data_5IEB # _entry.id 5IEB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IEB pdb_00005ieb 10.2210/pdb5ieb/pdb WWPDB D_1000218724 ? ? BMRB 30023 ? 10.13018/BMR30023 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-20 2 'Structure model' 1 1 2016-08-17 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2019-11-06 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_nmr_software 2 4 'Structure model' pdbx_nmr_spectrometer 3 5 'Structure model' chem_comp_atom 4 5 'Structure model' chem_comp_bond 5 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_nmr_software.name' 2 4 'Structure model' '_pdbx_nmr_spectrometer.model' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5IEB _pdbx_database_status.recvd_initial_deposition_date 2016-02-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 30023 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Campagne, S.' 1 'Vorholt, J.A.' 2 'Allain, F.H.-T.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first 1237 _citation.page_last 1247 _citation.title ;Role of the PFXFATG[G/Y] Motif in the Activation of SdrG, a Response Regulator Involved in the Alphaproteobacterial General Stress Response. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2016.05.015 _citation.pdbx_database_id_PubMed 27396826 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Campagne, S.' 1 ? primary 'Dintner, S.' 2 ? primary 'Gottschlich, L.' 3 ? primary 'Thibault, M.' 4 ? primary 'Bortfeld-Miller, M.' 5 ? primary 'Kaczmarczyk, A.' 6 ? primary 'Francez-Charlot, A.' 7 ? primary 'Allain, F.H.' 8 ? primary 'Vorholt, J.A.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sensory transduction regulatory protein' _entity.formula_weight 13892.781 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSALTQILIVEDEPLIAMMLEDFLEVLDKTPVGTVDTVAGALARVEDGGIDAAILDVNLRGGEKSTPVAEALAARDIPFV FATGGSDDSVDSRFRDRPVLQKPFTMDGVAKALAALLVPRGSVEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSALTQILIVEDEPLIAMMLEDFLEVLDKTPVGTVDTVAGALARVEDGGIDAAILDVNLRGGEKSTPVAEALAARDIPFV FATGGSDDSVDSRFRDRPVLQKPFTMDGVAKALAALLVPRGSVEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ALA n 1 4 LEU n 1 5 THR n 1 6 GLN n 1 7 ILE n 1 8 LEU n 1 9 ILE n 1 10 VAL n 1 11 GLU n 1 12 ASP n 1 13 GLU n 1 14 PRO n 1 15 LEU n 1 16 ILE n 1 17 ALA n 1 18 MET n 1 19 MET n 1 20 LEU n 1 21 GLU n 1 22 ASP n 1 23 PHE n 1 24 LEU n 1 25 GLU n 1 26 VAL n 1 27 LEU n 1 28 ASP n 1 29 LYS n 1 30 THR n 1 31 PRO n 1 32 VAL n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 ASP n 1 37 THR n 1 38 VAL n 1 39 ALA n 1 40 GLY n 1 41 ALA n 1 42 LEU n 1 43 ALA n 1 44 ARG n 1 45 VAL n 1 46 GLU n 1 47 ASP n 1 48 GLY n 1 49 GLY n 1 50 ILE n 1 51 ASP n 1 52 ALA n 1 53 ALA n 1 54 ILE n 1 55 LEU n 1 56 ASP n 1 57 VAL n 1 58 ASN n 1 59 LEU n 1 60 ARG n 1 61 GLY n 1 62 GLY n 1 63 GLU n 1 64 LYS n 1 65 SER n 1 66 THR n 1 67 PRO n 1 68 VAL n 1 69 ALA n 1 70 GLU n 1 71 ALA n 1 72 LEU n 1 73 ALA n 1 74 ALA n 1 75 ARG n 1 76 ASP n 1 77 ILE n 1 78 PRO n 1 79 PHE n 1 80 VAL n 1 81 PHE n 1 82 ALA n 1 83 THR n 1 84 GLY n 1 85 GLY n 1 86 SER n 1 87 ASP n 1 88 ASP n 1 89 SER n 1 90 VAL n 1 91 ASP n 1 92 SER n 1 93 ARG n 1 94 PHE n 1 95 ARG n 1 96 ASP n 1 97 ARG n 1 98 PRO n 1 99 VAL n 1 100 LEU n 1 101 GLN n 1 102 LYS n 1 103 PRO n 1 104 PHE n 1 105 THR n 1 106 MET n 1 107 ASP n 1 108 GLY n 1 109 VAL n 1 110 ALA n 1 111 LYS n 1 112 ALA n 1 113 LEU n 1 114 ALA n 1 115 ALA n 1 116 LEU n 1 117 LEU n 1 118 VAL n 1 119 PRO n 1 120 ARG n 1 121 GLY n 1 122 SER n 1 123 VAL n 1 124 GLU n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SR41_04275 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sphingomonas melonis FR1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1090317 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 PRO 119 119 ? ? ? A . n A 1 120 ARG 120 120 ? ? ? A . n A 1 121 GLY 121 121 ? ? ? A . n A 1 122 SER 122 122 ? ? ? A . n A 1 123 VAL 123 123 ? ? ? A . n A 1 124 GLU 124 124 ? ? ? A . n A 1 125 HIS 125 125 ? ? ? A . n A 1 126 HIS 126 126 ? ? ? A . n A 1 127 HIS 127 127 ? ? ? A . n A 1 128 HIS 128 128 ? ? ? A . n A 1 129 HIS 129 129 ? ? ? A . n A 1 130 HIS 130 130 ? ? ? A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5IEB _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IEB _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IEB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 5IEB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 5IEB _struct.title 'Solution structure of SdrG from Sphingomonas melonis Fr1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IEB _struct_keywords.text 'Single domain response regulator FAT GUY Familly, PROTEIN' _struct_keywords.pdbx_keywords PROTEIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0D1MA58_9SPHN _struct_ref.pdbx_db_accession A0A0D1MA58 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSALTQILIVEDEPLIAMMLEDFLEVLDKTPVGTVDTVAGALARVEDGGIDAAILDVNLRGGEKSTPVAEALAARDIPFV FATGGSDDSVDSRFRDRPVLQKPFTMDGVAKALAAL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IEB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0D1MA58 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5IEB LEU A 117 ? UNP A0A0D1MA58 ? ? 'expression tag' 117 1 1 5IEB VAL A 118 ? UNP A0A0D1MA58 ? ? 'expression tag' 118 2 1 5IEB PRO A 119 ? UNP A0A0D1MA58 ? ? 'expression tag' 119 3 1 5IEB ARG A 120 ? UNP A0A0D1MA58 ? ? 'expression tag' 120 4 1 5IEB GLY A 121 ? UNP A0A0D1MA58 ? ? 'expression tag' 121 5 1 5IEB SER A 122 ? UNP A0A0D1MA58 ? ? 'expression tag' 122 6 1 5IEB VAL A 123 ? UNP A0A0D1MA58 ? ? 'expression tag' 123 7 1 5IEB GLU A 124 ? UNP A0A0D1MA58 ? ? 'expression tag' 124 8 1 5IEB HIS A 125 ? UNP A0A0D1MA58 ? ? 'expression tag' 125 9 1 5IEB HIS A 126 ? UNP A0A0D1MA58 ? ? 'expression tag' 126 10 1 5IEB HIS A 127 ? UNP A0A0D1MA58 ? ? 'expression tag' 127 11 1 5IEB HIS A 128 ? UNP A0A0D1MA58 ? ? 'expression tag' 128 12 1 5IEB HIS A 129 ? UNP A0A0D1MA58 ? ? 'expression tag' 129 13 1 5IEB HIS A 130 ? UNP A0A0D1MA58 ? ? 'expression tag' 130 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 13 ? LEU A 27 ? GLU A 13 LEU A 27 1 ? 15 HELX_P HELX_P2 AA2 THR A 37 ? GLU A 46 ? THR A 37 GLU A 46 1 ? 10 HELX_P HELX_P3 AA3 LEU A 59 ? GLU A 63 ? LEU A 59 GLU A 63 5 ? 5 HELX_P HELX_P4 AA4 VAL A 68 ? ARG A 75 ? VAL A 68 ARG A 75 1 ? 8 HELX_P HELX_P5 AA5 THR A 105 ? LEU A 116 ? THR A 105 LEU A 116 1 ? 12 TURN_P TURN_P1 T01 MET A 1 ? LYS A 29 ? MET A 1 LYS A 29 1 ? ? TURN_P TURN_P2 T02 MET A 1 ? GLY A 62 ? MET A 1 GLY A 62 1 ? ? TURN_P TURN_P3 T03 MET A 1 ? ILE A 77 ? MET A 1 ILE A 77 1 ? ? TURN_P TURN_P4 T04 MET A 1 ? PHE A 94 ? MET A 1 PHE A 94 1 ? ? # loop_ _struct_conf_type.id _struct_conf_type.criteria _struct_conf_type.reference HELX_P ? ? TURN_P ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 30 ? VAL A 35 ? THR A 30 VAL A 35 AA1 2 GLN A 6 ? VAL A 10 ? GLN A 6 VAL A 10 AA1 3 ALA A 52 ? ASP A 56 ? ALA A 52 ASP A 56 AA1 4 PHE A 79 ? ALA A 82 ? PHE A 79 ALA A 82 AA1 5 VAL A 99 ? LEU A 100 ? VAL A 99 LEU A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 30 ? O THR A 30 N ILE A 7 ? N ILE A 7 AA1 2 3 N LEU A 8 ? N LEU A 8 O ALA A 52 ? O ALA A 52 AA1 3 4 N LEU A 55 ? N LEU A 55 O VAL A 80 ? O VAL A 80 AA1 4 5 N PHE A 81 ? N PHE A 81 O LEU A 100 ? O LEU A 100 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 5 ? ? -141.52 -30.88 2 1 LEU A 59 ? ? -105.92 -165.08 3 1 SER A 86 ? ? -148.80 -9.25 4 1 SER A 89 ? ? -77.51 32.67 5 1 GLN A 101 ? ? -139.34 -120.51 6 2 THR A 5 ? ? -148.61 -38.77 7 2 SER A 86 ? ? 55.95 11.57 8 2 SER A 89 ? ? -77.28 36.35 9 2 GLN A 101 ? ? -139.82 -120.21 10 3 THR A 5 ? ? -144.70 -32.99 11 3 LEU A 59 ? ? -106.05 -164.79 12 3 SER A 89 ? ? -82.49 36.39 13 3 GLN A 101 ? ? -141.86 -123.99 14 4 THR A 5 ? ? -139.57 -31.93 15 4 ASP A 88 ? ? -69.82 4.92 16 4 SER A 89 ? ? -80.52 38.53 17 4 GLN A 101 ? ? -140.32 -127.54 18 5 THR A 5 ? ? -142.30 -33.57 19 5 SER A 86 ? ? 56.89 10.86 20 5 SER A 89 ? ? -78.45 34.95 21 5 GLN A 101 ? ? -139.54 -120.84 22 6 THR A 5 ? ? -146.92 -46.47 23 6 LEU A 59 ? ? -106.25 -163.53 24 6 SER A 86 ? ? -142.80 -12.55 25 6 SER A 89 ? ? -76.67 29.40 26 6 GLN A 101 ? ? -138.96 -117.70 27 7 THR A 5 ? ? -141.57 -34.48 28 7 LEU A 59 ? ? -105.43 -164.15 29 7 ASP A 87 ? ? 57.90 15.21 30 7 SER A 89 ? ? -78.23 43.74 31 7 GLN A 101 ? ? -139.24 -124.86 32 8 THR A 5 ? ? -135.81 -41.05 33 8 LEU A 59 ? ? -105.62 -166.52 34 8 SER A 86 ? ? 56.98 8.22 35 8 SER A 89 ? ? -78.10 30.76 36 8 PRO A 103 ? ? -54.69 105.91 37 9 THR A 5 ? ? -142.07 -34.22 38 9 SER A 86 ? ? 52.57 12.39 39 9 SER A 89 ? ? -78.01 33.08 40 9 GLN A 101 ? ? -139.55 -117.49 41 10 THR A 5 ? ? -151.12 -42.18 42 10 SER A 86 ? ? -143.18 -10.70 43 10 SER A 89 ? ? -76.72 36.28 44 10 GLN A 101 ? ? -139.64 -121.80 45 10 LEU A 117 ? ? -131.04 -37.28 46 11 THR A 5 ? ? -140.65 -32.04 47 11 LEU A 59 ? ? -102.15 -168.42 48 11 ASP A 76 ? ? 58.62 17.58 49 11 ASP A 87 ? ? 56.68 15.39 50 11 GLN A 101 ? ? -139.43 -123.49 51 12 THR A 5 ? ? -140.99 -32.97 52 12 SER A 86 ? ? -142.37 -17.04 53 12 SER A 89 ? ? -80.38 36.26 54 12 GLN A 101 ? ? -139.49 -117.61 55 13 THR A 5 ? ? -150.13 -51.67 56 13 SER A 86 ? ? -144.97 -13.61 57 13 SER A 89 ? ? -79.40 29.32 58 13 GLN A 101 ? ? -139.37 -115.15 59 14 THR A 5 ? ? -147.34 -33.90 60 14 SER A 86 ? ? -149.73 -12.33 61 14 SER A 89 ? ? -79.13 31.55 62 14 GLN A 101 ? ? -139.47 -123.65 63 15 THR A 5 ? ? -134.47 -34.87 64 15 SER A 86 ? ? -142.94 -13.56 65 15 SER A 89 ? ? -80.98 33.24 66 15 GLN A 101 ? ? -139.36 -119.81 67 16 THR A 5 ? ? -140.78 -38.50 68 16 SER A 89 ? ? -77.11 35.30 69 16 GLN A 101 ? ? -139.39 -124.48 70 17 THR A 5 ? ? -143.32 -31.85 71 17 ASP A 87 ? ? -141.41 12.21 72 17 SER A 89 ? ? -81.28 38.07 73 17 GLN A 101 ? ? -139.15 -115.70 74 18 SER A 2 ? ? 61.00 164.58 75 18 THR A 5 ? ? -152.29 -44.24 76 18 SER A 86 ? ? -143.86 -14.00 77 18 SER A 89 ? ? -79.18 33.12 78 18 GLN A 101 ? ? -139.62 -116.51 79 19 THR A 5 ? ? -141.13 -33.03 80 19 SER A 86 ? ? -144.03 -0.58 81 19 ASP A 88 ? ? -75.24 24.53 82 19 SER A 89 ? ? -75.34 23.85 83 19 PRO A 103 ? ? -58.20 96.22 84 20 THR A 5 ? ? -151.46 -41.73 85 20 LEU A 59 ? ? -109.58 -168.14 86 20 ASP A 87 ? ? -145.63 17.13 87 20 ASP A 88 ? ? -64.77 5.69 88 20 SER A 89 ? ? -80.36 43.12 89 20 GLN A 101 ? ? -142.56 -122.82 # _pdbx_nmr_ensemble.entry_id 5IEB _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5IEB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] SdrG, 10 mM NaPO4, 50 mM NaCl, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C15N _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '1 mM SdrG labeled 13C 15N' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 SdrG 1 ? mM '[U-99% 13C; U-99% 15N]' 1 NaPO4 10 ? mM 'natural abundance' 1 NaCl 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ;Solvent NaPO4 10mM pH 6.5, NaCl50 mM ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 13C15N _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 3 1 1 '3D 1H-15N NOESY' 2 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D CBCA(CO)NH' 1 isotropic 10 1 1 '3D H(CCO)NH' 1 isotropic 9 1 1 '3D C(CO)NH' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '1D H' 1 isotropic # _pdbx_nmr_refine.entry_id 5IEB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.96 'P. Gunther' 2 refinement Amber 12 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 3 collection TopSpin 3.2 'Bruker Biospin' 4 'data analysis' CARA ? 'Keller and Wuthrich' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 119 ? A PRO 119 2 1 Y 1 A ARG 120 ? A ARG 120 3 1 Y 1 A GLY 121 ? A GLY 121 4 1 Y 1 A SER 122 ? A SER 122 5 1 Y 1 A VAL 123 ? A VAL 123 6 1 Y 1 A GLU 124 ? A GLU 124 7 1 Y 1 A HIS 125 ? A HIS 125 8 1 Y 1 A HIS 126 ? A HIS 126 9 1 Y 1 A HIS 127 ? A HIS 127 10 1 Y 1 A HIS 128 ? A HIS 128 11 1 Y 1 A HIS 129 ? A HIS 129 12 1 Y 1 A HIS 130 ? A HIS 130 13 2 Y 1 A PRO 119 ? A PRO 119 14 2 Y 1 A ARG 120 ? A ARG 120 15 2 Y 1 A GLY 121 ? A GLY 121 16 2 Y 1 A SER 122 ? A SER 122 17 2 Y 1 A VAL 123 ? A VAL 123 18 2 Y 1 A GLU 124 ? A GLU 124 19 2 Y 1 A HIS 125 ? A HIS 125 20 2 Y 1 A HIS 126 ? A HIS 126 21 2 Y 1 A HIS 127 ? A HIS 127 22 2 Y 1 A HIS 128 ? A HIS 128 23 2 Y 1 A HIS 129 ? A HIS 129 24 2 Y 1 A HIS 130 ? A HIS 130 25 3 Y 1 A PRO 119 ? A PRO 119 26 3 Y 1 A ARG 120 ? A ARG 120 27 3 Y 1 A GLY 121 ? A GLY 121 28 3 Y 1 A SER 122 ? A SER 122 29 3 Y 1 A VAL 123 ? A VAL 123 30 3 Y 1 A GLU 124 ? A GLU 124 31 3 Y 1 A HIS 125 ? A HIS 125 32 3 Y 1 A HIS 126 ? A HIS 126 33 3 Y 1 A HIS 127 ? A HIS 127 34 3 Y 1 A HIS 128 ? A HIS 128 35 3 Y 1 A HIS 129 ? A HIS 129 36 3 Y 1 A HIS 130 ? A HIS 130 37 4 Y 1 A PRO 119 ? A PRO 119 38 4 Y 1 A ARG 120 ? A ARG 120 39 4 Y 1 A GLY 121 ? A GLY 121 40 4 Y 1 A SER 122 ? A SER 122 41 4 Y 1 A VAL 123 ? A VAL 123 42 4 Y 1 A GLU 124 ? A GLU 124 43 4 Y 1 A HIS 125 ? A HIS 125 44 4 Y 1 A HIS 126 ? A HIS 126 45 4 Y 1 A HIS 127 ? A HIS 127 46 4 Y 1 A HIS 128 ? A HIS 128 47 4 Y 1 A HIS 129 ? A HIS 129 48 4 Y 1 A HIS 130 ? A HIS 130 49 5 Y 1 A PRO 119 ? A PRO 119 50 5 Y 1 A ARG 120 ? A ARG 120 51 5 Y 1 A GLY 121 ? A GLY 121 52 5 Y 1 A SER 122 ? A SER 122 53 5 Y 1 A VAL 123 ? A VAL 123 54 5 Y 1 A GLU 124 ? A GLU 124 55 5 Y 1 A HIS 125 ? A HIS 125 56 5 Y 1 A HIS 126 ? A HIS 126 57 5 Y 1 A HIS 127 ? A HIS 127 58 5 Y 1 A HIS 128 ? A HIS 128 59 5 Y 1 A HIS 129 ? A HIS 129 60 5 Y 1 A HIS 130 ? A HIS 130 61 6 Y 1 A PRO 119 ? A PRO 119 62 6 Y 1 A ARG 120 ? A ARG 120 63 6 Y 1 A GLY 121 ? A GLY 121 64 6 Y 1 A SER 122 ? A SER 122 65 6 Y 1 A VAL 123 ? A VAL 123 66 6 Y 1 A GLU 124 ? A GLU 124 67 6 Y 1 A HIS 125 ? A HIS 125 68 6 Y 1 A HIS 126 ? A HIS 126 69 6 Y 1 A HIS 127 ? A HIS 127 70 6 Y 1 A HIS 128 ? A HIS 128 71 6 Y 1 A HIS 129 ? A HIS 129 72 6 Y 1 A HIS 130 ? A HIS 130 73 7 Y 1 A PRO 119 ? A PRO 119 74 7 Y 1 A ARG 120 ? A ARG 120 75 7 Y 1 A GLY 121 ? A GLY 121 76 7 Y 1 A SER 122 ? A SER 122 77 7 Y 1 A VAL 123 ? A VAL 123 78 7 Y 1 A GLU 124 ? A GLU 124 79 7 Y 1 A HIS 125 ? A HIS 125 80 7 Y 1 A HIS 126 ? A HIS 126 81 7 Y 1 A HIS 127 ? A HIS 127 82 7 Y 1 A HIS 128 ? A HIS 128 83 7 Y 1 A HIS 129 ? A HIS 129 84 7 Y 1 A HIS 130 ? A HIS 130 85 8 Y 1 A PRO 119 ? A PRO 119 86 8 Y 1 A ARG 120 ? A ARG 120 87 8 Y 1 A GLY 121 ? A GLY 121 88 8 Y 1 A SER 122 ? A SER 122 89 8 Y 1 A VAL 123 ? A VAL 123 90 8 Y 1 A GLU 124 ? A GLU 124 91 8 Y 1 A HIS 125 ? A HIS 125 92 8 Y 1 A HIS 126 ? A HIS 126 93 8 Y 1 A HIS 127 ? A HIS 127 94 8 Y 1 A HIS 128 ? A HIS 128 95 8 Y 1 A HIS 129 ? A HIS 129 96 8 Y 1 A HIS 130 ? A HIS 130 97 9 Y 1 A PRO 119 ? A PRO 119 98 9 Y 1 A ARG 120 ? A ARG 120 99 9 Y 1 A GLY 121 ? A GLY 121 100 9 Y 1 A SER 122 ? A SER 122 101 9 Y 1 A VAL 123 ? A VAL 123 102 9 Y 1 A GLU 124 ? A GLU 124 103 9 Y 1 A HIS 125 ? A HIS 125 104 9 Y 1 A HIS 126 ? A HIS 126 105 9 Y 1 A HIS 127 ? A HIS 127 106 9 Y 1 A HIS 128 ? A HIS 128 107 9 Y 1 A HIS 129 ? A HIS 129 108 9 Y 1 A HIS 130 ? A HIS 130 109 10 Y 1 A PRO 119 ? A PRO 119 110 10 Y 1 A ARG 120 ? A ARG 120 111 10 Y 1 A GLY 121 ? A GLY 121 112 10 Y 1 A SER 122 ? A SER 122 113 10 Y 1 A VAL 123 ? A VAL 123 114 10 Y 1 A GLU 124 ? A GLU 124 115 10 Y 1 A HIS 125 ? A HIS 125 116 10 Y 1 A HIS 126 ? A HIS 126 117 10 Y 1 A HIS 127 ? A HIS 127 118 10 Y 1 A HIS 128 ? A HIS 128 119 10 Y 1 A HIS 129 ? A HIS 129 120 10 Y 1 A HIS 130 ? A HIS 130 121 11 Y 1 A PRO 119 ? A PRO 119 122 11 Y 1 A ARG 120 ? A ARG 120 123 11 Y 1 A GLY 121 ? A GLY 121 124 11 Y 1 A SER 122 ? A SER 122 125 11 Y 1 A VAL 123 ? A VAL 123 126 11 Y 1 A GLU 124 ? A GLU 124 127 11 Y 1 A HIS 125 ? A HIS 125 128 11 Y 1 A HIS 126 ? A HIS 126 129 11 Y 1 A HIS 127 ? A HIS 127 130 11 Y 1 A HIS 128 ? A HIS 128 131 11 Y 1 A HIS 129 ? A HIS 129 132 11 Y 1 A HIS 130 ? A HIS 130 133 12 Y 1 A PRO 119 ? A PRO 119 134 12 Y 1 A ARG 120 ? A ARG 120 135 12 Y 1 A GLY 121 ? A GLY 121 136 12 Y 1 A SER 122 ? A SER 122 137 12 Y 1 A VAL 123 ? A VAL 123 138 12 Y 1 A GLU 124 ? A GLU 124 139 12 Y 1 A HIS 125 ? A HIS 125 140 12 Y 1 A HIS 126 ? A HIS 126 141 12 Y 1 A HIS 127 ? A HIS 127 142 12 Y 1 A HIS 128 ? A HIS 128 143 12 Y 1 A HIS 129 ? A HIS 129 144 12 Y 1 A HIS 130 ? A HIS 130 145 13 Y 1 A PRO 119 ? A PRO 119 146 13 Y 1 A ARG 120 ? A ARG 120 147 13 Y 1 A GLY 121 ? A GLY 121 148 13 Y 1 A SER 122 ? A SER 122 149 13 Y 1 A VAL 123 ? A VAL 123 150 13 Y 1 A GLU 124 ? A GLU 124 151 13 Y 1 A HIS 125 ? A HIS 125 152 13 Y 1 A HIS 126 ? A HIS 126 153 13 Y 1 A HIS 127 ? A HIS 127 154 13 Y 1 A HIS 128 ? A HIS 128 155 13 Y 1 A HIS 129 ? A HIS 129 156 13 Y 1 A HIS 130 ? A HIS 130 157 14 Y 1 A PRO 119 ? A PRO 119 158 14 Y 1 A ARG 120 ? A ARG 120 159 14 Y 1 A GLY 121 ? A GLY 121 160 14 Y 1 A SER 122 ? A SER 122 161 14 Y 1 A VAL 123 ? A VAL 123 162 14 Y 1 A GLU 124 ? A GLU 124 163 14 Y 1 A HIS 125 ? A HIS 125 164 14 Y 1 A HIS 126 ? A HIS 126 165 14 Y 1 A HIS 127 ? A HIS 127 166 14 Y 1 A HIS 128 ? A HIS 128 167 14 Y 1 A HIS 129 ? A HIS 129 168 14 Y 1 A HIS 130 ? A HIS 130 169 15 Y 1 A PRO 119 ? A PRO 119 170 15 Y 1 A ARG 120 ? A ARG 120 171 15 Y 1 A GLY 121 ? A GLY 121 172 15 Y 1 A SER 122 ? A SER 122 173 15 Y 1 A VAL 123 ? A VAL 123 174 15 Y 1 A GLU 124 ? A GLU 124 175 15 Y 1 A HIS 125 ? A HIS 125 176 15 Y 1 A HIS 126 ? A HIS 126 177 15 Y 1 A HIS 127 ? A HIS 127 178 15 Y 1 A HIS 128 ? A HIS 128 179 15 Y 1 A HIS 129 ? A HIS 129 180 15 Y 1 A HIS 130 ? A HIS 130 181 16 Y 1 A PRO 119 ? A PRO 119 182 16 Y 1 A ARG 120 ? A ARG 120 183 16 Y 1 A GLY 121 ? A GLY 121 184 16 Y 1 A SER 122 ? A SER 122 185 16 Y 1 A VAL 123 ? A VAL 123 186 16 Y 1 A GLU 124 ? A GLU 124 187 16 Y 1 A HIS 125 ? A HIS 125 188 16 Y 1 A HIS 126 ? A HIS 126 189 16 Y 1 A HIS 127 ? A HIS 127 190 16 Y 1 A HIS 128 ? A HIS 128 191 16 Y 1 A HIS 129 ? A HIS 129 192 16 Y 1 A HIS 130 ? A HIS 130 193 17 Y 1 A PRO 119 ? A PRO 119 194 17 Y 1 A ARG 120 ? A ARG 120 195 17 Y 1 A GLY 121 ? A GLY 121 196 17 Y 1 A SER 122 ? A SER 122 197 17 Y 1 A VAL 123 ? A VAL 123 198 17 Y 1 A GLU 124 ? A GLU 124 199 17 Y 1 A HIS 125 ? A HIS 125 200 17 Y 1 A HIS 126 ? A HIS 126 201 17 Y 1 A HIS 127 ? A HIS 127 202 17 Y 1 A HIS 128 ? A HIS 128 203 17 Y 1 A HIS 129 ? A HIS 129 204 17 Y 1 A HIS 130 ? A HIS 130 205 18 Y 1 A PRO 119 ? A PRO 119 206 18 Y 1 A ARG 120 ? A ARG 120 207 18 Y 1 A GLY 121 ? A GLY 121 208 18 Y 1 A SER 122 ? A SER 122 209 18 Y 1 A VAL 123 ? A VAL 123 210 18 Y 1 A GLU 124 ? A GLU 124 211 18 Y 1 A HIS 125 ? A HIS 125 212 18 Y 1 A HIS 126 ? A HIS 126 213 18 Y 1 A HIS 127 ? A HIS 127 214 18 Y 1 A HIS 128 ? A HIS 128 215 18 Y 1 A HIS 129 ? A HIS 129 216 18 Y 1 A HIS 130 ? A HIS 130 217 19 Y 1 A PRO 119 ? A PRO 119 218 19 Y 1 A ARG 120 ? A ARG 120 219 19 Y 1 A GLY 121 ? A GLY 121 220 19 Y 1 A SER 122 ? A SER 122 221 19 Y 1 A VAL 123 ? A VAL 123 222 19 Y 1 A GLU 124 ? A GLU 124 223 19 Y 1 A HIS 125 ? A HIS 125 224 19 Y 1 A HIS 126 ? A HIS 126 225 19 Y 1 A HIS 127 ? A HIS 127 226 19 Y 1 A HIS 128 ? A HIS 128 227 19 Y 1 A HIS 129 ? A HIS 129 228 19 Y 1 A HIS 130 ? A HIS 130 229 20 Y 1 A PRO 119 ? A PRO 119 230 20 Y 1 A ARG 120 ? A ARG 120 231 20 Y 1 A GLY 121 ? A GLY 121 232 20 Y 1 A SER 122 ? A SER 122 233 20 Y 1 A VAL 123 ? A VAL 123 234 20 Y 1 A GLU 124 ? A GLU 124 235 20 Y 1 A HIS 125 ? A HIS 125 236 20 Y 1 A HIS 126 ? A HIS 126 237 20 Y 1 A HIS 127 ? A HIS 127 238 20 Y 1 A HIS 128 ? A HIS 128 239 20 Y 1 A HIS 129 ? A HIS 129 240 20 Y 1 A HIS 130 ? A HIS 130 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 VAL N CA sing N N 291 VAL N H sing N N 292 VAL N H2 sing N N 293 VAL CA C sing N N 294 VAL CA CB sing N N 295 VAL CA HA sing N N 296 VAL C O doub N N 297 VAL C OXT sing N N 298 VAL CB CG1 sing N N 299 VAL CB CG2 sing N N 300 VAL CB HB sing N N 301 VAL CG1 HG11 sing N N 302 VAL CG1 HG12 sing N N 303 VAL CG1 HG13 sing N N 304 VAL CG2 HG21 sing N N 305 VAL CG2 HG22 sing N N 306 VAL CG2 HG23 sing N N 307 VAL OXT HXT sing N N 308 # _pdbx_audit_support.funding_organization ETH _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number 'ETH-21 09-3' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 500 'cryo probbed' 2 'AVANCE II' ? Bruker 900 'cryo probbed' # _atom_sites.entry_id 5IEB _atom_sites.fract_transf_matrix[1][1] 0.001000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.001000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.001000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #