASP n 1 45 TRP n 1 46 ARG n 1 47 ASP n 1 48 ILE n 1 49 ALA n 1 50 ARG n 1 51 CYS n 1 52 GLN n 1 53 ILE n 1 54 ALA n 1 55 GLY n 1 56 THR n 1 57 VAL n 1 58 VAL n 1 59 SER n 1 60 THR n 1 61 GLN n 1 62 LEU n 1 63 PHE n 1 64 LEU n 1 65 ASN n 1 66 GLY n 1 67 SER n 1 68 LEU n 1 69 ALA n 1 70 GLU n 1 71 GLU n 1 72 GLU n 1 73 VAL n 1 74 VAL n 1 75 ILE n 1 76 ARG n 1 77 SER n 1 78 GLU n 1 79 ASP n 1 80 TRP n 1 81 ARG n 1 82 ASP n 1 83 ASN n 1 84 ALA n 1 85 LYS n 1 86 SER n 1 87 ILE n 1 88 CYS n 1 89 VAL n 1 90 GLN n 1 91 LEU n 1 92 ALA n 1 93 THR n 1 94 SER n 1 95 VAL n 1 96 GLU n 1 97 ILE n 1 98 ALA n 1 99 CYS n 1 100 THR n 1 101 GLY n 1 102 ALA n 1 103 GLY n 1 104 HIS n 1 105 CYS n 1 106 ALA n 1 107 ILE n 1 108 SER n 1 109 ARG n 1 110 ALA n 1 111 LYS n 1 112 TRP n 1 113 ALA n 1 114 ASN n 1 115 THR n 1 116 LEU n 1 117 LYS n 1 118 GLN n 1 119 ILE n 1 120 ALA n 1 121 SER n 1 122 LYS n 1 123 LEU n 1 124 ARG n 1 125 GLU n 1 126 GLN n 1 127 TYR n 1 128 GLY n 1 129 ALA n 1 130 LYS n 1 131 THR n 1 132 ILE n 1 133 ILE n 1 134 PHE n 1 135 LYS n 1 136 PRO n 1 137 SER n 1 138 SER n 1 139 GLY n 1 140 GLY n 1 141 ASP n 1 142 PRO n 1 143 GLU n 1 144 PHE n 1 145 VAL n 1 146 ASN n 1 147 HIS n 1 148 SER n 1 149 PHE n 1 150 ASN n 1 151 CYS n 1 152 GLY n 1 153 GLY n 1 154 GLU n 1 155 PHE n 1 156 PHE n 1 157 TYR n 1 158 CYS n 1 159 ALA n 1 160 SER n 1 161 THR n 1 162 GLN n 1 163 LEU n 1 164 PHE n 1 165 ALA n 1 166 SER n 1 167 THR n 1 168 TRP n 1 169 PHE n 1 170 ALA n 1 171 SER n 1 172 THR n 1 173 GLY n 1 174 THR n 1 175 LYS n 1 176 HIS n 1 177 HIS n 1 178 HIS n 1 179 HIS n 1 180 HIS n 1 181 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 181 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5IDL _struct_ref.pdbx_db_accession 5IDL _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IDL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 181 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5IDL _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 181 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IDL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2% (v/v) PEG 400, 2M ammonium sulfate, 0.1M HEPES pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97945 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL11-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97945 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL11-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 62.610 _reflns.entry_id 5IDL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.840 _reflns.d_resolution_low 40.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3333 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs 0.131 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.930 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.840 2.920 ? 1.400 ? ? ? ? ? 98.900 ? ? ? ? 0.779 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? 2.920 3.000 ? 1.790 ? ? ? ? ? 99.800 ? ? ? ? 0.564 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 ? ? 3.000 3.080 ? 2.020 ? ? ? ? ? 99.300 ? ? ? ? 0.581 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 ? ? 3.080 3.180 ? 2.450 ? ? ? ? ? 100.000 ? ? ? ? 0.457 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 ? ? 3.180 3.280 ? 3.430 ? ? ? ? ? 99.800 ? ? ? ? 0.296 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 ? ? 3.280 3.400 ? 3.330 ? ? ? ? ? 98.800 ? ? ? ? 0.294 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 ? ? 3.400 3.530 ? 4.020 ? ? ? ? ? 99.200 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 ? ? 3.530 3.670 ? 5.510 ? ? ? ? ? 100.000 ? ? ? ? 0.194 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 ? ? 3.670 3.830 ? 6.520 ? ? ? ? ? 99.700 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 ? ? 3.830 4.020 ? 7.480 ? ? ? ? ? 98.300 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 ? ? 4.020 4.240 ? 9.310 ? ? ? ? ? 98.800 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 ? ? 4.240 4.500 ? 10.280 ? ? ? ? ? 100.000 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 ? ? 4.500 4.810 ? 12.620 ? ? ? ? ? 99.700 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 ? ? 4.810 5.190 ? 13.840 ? ? ? ? ? 100.000 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 ? ? 5.190 5.690 ? 12.300 ? ? ? ? ? 100.000 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 ? ? 5.690 6.360 ? 11.410 ? ? ? ? ? 99.100 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 ? ? 6.360 7.340 ? 11.000 ? ? ? ? ? 100.000 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 ? ? 7.340 8.990 ? 18.180 ? ? ? ? ? 99.400 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 ? ? 8.990 12.710 ? 22.380 ? ? ? ? ? 99.300 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 ? ? 12.710 ? ? 24.590 ? ? ? ? ? 95.700 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 94.090 _refine.B_iso_mean 52.3497 _refine.B_iso_min 33.990 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5IDL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9000 _refine.ls_d_res_low 31.4220 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3332 _refine.ls_number_reflns_R_free 243 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.6 _refine.ls_percent_reflns_R_free 10.0200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2575 _refine.ls_R_factor_R_free 0.2971 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2531 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4JPJ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.9600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.9000 _refine_hist.d_res_low 31.4220 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1245 _refine_hist.pdbx_number_residues_total 162 _refine_hist.pdbx_B_iso_mean_ligand 58.83 _refine_hist.pdbx_number_atoms_protein 1217 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1278 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.455 ? 1745 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 206 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 220 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.888 ? 756 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9004 3.6533 . . 157 1413 95.0000 . . . 0.3498 . . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6533 . . . 177 1585 99.0000 . . . 0.2762 . 0.2357 . . . . . . . . . . # _struct.entry_id 5IDL _struct.title 'Crystal structure of the germline-targeting HIV-1 gp120 engineered outer domain, eOD-GT8' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IDL _struct_keywords.text 'HIV Env, germline-targeting immunogen, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 12 ? SER A 16 ? PRO A 12 SER A 16 5 ? 5 HELX_P HELX_P2 AA2 ASP A 44 ? ARG A 50 ? ASP A 44 ARG A 50 1 ? 7 HELX_P HELX_P3 AA3 ARG A 109 ? GLY A 128 ? ARG A 109 GLY A 128 1 ? 20 HELX_P HELX_P4 AA4 PRO A 142 ? ASN A 146 ? PRO A 142 ASN A 146 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 158 SG ? ? A CYS 7 A CYS 158 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 151 SG ? ? A CYS 15 A CYS 151 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 51 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 51 A CYS 88 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 99 SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 99 A CYS 105 1_555 ? ? ? ? ? ? ? 2.030 ? ? covale1 covale one ? A ASN 18 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 18 A NAG 201 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation covale2 covale one ? A ASN 65 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 65 A NAG 202 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 8 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 8 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 9 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 9 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.09 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 62 ? LEU A 64 ? LEU A 62 LEU A 64 AA1 2 SER A 17 ? ARG A 26 ? SER A 17 ARG A 26 AA1 3 ILE A 87 ? CYS A 99 ? ILE A 87 CYS A 99 AA1 4 HIS A 104 ? SER A 108 ? HIS A 104 SER A 108 AA1 5 THR A 2 ? ARG A 8 ? THR A 2 ARG A 8 AA1 6 GLU A 154 ? CYS A 158 ? GLU A 154 CYS A 158 AA1 7 HIS A 147 ? CYS A 151 ? HIS A 147 CYS A 151 AA2 1 VAL A 74 ? ARG A 76 ? VAL A 74 ARG A 76 AA2 2 ILE A 87 ? CYS A 99 ? ILE A 87 CYS A 99 AA2 3 SER A 17 ? ARG A 26 ? SER A 17 ARG A 26 AA2 4 THR A 35 ? PRO A 40 ? THR A 35 PRO A 40 AA2 5 THR A 131 ? PHE A 134 ? THR A 131 PHE A 134 AA2 6 SER A 166 ? TRP A 168 ? SER A 166 TRP A 168 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 63 ? O PHE A 63 N GLY A 21 ? N GLY A 21 AA1 2 3 N ILE A 19 ? N ILE A 19 O VAL A 95 ? O VAL A 95 AA1 3 4 N ALA A 98 ? N ALA A 98 O ALA A 106 ? O ALA A 106 AA1 4 5 O ILE A 107 ? O ILE A 107 N ILE A 3 ? N ILE A 3 AA1 5 6 N ARG A 8 ? N ARG A 8 O TYR A 157 ? O TYR A 157 AA1 6 7 O GLU A 154 ? O GLU A 154 N CYS A 151 ? N CYS A 151 AA2 1 2 N VAL A 74 ? N VAL A 74 O GLN A 90 ? O GLN A 90 AA2 2 3 O VAL A 95 ? O VAL A 95 N ILE A 19 ? N ILE A 19 AA2 3 4 N THR A 25 ? N THR A 25 O ARG A 39 ? O ARG A 39 AA2 4 5 N PHE A 38 ? N PHE A 38 O ILE A 133 ? O ILE A 133 AA2 5 6 N ILE A 132 ? N ILE A 132 O TRP A 168 ? O TRP A 168 # _atom_sites.entry_id 5IDL _atom_sites.fract_transf_matrix[1][1] 0.029129 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018847 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012822 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 GLY 29 29 ? ? ? A . n A 1 30 TYR 30 30 ? ? ? A . n A 1 31 SER 31 31 ? ? ? A . n A 1 32 ASN 32 32 ? ? ? A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 TRP 112 112 112 TRP TRP A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 SER 138 138 ? ? ? A . n A 1 139 GLY 139 139 ? ? ? A . n A 1 140 GLY 140 140 ? ? ? A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 CYS 151 151 151 CYS CYS A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 CYS 158 158 158 CYS CYS A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 TRP 168 168 168 TRP TRP A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 SER 171 171 ? ? ? A . n A 1 172 THR 172 172 ? ? ? A . n A 1 173 GLY 173 173 ? ? ? A . n A 1 174 THR 174 174 ? ? ? A . n A 1 175 LYS 175 175 ? ? ? A . n A 1 176 HIS 176 176 ? ? ? A . n A 1 177 HIS 177 177 ? ? ? A . n A 1 178 HIS 178 178 ? ? ? A . n A 1 179 HIS 179 179 ? ? ? A . n A 1 180 HIS 180 180 ? ? ? A . n A 1 181 HIS 181 181 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 201 1018 NAG NAG A . C 2 NAG 1 202 1065 NAG NAG A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-10-05 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2019-12-11 4 'Structure model' 1 3 2020-07-29 5 'Structure model' 1 4 2023-09-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_audit_support 3 2 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' pdbx_audit_support 5 4 'Structure model' chem_comp 6 4 'Structure model' entity 7 4 'Structure model' pdbx_chem_comp_identifier 8 4 'Structure model' pdbx_entity_nonpoly 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_site 11 4 'Structure model' struct_site_gen 12 5 'Structure model' chem_comp 13 5 'Structure model' chem_comp_atom 14 5 'Structure model' chem_comp_bond 15 5 'Structure model' database_2 16 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_CSD' 2 2 'Structure model' '_pdbx_audit_support.funding_organization' 3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' 5 4 'Structure model' '_chem_comp.name' 6 4 'Structure model' '_chem_comp.type' 7 4 'Structure model' '_entity.pdbx_description' 8 4 'Structure model' '_pdbx_entity_nonpoly.name' 9 4 'Structure model' '_struct_conn.pdbx_role' 10 5 'Structure model' '_chem_comp.pdbx_synonyms' 11 5 'Structure model' '_database_2.pdbx_DOI' 12 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 61 ? ? 67.31 -38.81 2 1 ASP A 79 ? ? -160.97 109.99 3 1 PHE A 164 ? ? -116.54 77.20 4 1 ALA A 165 ? ? -161.06 54.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 1 ? CG ? A ASP 1 CG 2 1 Y 1 A ASP 1 ? OD1 ? A ASP 1 OD1 3 1 Y 1 A ASP 1 ? OD2 ? A ASP 1 OD2 4 1 Y 1 A ARG 46 ? CG ? A ARG 46 CG 5 1 Y 1 A ARG 46 ? CD ? A ARG 46 CD 6 1 Y 1 A ARG 46 ? NE ? A ARG 46 NE 7 1 Y 1 A ARG 46 ? CZ ? A ARG 46 CZ 8 1 Y 1 A ARG 46 ? NH1 ? A ARG 46 NH1 9 1 Y 1 A ARG 46 ? NH2 ? A ARG 46 NH2 10 1 Y 1 A ASP 47 ? CG ? A ASP 47 CG 11 1 Y 1 A ASP 47 ? OD1 ? A ASP 47 OD1 12 1 Y 1 A ASP 47 ? OD2 ? A ASP 47 OD2 13 1 Y 1 A ARG 50 ? CG ? A ARG 50 CG 14 1 Y 1 A ARG 50 ? CD ? A ARG 50 CD 15 1 Y 1 A ARG 50 ? NE ? A ARG 50 NE 16 1 Y 1 A ARG 50 ? CZ ? A ARG 50 CZ 17 1 Y 1 A ARG 50 ? NH1 ? A ARG 50 NH1 18 1 Y 1 A ARG 50 ? NH2 ? A ARG 50 NH2 19 1 Y 1 A ARG 81 ? CG ? A ARG 81 CG 20 1 Y 1 A ARG 81 ? CD ? A ARG 81 CD 21 1 Y 1 A ARG 81 ? NE ? A ARG 81 NE 22 1 Y 1 A ARG 81 ? CZ ? A ARG 81 CZ 23 1 Y 1 A ARG 81 ? NH1 ? A ARG 81 NH1 24 1 Y 1 A ARG 81 ? NH2 ? A ARG 81 NH2 25 1 Y 1 A GLU 143 ? CG ? A GLU 143 CG 26 1 Y 1 A GLU 143 ? CD ? A GLU 143 CD 27 1 Y 1 A GLU 143 ? OE1 ? A GLU 143 OE1 28 1 Y 1 A GLU 143 ? OE2 ? A GLU 143 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 28 ? A GLY 28 2 1 Y 1 A GLY 29 ? A GLY 29 3 1 Y 1 A TYR 30 ? A TYR 30 4 1 Y 1 A SER 31 ? A SER 31 5 1 Y 1 A ASN 32 ? A ASN 32 6 1 Y 1 A SER 138 ? A SER 138 7 1 Y 1 A GLY 139 ? A GLY 139 8 1 Y 1 A GLY 140 ? A GLY 140 9 1 Y 1 A SER 171 ? A SER 171 10 1 Y 1 A THR 172 ? A THR 172 11 1 Y 1 A GLY 173 ? A GLY 173 12 1 Y 1 A THR 174 ? A THR 174 13 1 Y 1 A LYS 175 ? A LYS 175 14 1 Y 1 A HIS 176 ? A HIS 176 15 1 Y 1 A HIS 177 ? A HIS 177 16 1 Y 1 A HIS 178 ? A HIS 178 17 1 Y 1 A HIS 179 ? A HIS 179 18 1 Y 1 A HIS 180 ? A HIS 180 19 1 Y 1 A HIS 181 ? A HIS 181 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 NAG C1 C N R 227 NAG C2 C N R 228 NAG C3 C N R 229 NAG C4 C N S 230 NAG C5 C N R 231 NAG C6 C N N 232 NAG C7 C N N 233 NAG C8 C N N 234 NAG N2 N N N 235 NAG O1 O N N 236 NAG O3 O N N 237 NAG O4 O N N 238 NAG O5 O N N 239 NAG O6 O N N 240 NAG O7 O N N 241 NAG H1 H N N 242 NAG H2 H N N 243 NAG H3 H N N 244 NAG H4 H N N 245 NAG H5 H N N 246 NAG H61 H N N 247 NAG H62 H N N 248 NAG H81 H N N 249 NAG H82 H N N 250 NAG H83 H N N 251 NAG HN2 H N N 252 NAG HO1 H N N 253 NAG HO3 H N N 254 NAG HO4 H N N 255 NAG HO6 H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 NAG C1 C2 sing N N 216 NAG C1 O1 sing N N 217 NAG C1 O5 sing N N 218 NAG C1 H1 sing N N 219 NAG C2 C3 sing N N 220 NAG C2 N2 sing N N 221 NAG C2 H2 sing N N 222 NAG C3 C4 sing N N 223 NAG C3 O3 sing N N 224 NAG C3 H3 sing N N 225 NAG C4 C5 sing N N 226 NAG C4 O4 sing N N 227 NAG C4 H4 sing N N 228 NAG C5 C6 sing N N 229 NAG C5 O5 sing N N 230 NAG C5 H5 sing N N 231 NAG C6 O6 sing N N 232 NAG C6 H61 sing N N 233 NAG C6 H62 sing N N 234 NAG C7 C8 sing N N 235 NAG C7 N2 sing N N 236 NAG C7 O7 doub N N 237 NAG C8 H81 sing N N 238 NAG C8 H82 sing N N 239 NAG C8 H83 sing N N 240 NAG N2 HN2 sing N N 241 NAG O1 HO1 sing N N 242 NAG O3 HO3 sing N N 243 NAG O4 HO4 sing N N 244 NAG O6 HO6 sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'P01 AI82362' 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'CHAVI-ID 1UM1AI100663' 2 CAVD 'United States' 'IAVI NAC Center' 3 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'R01 AI084817' 4 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4JPJ _pdbx_initial_refinement_model.details ? #