data_5II6 # _entry.id 5II6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5II6 pdb_00005ii6 10.2210/pdb5ii6/pdb WWPDB D_1000218160 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-14 2 'Structure model' 1 1 2017-06-28 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Database references' 4 5 'Structure model' Advisory 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_database_related 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature 10 5 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_pdbx_audit_support.funding_organization' 13 4 'Structure model' '_pdbx_database_related.db_id' 14 5 'Structure model' '_database_2.pdbx_DOI' 15 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5II6 _pdbx_database_status.recvd_initial_deposition_date 2016-03-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 3D4C unspecified PDB . 3D4G unspecified PDB . 3EF7 unspecified PDB . 3NK3 unspecified PDB . 3NK4 unspecified PDB . 5BUP unspecified PDB 'Related entry under submission' 5II5 unspecified PDB 'Related entry under submission' 5II4 unspecified PDB 'Related entry under submission' 5IIC unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dioguardi, E.' 1 'Han, L.' 2 'Nishimura, K.' 3 'De Sanctis, D.' 4 'Jovine, L.' 5 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary Cell ? ? 1097-4172 ? ? 169 ? 1315 1326.e17 'Structural Basis of Egg Coat-Sperm Recognition at Fertilization.' 2017 ? 10.1016/j.cell.2017.05.033 28622512 ? ? ? ? ? ? ? ? US ? ? 1 'J. Cell Biol.' JCLBA3 2019 1540-8140 ? ? 205 ? 801 809 'A single domain of the ZP2 zona pellucida protein mediates gamete recognition in mice and humans.' 2014 ? 10.1083/jcb.201404025 24934154 ? ? ? ? ? ? ? ? US ? ? 2 'J. Cell Biol.' JCLBA3 2019 1540-8140 ? ? 197 ? 897 905 'Human sperm bind to the N-terminal domain of ZP2 in humanized zonae pellucidae in transgenic mice.' 2012 ? 10.1083/jcb.201203062 22734000 ? ? ? ? ? ? ? ? US ? ? 3 Science SCIEAS 0038 1095-9203 ? ? 329 ? 216 219 ;Gamete recognition in mice depends on the cleavage status of an egg's zona pellucida protein. ; 2010 ? 10.1126/science.1188178 20616279 ? ? ? ? ? ? ? ? UK ? ? 4 Nature NATUAS 0006 1476-4687 ? ? 456 ? 653 657 'Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats.' 2008 ? 10.1038/nature07599 19052627 ? ? ? ? ? ? ? ? US ? ? 5 'J. Biol. Chem.' JBCHA3 0071 0021-9258 ? ? 278 ? 34189 34202 'Structural characterization of native mouse zona pellucida proteins using mass spectrometry.' 2003 ? ? 12799386 ? ? ? ? ? ? ? ? US ? ? 6 'Mol. Cell. Biol.' MCEBD4 2044 0270-7306 ? ? 10 ? 1507 1515 'Oocyte-specific expression of mouse Zp-2: developmental regulation of the zona pellucida genes.' 1990 ? ? 0001690843 ? ? ? ? ? ? ? ? US ? ? 7 Cell CELLB5 0998 0092-8674 ? ? 31 ? 749 759 'Biosynthesis of the major zona pellucida glycoprotein secreted by oocytes during mammalian oogenesis.' 1982 ? ? 0006819087 ? ? ? ? ? ? ? ? US ? ? 8 'Dev. Biol.' ? ? 0012-1606 ? ? 86 ? 189 197 'Mammalian sperm-egg interaction: fertilization of mouse eggs triggers modification of the major zona pellucida glycoprotein, ZP2.' 1981 ? ? 0006793422 ? ? ? ? ? ? ? ? US ? ? 9 'Proc. Natl. Acad. Sci. U.S.A.' PNASA6 0040 0027-8424 ? ? 77 ? 1029 1033 'Synthesis of zona pellucida proteins by denuded and follicle-enclosed mouse oocytes during culture in vitro.' 1980 ? ? 0006928658 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Raj, I.' 1 ? primary 'Sadat Al Hosseini, H.' 2 ? primary 'Dioguardi, E.' 3 ? primary 'Nishimura, K.' 4 ? primary 'Han, L.' 5 ? primary 'Villa, A.' 6 ? primary 'de Sanctis, D.' 7 ? primary 'Jovine, L.' 8 ? 1 'Avella, M.A.' 9 ? 1 'Baibakov, B.' 10 ? 1 'Dean, J.' 11 ? 2 'Baibakov, B.' 12 ? 2 'Boggs, N.A.' 13 ? 2 'Yauger, B.' 14 ? 2 'Baibakov, G.' 15 ? 2 'Dean, J.' 16 ? 3 'Gahlay, G.' 17 ? 3 'Gauthier, L.' 18 ? 3 'Baibakov, B.' 19 ? 3 'Epifano, O.' 20 ? 3 'Dean, J.' 21 ? 4 'Monne, M.' 22 ? 4 'Han, L.' 23 ? 4 'Schwend, T.' 24 ? 4 'Burendahl, S.' 25 ? 4 'Jovine, L.' 26 ? 5 'Boja, E.S.' 27 ? 5 'Hoodbhoy, T.' 28 ? 5 'Fales, H.M.' 29 ? 5 'Dean, J.' 30 ? 6 'Liang, L.F.' 31 ? 6 'Chamow, S.M.' 32 ? 6 'Dean, J.' 33 ? 7 'Greve, J.M.' 34 ? 7 'Salzmann, G.S.' 35 ? 7 'Roller, R.J.' 36 ? 7 'Wassarman, P.M.' 37 ? 8 'Bleil, J.D.' 38 ? 8 'Beall, C.F.' 39 ? 8 'Wassarman, P.M.' 40 ? 9 'Bleil, J.D.' 41 ? 9 'Wassarman, P.M.' 42 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zona pellucida sperm-binding protein 2' 12994.641 1 ? N83S 'UNP residues 35-138' ? 2 water nat water 18.015 142 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zona pellucida glycoprotein 2,Zp-2,Zona pellucida protein A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VSLPQSENPAFPGTLICDKDEVRIEFSSRFDMEKWNPSVVDTLGSEILSCTYALDLERFVLKFPYETCTIKVVGGYQVNI RVGDTTTDVRYKDDMYHFFCPAIQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;VSLPQSENPAFPGTLICDKDEVRIEFSSRFDMEKWNPSVVDTLGSEILSCTYALDLERFVLKFPYETCTIKVVGGYQVNI RVGDTTTDVRYKDDMYHFFCPAIQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 SER n 1 3 LEU n 1 4 PRO n 1 5 GLN n 1 6 SER n 1 7 GLU n 1 8 ASN n 1 9 PRO n 1 10 ALA n 1 11 PHE n 1 12 PRO n 1 13 GLY n 1 14 THR n 1 15 LEU n 1 16 ILE n 1 17 CYS n 1 18 ASP n 1 19 LYS n 1 20 ASP n 1 21 GLU n 1 22 VAL n 1 23 ARG n 1 24 ILE n 1 25 GLU n 1 26 PHE n 1 27 SER n 1 28 SER n 1 29 ARG n 1 30 PHE n 1 31 ASP n 1 32 MET n 1 33 GLU n 1 34 LYS n 1 35 TRP n 1 36 ASN n 1 37 PRO n 1 38 SER n 1 39 VAL n 1 40 VAL n 1 41 ASP n 1 42 THR n 1 43 LEU n 1 44 GLY n 1 45 SER n 1 46 GLU n 1 47 ILE n 1 48 LEU n 1 49 SER n 1 50 CYS n 1 51 THR n 1 52 TYR n 1 53 ALA n 1 54 LEU n 1 55 ASP n 1 56 LEU n 1 57 GLU n 1 58 ARG n 1 59 PHE n 1 60 VAL n 1 61 LEU n 1 62 LYS n 1 63 PHE n 1 64 PRO n 1 65 TYR n 1 66 GLU n 1 67 THR n 1 68 CYS n 1 69 THR n 1 70 ILE n 1 71 LYS n 1 72 VAL n 1 73 VAL n 1 74 GLY n 1 75 GLY n 1 76 TYR n 1 77 GLN n 1 78 VAL n 1 79 ASN n 1 80 ILE n 1 81 ARG n 1 82 VAL n 1 83 GLY n 1 84 ASP n 1 85 THR n 1 86 THR n 1 87 THR n 1 88 ASP n 1 89 VAL n 1 90 ARG n 1 91 TYR n 1 92 LYS n 1 93 ASP n 1 94 ASP n 1 95 MET n 1 96 TYR n 1 97 HIS n 1 98 PHE n 1 99 PHE n 1 100 CYS n 1 101 PRO n 1 102 ALA n 1 103 ILE n 1 104 GLN n 1 105 LEU n 1 106 GLU n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 112 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Zp2, Zp-2, Zpa' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name Human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line HEK-293T _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pHLsec _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 35 ? ? ? A . n A 1 2 SER 2 36 ? ? ? A . n A 1 3 LEU 3 37 ? ? ? A . n A 1 4 PRO 4 38 ? ? ? A . n A 1 5 GLN 5 39 ? ? ? A . n A 1 6 SER 6 40 ? ? ? A . n A 1 7 GLU 7 41 ? ? ? A . n A 1 8 ASN 8 42 42 ASN ASN A . n A 1 9 PRO 9 43 43 PRO PRO A . n A 1 10 ALA 10 44 44 ALA ALA A . n A 1 11 PHE 11 45 45 PHE PHE A . n A 1 12 PRO 12 46 46 PRO PRO A . n A 1 13 GLY 13 47 47 GLY GLY A . n A 1 14 THR 14 48 48 THR THR A . n A 1 15 LEU 15 49 49 LEU LEU A . n A 1 16 ILE 16 50 50 ILE ILE A . n A 1 17 CYS 17 51 51 CYS CYS A . n A 1 18 ASP 18 52 52 ASP ASP A . n A 1 19 LYS 19 53 53 LYS LYS A . n A 1 20 ASP 20 54 54 ASP ASP A . n A 1 21 GLU 21 55 55 GLU GLU A . n A 1 22 VAL 22 56 56 VAL VAL A . n A 1 23 ARG 23 57 57 ARG ARG A . n A 1 24 ILE 24 58 58 ILE ILE A . n A 1 25 GLU 25 59 59 GLU GLU A . n A 1 26 PHE 26 60 60 PHE PHE A . n A 1 27 SER 27 61 61 SER SER A . n A 1 28 SER 28 62 62 SER SER A . n A 1 29 ARG 29 63 63 ARG ARG A . n A 1 30 PHE 30 64 64 PHE PHE A . n A 1 31 ASP 31 65 65 ASP ASP A . n A 1 32 MET 32 66 66 MET MET A . n A 1 33 GLU 33 67 67 GLU GLU A . n A 1 34 LYS 34 68 68 LYS LYS A . n A 1 35 TRP 35 69 69 TRP TRP A . n A 1 36 ASN 36 70 70 ASN ASN A . n A 1 37 PRO 37 71 71 PRO PRO A . n A 1 38 SER 38 72 72 SER SER A . n A 1 39 VAL 39 73 73 VAL VAL A . n A 1 40 VAL 40 74 74 VAL VAL A . n A 1 41 ASP 41 75 75 ASP ASP A . n A 1 42 THR 42 76 76 THR THR A . n A 1 43 LEU 43 77 77 LEU LEU A . n A 1 44 GLY 44 78 78 GLY GLY A . n A 1 45 SER 45 79 79 SER SER A . n A 1 46 GLU 46 80 80 GLU GLU A . n A 1 47 ILE 47 81 81 ILE ILE A . n A 1 48 LEU 48 82 82 LEU LEU A . n A 1 49 SER 49 83 83 SER SER A . n A 1 50 CYS 50 84 84 CYS CYS A . n A 1 51 THR 51 85 85 THR THR A . n A 1 52 TYR 52 86 86 TYR TYR A . n A 1 53 ALA 53 87 87 ALA ALA A . n A 1 54 LEU 54 88 88 LEU LEU A . n A 1 55 ASP 55 89 89 ASP ASP A . n A 1 56 LEU 56 90 90 LEU LEU A . n A 1 57 GLU 57 91 91 GLU GLU A . n A 1 58 ARG 58 92 92 ARG ARG A . n A 1 59 PHE 59 93 93 PHE PHE A . n A 1 60 VAL 60 94 94 VAL VAL A . n A 1 61 LEU 61 95 95 LEU LEU A . n A 1 62 LYS 62 96 96 LYS LYS A . n A 1 63 PHE 63 97 97 PHE PHE A . n A 1 64 PRO 64 98 98 PRO PRO A . n A 1 65 TYR 65 99 99 TYR TYR A . n A 1 66 GLU 66 100 100 GLU GLU A . n A 1 67 THR 67 101 101 THR THR A . n A 1 68 CYS 68 102 102 CYS CYS A . n A 1 69 THR 69 103 103 THR THR A . n A 1 70 ILE 70 104 104 ILE ILE A . n A 1 71 LYS 71 105 105 LYS LYS A . n A 1 72 VAL 72 106 106 VAL VAL A . n A 1 73 VAL 73 107 107 VAL VAL A . n A 1 74 GLY 74 108 108 GLY GLY A . n A 1 75 GLY 75 109 109 GLY GLY A . n A 1 76 TYR 76 110 110 TYR TYR A . n A 1 77 GLN 77 111 111 GLN GLN A . n A 1 78 VAL 78 112 112 VAL VAL A . n A 1 79 ASN 79 113 113 ASN ASN A . n A 1 80 ILE 80 114 114 ILE ILE A . n A 1 81 ARG 81 115 115 ARG ARG A . n A 1 82 VAL 82 116 116 VAL VAL A . n A 1 83 GLY 83 117 117 GLY GLY A . n A 1 84 ASP 84 118 ? ? ? A . n A 1 85 THR 85 119 ? ? ? A . n A 1 86 THR 86 120 ? ? ? A . n A 1 87 THR 87 121 ? ? ? A . n A 1 88 ASP 88 122 ? ? ? A . n A 1 89 VAL 89 123 123 VAL VAL A . n A 1 90 ARG 90 124 124 ARG ARG A . n A 1 91 TYR 91 125 125 TYR TYR A . n A 1 92 LYS 92 126 126 LYS LYS A . n A 1 93 ASP 93 127 127 ASP ASP A . n A 1 94 ASP 94 128 128 ASP ASP A . n A 1 95 MET 95 129 129 MET MET A . n A 1 96 TYR 96 130 130 TYR TYR A . n A 1 97 HIS 97 131 131 HIS HIS A . n A 1 98 PHE 98 132 132 PHE PHE A . n A 1 99 PHE 99 133 133 PHE PHE A . n A 1 100 CYS 100 134 134 CYS CYS A . n A 1 101 PRO 101 135 135 PRO PRO A . n A 1 102 ALA 102 136 136 ALA ALA A . n A 1 103 ILE 103 137 137 ILE ILE A . n A 1 104 GLN 104 138 138 GLN GLN A . n A 1 105 LEU 105 139 139 LEU LEU A . n A 1 106 GLU 106 140 140 GLU GLU A . n A 1 107 HIS 107 141 141 HIS HIS A . n A 1 108 HIS 108 142 142 HIS HIS A . n A 1 109 HIS 109 143 143 HIS HIS A . n A 1 110 HIS 110 144 144 HIS HIS A . n A 1 111 HIS 111 145 145 HIS HIS A . n A 1 112 HIS 112 146 146 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 141 HOH HOH A . B 2 HOH 2 202 140 HOH HOH A . B 2 HOH 3 203 115 HOH HOH A . B 2 HOH 4 204 107 HOH HOH A . B 2 HOH 5 205 118 HOH HOH A . B 2 HOH 6 206 44 HOH HOH A . B 2 HOH 7 207 112 HOH HOH A . B 2 HOH 8 208 142 HOH HOH A . B 2 HOH 9 209 82 HOH HOH A . B 2 HOH 10 210 73 HOH HOH A . B 2 HOH 11 211 105 HOH HOH A . B 2 HOH 12 212 8 HOH HOH A . B 2 HOH 13 213 130 HOH HOH A . B 2 HOH 14 214 120 HOH HOH A . B 2 HOH 15 215 100 HOH HOH A . B 2 HOH 16 216 113 HOH HOH A . B 2 HOH 17 217 102 HOH HOH A . B 2 HOH 18 218 139 HOH HOH A . B 2 HOH 19 219 42 HOH HOH A . B 2 HOH 20 220 33 HOH HOH A . B 2 HOH 21 221 111 HOH HOH A . B 2 HOH 22 222 138 HOH HOH A . B 2 HOH 23 223 12 HOH HOH A . B 2 HOH 24 224 48 HOH HOH A . B 2 HOH 25 225 20 HOH HOH A . B 2 HOH 26 226 109 HOH HOH A . B 2 HOH 27 227 63 HOH HOH A . B 2 HOH 28 228 60 HOH HOH A . B 2 HOH 29 229 59 HOH HOH A . B 2 HOH 30 230 69 HOH HOH A . B 2 HOH 31 231 27 HOH HOH A . B 2 HOH 32 232 17 HOH HOH A . B 2 HOH 33 233 14 HOH HOH A . B 2 HOH 34 234 74 HOH HOH A . B 2 HOH 35 235 6 HOH HOH A . B 2 HOH 36 236 45 HOH HOH A . B 2 HOH 37 237 104 HOH HOH A . B 2 HOH 38 238 10 HOH HOH A . B 2 HOH 39 239 90 HOH HOH A . B 2 HOH 40 240 31 HOH HOH A . B 2 HOH 41 241 26 HOH HOH A . B 2 HOH 42 242 1 HOH HOH A . B 2 HOH 43 243 122 HOH HOH A . B 2 HOH 44 244 2 HOH HOH A . B 2 HOH 45 245 9 HOH HOH A . B 2 HOH 46 246 84 HOH HOH A . B 2 HOH 47 247 119 HOH HOH A . B 2 HOH 48 248 22 HOH HOH A . B 2 HOH 49 249 76 HOH HOH A . B 2 HOH 50 250 83 HOH HOH A . B 2 HOH 51 251 15 HOH HOH A . B 2 HOH 52 252 95 HOH HOH A . B 2 HOH 53 253 4 HOH HOH A . B 2 HOH 54 254 85 HOH HOH A . B 2 HOH 55 255 29 HOH HOH A . B 2 HOH 56 256 39 HOH HOH A . B 2 HOH 57 257 7 HOH HOH A . B 2 HOH 58 258 23 HOH HOH A . B 2 HOH 59 259 40 HOH HOH A . B 2 HOH 60 260 62 HOH HOH A . B 2 HOH 61 261 38 HOH HOH A . B 2 HOH 62 262 75 HOH HOH A . B 2 HOH 63 263 41 HOH HOH A . B 2 HOH 64 264 89 HOH HOH A . B 2 HOH 65 265 3 HOH HOH A . B 2 HOH 66 266 91 HOH HOH A . B 2 HOH 67 267 5 HOH HOH A . B 2 HOH 68 268 106 HOH HOH A . B 2 HOH 69 269 71 HOH HOH A . B 2 HOH 70 270 127 HOH HOH A . B 2 HOH 71 271 57 HOH HOH A . B 2 HOH 72 272 81 HOH HOH A . B 2 HOH 73 273 19 HOH HOH A . B 2 HOH 74 274 30 HOH HOH A . B 2 HOH 75 275 32 HOH HOH A . B 2 HOH 76 276 46 HOH HOH A . B 2 HOH 77 277 110 HOH HOH A . B 2 HOH 78 278 66 HOH HOH A . B 2 HOH 79 279 58 HOH HOH A . B 2 HOH 80 280 77 HOH HOH A . B 2 HOH 81 281 52 HOH HOH A . B 2 HOH 82 282 21 HOH HOH A . B 2 HOH 83 283 65 HOH HOH A . B 2 HOH 84 284 43 HOH HOH A . B 2 HOH 85 285 18 HOH HOH A . B 2 HOH 86 286 13 HOH HOH A . B 2 HOH 87 287 28 HOH HOH A . B 2 HOH 88 288 35 HOH HOH A . B 2 HOH 89 289 86 HOH HOH A . B 2 HOH 90 290 25 HOH HOH A . B 2 HOH 91 291 24 HOH HOH A . B 2 HOH 92 292 123 HOH HOH A . B 2 HOH 93 293 37 HOH HOH A . B 2 HOH 94 294 128 HOH HOH A . B 2 HOH 95 295 129 HOH HOH A . B 2 HOH 96 296 121 HOH HOH A . B 2 HOH 97 297 53 HOH HOH A . B 2 HOH 98 298 36 HOH HOH A . B 2 HOH 99 299 79 HOH HOH A . B 2 HOH 100 300 101 HOH HOH A . B 2 HOH 101 301 50 HOH HOH A . B 2 HOH 102 302 64 HOH HOH A . B 2 HOH 103 303 99 HOH HOH A . B 2 HOH 104 304 11 HOH HOH A . B 2 HOH 105 305 103 HOH HOH A . B 2 HOH 106 306 132 HOH HOH A . B 2 HOH 107 307 137 HOH HOH A . B 2 HOH 108 308 136 HOH HOH A . B 2 HOH 109 309 98 HOH HOH A . B 2 HOH 110 310 67 HOH HOH A . B 2 HOH 111 311 61 HOH HOH A . B 2 HOH 112 312 124 HOH HOH A . B 2 HOH 113 313 117 HOH HOH A . B 2 HOH 114 314 56 HOH HOH A . B 2 HOH 115 315 51 HOH HOH A . B 2 HOH 116 316 68 HOH HOH A . B 2 HOH 117 317 116 HOH HOH A . B 2 HOH 118 318 97 HOH HOH A . B 2 HOH 119 319 54 HOH HOH A . B 2 HOH 120 320 70 HOH HOH A . B 2 HOH 121 321 47 HOH HOH A . B 2 HOH 122 322 16 HOH HOH A . B 2 HOH 123 323 34 HOH HOH A . B 2 HOH 124 324 72 HOH HOH A . B 2 HOH 125 325 134 HOH HOH A . B 2 HOH 126 326 108 HOH HOH A . B 2 HOH 127 327 78 HOH HOH A . B 2 HOH 128 328 131 HOH HOH A . B 2 HOH 129 329 94 HOH HOH A . B 2 HOH 130 330 88 HOH HOH A . B 2 HOH 131 331 125 HOH HOH A . B 2 HOH 132 332 96 HOH HOH A . B 2 HOH 133 333 55 HOH HOH A . B 2 HOH 134 334 80 HOH HOH A . B 2 HOH 135 335 114 HOH HOH A . B 2 HOH 136 336 126 HOH HOH A . B 2 HOH 137 337 87 HOH HOH A . B 2 HOH 138 338 135 HOH HOH A . B 2 HOH 139 339 49 HOH HOH A . B 2 HOH 140 340 93 HOH HOH A . B 2 HOH 141 341 133 HOH HOH A . B 2 HOH 142 342 92 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 0 A HOH 201 ? O A B HOH ? O 2 1 N 0 A HOH 208 ? O A B HOH ? O # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_2386: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXCD ? ? ? . 4 # _cell.entry_id 5II6 _cell.length_a 39.539 _cell.length_b 50.013 _cell.length_c 51.751 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5II6 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5II6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.8 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 200, 5% PEG 3000, 0.1 M MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.88560 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.88560 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 11.02 _reflns.entry_id 5II6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.950 _reflns.d_resolution_low 31.419 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 64506 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_Rmerge_I_obs 0.02234 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.00 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 0.950 _reflns_shell.d_res_low 0.984 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.66 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 90 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.2419 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5II6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 64499 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 31.419 _refine.ls_d_res_high 0.950 _refine.ls_percent_reflns_obs 98.70 _refine.ls_R_factor_obs 0.1276 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1267 _refine.ls_R_factor_R_free 0.1448 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.01 _refine.ls_number_reflns_R_free 3230 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.06 _refine.pdbx_overall_phase_error 12.12 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 825 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 142 _refine_hist.number_atoms_total 967 _refine_hist.d_res_high 0.950 _refine_hist.d_res_low 31.419 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.016 ? ? 936 'X-RAY DIFFRACTION' ? f_angle_d 1.458 ? ? 1281 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 12.059 ? ? 355 'X-RAY DIFFRACTION' ? f_chiral_restr 0.113 ? ? 132 'X-RAY DIFFRACTION' ? f_plane_restr 0.012 ? ? 171 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 0.9500 0.9642 2263 0.2350 84.00 0.2427 . . 123 . . 'X-RAY DIFFRACTION' . 0.9642 0.9793 2449 0.2072 93.00 0.2244 . . 144 . . 'X-RAY DIFFRACTION' . 0.9793 0.9953 2692 0.1841 100.00 0.1808 . . 135 . . 'X-RAY DIFFRACTION' . 0.9953 1.0125 2670 0.1709 100.00 0.1868 . . 121 . . 'X-RAY DIFFRACTION' . 1.0125 1.0309 2619 0.1560 100.00 0.1795 . . 151 . . 'X-RAY DIFFRACTION' . 1.0309 1.0507 2689 0.1403 99.00 0.1752 . . 122 . . 'X-RAY DIFFRACTION' . 1.0507 1.0722 2590 0.1311 97.00 0.1509 . . 136 . . 'X-RAY DIFFRACTION' . 1.0722 1.0955 2670 0.1126 100.00 0.1371 . . 147 . . 'X-RAY DIFFRACTION' . 1.0955 1.1210 2673 0.1053 100.00 0.1079 . . 127 . . 'X-RAY DIFFRACTION' . 1.1210 1.1490 2669 0.0993 100.00 0.1148 . . 147 . . 'X-RAY DIFFRACTION' . 1.1490 1.1801 2657 0.0952 100.00 0.1159 . . 152 . . 'X-RAY DIFFRACTION' . 1.1801 1.2148 2639 0.0965 99.00 0.1174 . . 154 . . 'X-RAY DIFFRACTION' . 1.2148 1.2540 2672 0.1005 100.00 0.1229 . . 128 . . 'X-RAY DIFFRACTION' . 1.2540 1.2988 2699 0.1033 100.00 0.1057 . . 132 . . 'X-RAY DIFFRACTION' . 1.2988 1.3508 2675 0.1007 100.00 0.1264 . . 158 . . 'X-RAY DIFFRACTION' . 1.3508 1.4123 2685 0.1018 100.00 0.1239 . . 162 . . 'X-RAY DIFFRACTION' . 1.4123 1.4868 2669 0.1001 99.00 0.1293 . . 135 . . 'X-RAY DIFFRACTION' . 1.4868 1.5799 2725 0.1054 100.00 0.1192 . . 129 . . 'X-RAY DIFFRACTION' . 1.5799 1.7019 2706 0.1126 100.00 0.1390 . . 145 . . 'X-RAY DIFFRACTION' . 1.7019 1.8731 2743 0.1164 100.00 0.1239 . . 132 . . 'X-RAY DIFFRACTION' . 1.8731 2.1441 2734 0.1195 100.00 0.1336 . . 142 . . 'X-RAY DIFFRACTION' . 2.1441 2.7011 2762 0.1336 100.00 0.1495 . . 161 . . 'X-RAY DIFFRACTION' . 2.7011 31.4358 2919 0.1476 100.00 0.1701 . . 147 . . # _struct.entry_id 5II6 _struct.title 'Crystal structure of the ZP-N1 domain of mouse sperm receptor ZP2 at 0.95 A resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5II6 _struct_keywords.text ;CELL ADHESION, FERTILIZATION, EGG-SPERM INTERACTION, GAMETE RECOGNITION, SPERM RECEPTOR, EGG COAT, ZONA PELLUCIDA, ZP DOMAIN, ZP-N DOMAIN ; _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZP2_MOUSE _struct_ref.pdbx_db_accession P20239 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSLPQSENPAFPGTLICDKDEVRIEFSSRFDMEKWNPSVVDTLGSEILNCTYALDLERFVLKFPYETCTIKVVGGYQVNI RVGDTTTDVRYKDDMYHFFCPAIQ ; _struct_ref.pdbx_align_begin 35 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5II6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20239 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 35 _struct_ref_seq.pdbx_auth_seq_align_end 138 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5II6 SER A 49 ? UNP P20239 ASN 83 'engineered mutation' 83 1 1 5II6 LEU A 105 ? UNP P20239 ? ? 'expression tag' 139 2 1 5II6 GLU A 106 ? UNP P20239 ? ? 'expression tag' 140 3 1 5II6 HIS A 107 ? UNP P20239 ? ? 'expression tag' 141 4 1 5II6 HIS A 108 ? UNP P20239 ? ? 'expression tag' 142 5 1 5II6 HIS A 109 ? UNP P20239 ? ? 'expression tag' 143 6 1 5II6 HIS A 110 ? UNP P20239 ? ? 'expression tag' 144 7 1 5II6 HIS A 111 ? UNP P20239 ? ? 'expression tag' 145 8 1 5II6 HIS A 112 ? UNP P20239 ? ? 'expression tag' 146 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7150 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 28 ? ASN A 36 ? SER A 62 ASN A 70 1 ? 9 HELX_P HELX_P2 AA2 PRO A 64 ? THR A 69 ? PRO A 98 THR A 103 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 100 SG ? ? A CYS 51 A CYS 134 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 50 SG ? ? ? 1_555 A CYS 68 SG ? ? A CYS 84 A CYS 102 1_555 ? ? ? ? ? ? ? 2.063 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 17 ? CYS A 100 ? CYS A 51 ? 1_555 CYS A 134 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 50 ? CYS A 68 ? CYS A 84 ? 1_555 CYS A 102 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 14 ? CYS A 17 ? THR A 48 CYS A 51 AA1 2 VAL A 22 ? GLU A 25 ? VAL A 56 GLU A 59 AA1 3 VAL A 60 ? PHE A 63 ? VAL A 94 PHE A 97 AA1 4 ALA A 53 ? ASP A 55 ? ALA A 87 ASP A 89 AA2 1 SER A 38 ? VAL A 40 ? SER A 72 VAL A 74 AA2 2 GLY A 75 ? ARG A 81 ? GLY A 109 ARG A 115 AA2 3 ILE A 70 ? VAL A 72 ? ILE A 104 VAL A 106 AA3 1 SER A 38 ? VAL A 40 ? SER A 72 VAL A 74 AA3 2 GLY A 75 ? ARG A 81 ? GLY A 109 ARG A 115 AA3 3 MET A 95 ? PRO A 101 ? MET A 129 PRO A 135 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 16 ? N ILE A 50 O ARG A 23 ? O ARG A 57 AA1 2 3 N ILE A 24 ? N ILE A 58 O LEU A 61 ? O LEU A 95 AA1 3 4 O VAL A 60 ? O VAL A 94 N ASP A 55 ? N ASP A 89 AA2 1 2 N VAL A 40 ? N VAL A 74 O ASN A 79 ? O ASN A 113 AA2 2 3 O GLN A 77 ? O GLN A 111 N ILE A 70 ? N ILE A 104 AA3 1 2 N VAL A 40 ? N VAL A 74 O ASN A 79 ? O ASN A 113 AA3 2 3 N ILE A 80 ? N ILE A 114 O TYR A 96 ? O TYR A 130 # _pdbx_entry_details.entry_id 5II6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 141 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -113.65 _pdbx_validate_torsion.psi -75.63 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id HIS _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 144 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -11.50 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 340 ? 5.83 . 2 1 O ? A HOH 341 ? 5.97 . 3 1 O ? A HOH 342 ? 6.44 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 35 ? A VAL 1 2 1 Y 1 A SER 36 ? A SER 2 3 1 Y 1 A LEU 37 ? A LEU 3 4 1 Y 1 A PRO 38 ? A PRO 4 5 1 Y 1 A GLN 39 ? A GLN 5 6 1 Y 1 A SER 40 ? A SER 6 7 1 Y 1 A GLU 41 ? A GLU 7 8 1 Y 1 A ASP 118 ? A ASP 84 9 1 Y 1 A THR 119 ? A THR 85 10 1 Y 1 A THR 120 ? A THR 86 11 1 Y 1 A THR 121 ? A THR 87 12 1 Y 1 A ASP 122 ? A ASP 88 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Karolinska Institutet' Sweden ? 1 'Swedish Research Council' Sweden 2012-5093 2 'Goran Gustafsson Foundation for Research in Natural Sciences and Medicine' Sweden ? 3 'Sven and Ebba-Christina Hagberg foundation' Sweden ? 4 'European Molecular Biology Organization' ? ? 5 'European Union' ? 'ERC 260759' 6 # _atom_sites.entry_id 5II6 _atom_sites.fract_transf_matrix[1][1] 0.025291 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019995 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019323 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_