data_5IMX # _entry.id 5IMX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5IMX WWPDB D_1000219058 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IMX _pdbx_database_status.recvd_initial_deposition_date 2016-03-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, C.' 1 'Zhang, P.' 2 'Dong, J.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first 1910 _citation.page_last 1918 _citation.title 'Design and synthesis of novel 3-sulfonylpyrazol-4-amino pyrimidines as potent anaplastic lymphoma kinase (ALK) inhibitors.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2016.03.017 _citation.pdbx_database_id_PubMed 26979157 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, P.' 1 primary 'Dong, J.' 2 primary 'Zhong, B.' 3 primary 'Zhang, D.' 4 primary 'Yuan, H.' 5 primary 'Jin, C.' 6 primary 'Xu, X.' 7 primary 'Li, H.' 8 primary 'Zhou, Y.' 9 primary 'Liang, Z.' 10 primary 'Ji, M.' 11 primary 'Xu, T.' 12 primary 'Song, G.' 13 primary 'Zhang, L.' 14 primary 'Chen, G.' 15 primary 'Meng, X.' 16 primary 'Sun, D.' 17 primary 'Shih, J.' 18 primary 'Zhang, R.' 19 primary 'Hou, G.' 20 primary 'Wang, C.' 21 primary 'Jin, Y.' 22 primary 'Yang, Q.' 23 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5IMX _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.698 _cell.length_a_esd ? _cell.length_b 56.759 _cell.length_b_esd ? _cell.length_c 104.556 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IMX _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ALK tyrosine kinase receptor' 36909.355 1 2.7.10.1 ? 'UNP RESIDUES 1093-1411' ? 2 non-polymer syn ;5-chloro-N~2~-{5-methyl-4-(1-methylpiperidin-4-yl)-2-[(propan-2-yl)oxy]phenyl}-N~4~-{1-methyl-3-[(propan-2-yl)sulfonyl]-1H-pyrazol-4-yl}pyrimidine-2,4-diamine ; 576.154 1 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Anaplastic lymphoma kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDF LMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENH FIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFS LGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPL VEEEEKV ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDF LMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENH FIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFS LGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPL VEEEEKV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 ASN n 1 10 PRO n 1 11 ASN n 1 12 TYR n 1 13 CYS n 1 14 PHE n 1 15 ALA n 1 16 GLY n 1 17 LYS n 1 18 THR n 1 19 SER n 1 20 SER n 1 21 ILE n 1 22 SER n 1 23 ASP n 1 24 LEU n 1 25 LYS n 1 26 GLU n 1 27 VAL n 1 28 PRO n 1 29 ARG n 1 30 LYS n 1 31 ASN n 1 32 ILE n 1 33 THR n 1 34 LEU n 1 35 ILE n 1 36 ARG n 1 37 GLY n 1 38 LEU n 1 39 GLY n 1 40 HIS n 1 41 GLY n 1 42 ALA n 1 43 PHE n 1 44 GLY n 1 45 GLU n 1 46 VAL n 1 47 TYR n 1 48 GLU n 1 49 GLY n 1 50 GLN n 1 51 VAL n 1 52 SER n 1 53 GLY n 1 54 MET n 1 55 PRO n 1 56 ASN n 1 57 ASP n 1 58 PRO n 1 59 SER n 1 60 PRO n 1 61 LEU n 1 62 GLN n 1 63 VAL n 1 64 ALA n 1 65 VAL n 1 66 LYS n 1 67 THR n 1 68 LEU n 1 69 PRO n 1 70 GLU n 1 71 VAL n 1 72 CYS n 1 73 SER n 1 74 GLU n 1 75 GLN n 1 76 ASP n 1 77 GLU n 1 78 LEU n 1 79 ASP n 1 80 PHE n 1 81 LEU n 1 82 MET n 1 83 GLU n 1 84 ALA n 1 85 LEU n 1 86 ILE n 1 87 ILE n 1 88 SER n 1 89 LYS n 1 90 PHE n 1 91 ASN n 1 92 HIS n 1 93 GLN n 1 94 ASN n 1 95 ILE n 1 96 VAL n 1 97 ARG n 1 98 CYS n 1 99 ILE n 1 100 GLY n 1 101 VAL n 1 102 SER n 1 103 LEU n 1 104 GLN n 1 105 SER n 1 106 LEU n 1 107 PRO n 1 108 ARG n 1 109 PHE n 1 110 ILE n 1 111 LEU n 1 112 LEU n 1 113 GLU n 1 114 LEU n 1 115 MET n 1 116 ALA n 1 117 GLY n 1 118 GLY n 1 119 ASP n 1 120 LEU n 1 121 LYS n 1 122 SER n 1 123 PHE n 1 124 LEU n 1 125 ARG n 1 126 GLU n 1 127 THR n 1 128 ARG n 1 129 PRO n 1 130 ARG n 1 131 PRO n 1 132 SER n 1 133 GLN n 1 134 PRO n 1 135 SER n 1 136 SER n 1 137 LEU n 1 138 ALA n 1 139 MET n 1 140 LEU n 1 141 ASP n 1 142 LEU n 1 143 LEU n 1 144 HIS n 1 145 VAL n 1 146 ALA n 1 147 ARG n 1 148 ASP n 1 149 ILE n 1 150 ALA n 1 151 CYS n 1 152 GLY n 1 153 CYS n 1 154 GLN n 1 155 TYR n 1 156 LEU n 1 157 GLU n 1 158 GLU n 1 159 ASN n 1 160 HIS n 1 161 PHE n 1 162 ILE n 1 163 HIS n 1 164 ARG n 1 165 ASP n 1 166 ILE n 1 167 ALA n 1 168 ALA n 1 169 ARG n 1 170 ASN n 1 171 CYS n 1 172 LEU n 1 173 LEU n 1 174 THR n 1 175 CYS n 1 176 PRO n 1 177 GLY n 1 178 PRO n 1 179 GLY n 1 180 ARG n 1 181 VAL n 1 182 ALA n 1 183 LYS n 1 184 ILE n 1 185 GLY n 1 186 ASP n 1 187 PHE n 1 188 GLY n 1 189 MET n 1 190 ALA n 1 191 ARG n 1 192 ASP n 1 193 ILE n 1 194 TYR n 1 195 ARG n 1 196 ALA n 1 197 SER n 1 198 TYR n 1 199 TYR n 1 200 ARG n 1 201 LYS n 1 202 GLY n 1 203 GLY n 1 204 CYS n 1 205 ALA n 1 206 MET n 1 207 LEU n 1 208 PRO n 1 209 VAL n 1 210 LYS n 1 211 TRP n 1 212 MET n 1 213 PRO n 1 214 PRO n 1 215 GLU n 1 216 ALA n 1 217 PHE n 1 218 MET n 1 219 GLU n 1 220 GLY n 1 221 ILE n 1 222 PHE n 1 223 THR n 1 224 SER n 1 225 LYS n 1 226 THR n 1 227 ASP n 1 228 THR n 1 229 TRP n 1 230 SER n 1 231 PHE n 1 232 GLY n 1 233 VAL n 1 234 LEU n 1 235 LEU n 1 236 TRP n 1 237 GLU n 1 238 ILE n 1 239 PHE n 1 240 SER n 1 241 LEU n 1 242 GLY n 1 243 TYR n 1 244 MET n 1 245 PRO n 1 246 TYR n 1 247 PRO n 1 248 SER n 1 249 LYS n 1 250 SER n 1 251 ASN n 1 252 GLN n 1 253 GLU n 1 254 VAL n 1 255 LEU n 1 256 GLU n 1 257 PHE n 1 258 VAL n 1 259 THR n 1 260 SER n 1 261 GLY n 1 262 GLY n 1 263 ARG n 1 264 MET n 1 265 ASP n 1 266 PRO n 1 267 PRO n 1 268 LYS n 1 269 ASN n 1 270 CYS n 1 271 PRO n 1 272 GLY n 1 273 PRO n 1 274 VAL n 1 275 TYR n 1 276 ARG n 1 277 ILE n 1 278 MET n 1 279 THR n 1 280 GLN n 1 281 CYS n 1 282 TRP n 1 283 GLN n 1 284 HIS n 1 285 GLN n 1 286 PRO n 1 287 GLU n 1 288 ASP n 1 289 ARG n 1 290 PRO n 1 291 ASN n 1 292 PHE n 1 293 ALA n 1 294 ILE n 1 295 ILE n 1 296 LEU n 1 297 GLU n 1 298 ARG n 1 299 ILE n 1 300 GLU n 1 301 TYR n 1 302 CYS n 1 303 THR n 1 304 GLN n 1 305 ASP n 1 306 PRO n 1 307 ASP n 1 308 VAL n 1 309 ILE n 1 310 ASN n 1 311 THR n 1 312 ALA n 1 313 LEU n 1 314 PRO n 1 315 ILE n 1 316 GLU n 1 317 TYR n 1 318 GLY n 1 319 PRO n 1 320 LEU n 1 321 VAL n 1 322 GLU n 1 323 GLU n 1 324 GLU n 1 325 GLU n 1 326 LYS n 1 327 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 327 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ALK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ALK_HUMAN _struct_ref.pdbx_db_accession Q9UM73 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIIS KFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAA RNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPS KSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKV ; _struct_ref.pdbx_align_begin 1093 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IMX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 327 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UM73 _struct_ref_seq.db_align_beg 1093 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1411 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1093 _struct_ref_seq.pdbx_auth_seq_align_end 1411 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5IMX MET A 1 ? UNP Q9UM73 ? ? 'expression tag' 1085 1 1 5IMX ALA A 2 ? UNP Q9UM73 ? ? 'expression tag' 1086 2 1 5IMX HIS A 3 ? UNP Q9UM73 ? ? 'expression tag' 1087 3 1 5IMX HIS A 4 ? UNP Q9UM73 ? ? 'expression tag' 1088 4 1 5IMX HIS A 5 ? UNP Q9UM73 ? ? 'expression tag' 1089 5 1 5IMX HIS A 6 ? UNP Q9UM73 ? ? 'expression tag' 1090 6 1 5IMX HIS A 7 ? UNP Q9UM73 ? ? 'expression tag' 1091 7 1 5IMX HIS A 8 ? UNP Q9UM73 ? ? 'expression tag' 1092 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 CZ4 non-polymer . ;5-chloro-N~2~-{5-methyl-4-(1-methylpiperidin-4-yl)-2-[(propan-2-yl)oxy]phenyl}-N~4~-{1-methyl-3-[(propan-2-yl)sulfonyl]-1H-pyrazol-4-yl}pyrimidine-2,4-diamine ; ? 'C27 H38 Cl N7 O3 S' 576.154 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IMX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '18% PEG 3350, 0.1 M Tris-HCl, PH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-09-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5IMX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.12 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19144 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 88.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 34.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.12 _reflns_shell.d_res_low 2.15 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.515 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -17.2800 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -20.4300 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 37.7100 _refine.B_iso_max 134.880 _refine.B_iso_mean 48.5170 _refine.B_iso_min 23.090 _refine.correlation_coeff_Fo_to_Fc 0.9500 _refine.correlation_coeff_Fo_to_Fc_free 0.9170 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5IMX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1200 _refine.ls_d_res_low 46.3400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15084 _refine.ls_number_reflns_R_free 816 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 87.9200 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2130 _refine.ls_R_factor_R_free 0.2593 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2105 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0570 _refine.pdbx_overall_ESU_R_Free 0.0470 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.3030 _refine.overall_SU_ML 0.1430 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5IMX _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1200 _refine_hist.d_res_low 46.3400 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 2135 _refine_hist.pdbx_number_residues_total 266 _refine_hist.pdbx_B_iso_mean_ligand 49.11 _refine_hist.pdbx_B_iso_mean_solvent 41.24 _refine_hist.pdbx_number_atoms_protein 2066 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 0.019 2157 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2056 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.930 1.995 2933 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.921 3.000 4731 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.627 5.000 262 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.566 23.846 91 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.234 15.000 348 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.210 15.000 14 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.102 0.200 325 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.021 2401 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 480 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 4.085 4.781 1060 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.078 4.778 1059 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.918 7.132 1318 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1200 _refine_ls_shell.d_res_low 2.1750 _refine_ls_shell.number_reflns_all 1306 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 65 _refine_ls_shell.number_reflns_R_work 1241 _refine_ls_shell.percent_reflns_obs 99.3900 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2290 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2150 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5IMX _struct.title 'Anaplastic lymphoma kinase (ALK) catalytic domain complexed with novel inhibitor 3-sulfonylpyrazol-4-amino pyrimidine' _struct.pdbx_descriptor 'ALK tyrosine kinase receptor (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IMX _struct_keywords.text 'Kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 79 ? PHE A 90 ? ASP A 1163 PHE A 1174 1 ? 12 HELX_P HELX_P2 AA2 ASP A 119 ? THR A 127 ? ASP A 1203 THR A 1211 1 ? 9 HELX_P HELX_P3 AA3 ALA A 138 ? ASN A 159 ? ALA A 1222 ASN A 1243 1 ? 22 HELX_P HELX_P4 AA4 ALA A 167 ? ARG A 169 ? ALA A 1251 ARG A 1253 5 ? 3 HELX_P HELX_P5 AA5 PRO A 208 ? MET A 212 ? PRO A 1292 MET A 1296 5 ? 5 HELX_P HELX_P6 AA6 PRO A 213 ? GLY A 220 ? PRO A 1297 GLY A 1304 1 ? 8 HELX_P HELX_P7 AA7 THR A 223 ? SER A 240 ? THR A 1307 SER A 1324 1 ? 18 HELX_P HELX_P8 AA8 SER A 250 ? SER A 260 ? SER A 1334 SER A 1344 1 ? 11 HELX_P HELX_P9 AA9 PRO A 271 ? TRP A 282 ? PRO A 1355 TRP A 1366 1 ? 12 HELX_P HELX_P10 AB1 GLN A 285 ? ARG A 289 ? GLN A 1369 ARG A 1373 5 ? 5 HELX_P HELX_P11 AB2 ASN A 291 ? GLN A 304 ? ASN A 1375 GLN A 1388 1 ? 14 HELX_P HELX_P12 AB3 ASP A 305 ? ASN A 310 ? ASP A 1389 ASN A 1394 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 106 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 1190 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 107 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1191 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 11.39 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 33 ? HIS A 40 ? THR A 1117 HIS A 1124 AA1 2 GLU A 45 ? GLN A 50 ? GLU A 1129 GLN A 1134 AA1 3 VAL A 63 ? LEU A 68 ? VAL A 1147 LEU A 1152 AA1 4 ARG A 108 ? GLU A 113 ? ARG A 1192 GLU A 1197 AA1 5 CYS A 98 ? SER A 102 ? CYS A 1182 SER A 1186 AA2 1 CYS A 171 ? LEU A 173 ? CYS A 1255 LEU A 1257 AA2 2 ALA A 182 ? ILE A 184 ? ALA A 1266 ILE A 1268 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 38 ? N LEU A 1122 O VAL A 46 ? O VAL A 1130 AA1 2 3 N GLY A 49 ? N GLY A 1133 O VAL A 63 ? O VAL A 1147 AA1 3 4 N ALA A 64 ? N ALA A 1148 O LEU A 112 ? O LEU A 1196 AA1 4 5 O LEU A 111 ? O LEU A 1195 N GLY A 100 ? N GLY A 1184 AA2 1 2 N LEU A 172 ? N LEU A 1256 O LYS A 183 ? O LYS A 1267 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CZ4 _struct_site.pdbx_auth_seq_id 1501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue CZ4 A 1501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 LEU A 38 ? LEU A 1122 . ? 1_555 ? 2 AC1 12 GLY A 39 ? GLY A 1123 . ? 1_555 ? 3 AC1 12 GLY A 41 ? GLY A 1125 . ? 1_555 ? 4 AC1 12 ALA A 42 ? ALA A 1126 . ? 1_555 ? 5 AC1 12 ALA A 64 ? ALA A 1148 . ? 1_555 ? 6 AC1 12 LYS A 66 ? LYS A 1150 . ? 1_555 ? 7 AC1 12 LEU A 112 ? LEU A 1196 . ? 1_555 ? 8 AC1 12 GLU A 113 ? GLU A 1197 . ? 1_555 ? 9 AC1 12 MET A 115 ? MET A 1199 . ? 1_555 ? 10 AC1 12 ASP A 119 ? ASP A 1203 . ? 1_555 ? 11 AC1 12 LEU A 172 ? LEU A 1256 . ? 1_555 ? 12 AC1 12 ASP A 186 ? ASP A 1270 . ? 1_555 ? # _atom_sites.entry_id 5IMX _atom_sites.fract_transf_matrix[1][1] 0.019343 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017618 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009564 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1085 ? ? ? A . n A 1 2 ALA 2 1086 ? ? ? A . n A 1 3 HIS 3 1087 ? ? ? A . n A 1 4 HIS 4 1088 ? ? ? A . n A 1 5 HIS 5 1089 ? ? ? A . n A 1 6 HIS 6 1090 ? ? ? A . n A 1 7 HIS 7 1091 ? ? ? A . n A 1 8 HIS 8 1092 ? ? ? A . n A 1 9 ASN 9 1093 ? ? ? A . n A 1 10 PRO 10 1094 ? ? ? A . n A 1 11 ASN 11 1095 ? ? ? A . n A 1 12 TYR 12 1096 ? ? ? A . n A 1 13 CYS 13 1097 ? ? ? A . n A 1 14 PHE 14 1098 ? ? ? A . n A 1 15 ALA 15 1099 ? ? ? A . n A 1 16 GLY 16 1100 ? ? ? A . n A 1 17 LYS 17 1101 ? ? ? A . n A 1 18 THR 18 1102 ? ? ? A . n A 1 19 SER 19 1103 ? ? ? A . n A 1 20 SER 20 1104 ? ? ? A . n A 1 21 ILE 21 1105 ? ? ? A . n A 1 22 SER 22 1106 ? ? ? A . n A 1 23 ASP 23 1107 ? ? ? A . n A 1 24 LEU 24 1108 ? ? ? A . n A 1 25 LYS 25 1109 1109 LYS LYS A . n A 1 26 GLU 26 1110 1110 GLU GLU A . n A 1 27 VAL 27 1111 1111 VAL VAL A . n A 1 28 PRO 28 1112 1112 PRO PRO A . n A 1 29 ARG 29 1113 1113 ARG ARG A . n A 1 30 LYS 30 1114 1114 LYS LYS A . n A 1 31 ASN 31 1115 1115 ASN ASN A . n A 1 32 ILE 32 1116 1116 ILE ILE A . n A 1 33 THR 33 1117 1117 THR THR A . n A 1 34 LEU 34 1118 1118 LEU LEU A . n A 1 35 ILE 35 1119 1119 ILE ILE A . n A 1 36 ARG 36 1120 1120 ARG ARG A . n A 1 37 GLY 37 1121 1121 GLY GLY A . n A 1 38 LEU 38 1122 1122 LEU LEU A . n A 1 39 GLY 39 1123 1123 GLY GLY A . n A 1 40 HIS 40 1124 1124 HIS HIS A . n A 1 41 GLY 41 1125 1125 GLY GLY A . n A 1 42 ALA 42 1126 1126 ALA ALA A . n A 1 43 PHE 43 1127 1127 PHE PHE A . n A 1 44 GLY 44 1128 1128 GLY GLY A . n A 1 45 GLU 45 1129 1129 GLU GLU A . n A 1 46 VAL 46 1130 1130 VAL VAL A . n A 1 47 TYR 47 1131 1131 TYR TYR A . n A 1 48 GLU 48 1132 1132 GLU GLU A . n A 1 49 GLY 49 1133 1133 GLY GLY A . n A 1 50 GLN 50 1134 1134 GLN GLN A . n A 1 51 VAL 51 1135 1135 VAL VAL A . n A 1 52 SER 52 1136 1136 SER SER A . n A 1 53 GLY 53 1137 ? ? ? A . n A 1 54 MET 54 1138 ? ? ? A . n A 1 55 PRO 55 1139 ? ? ? A . n A 1 56 ASN 56 1140 ? ? ? A . n A 1 57 ASP 57 1141 ? ? ? A . n A 1 58 PRO 58 1142 ? ? ? A . n A 1 59 SER 59 1143 ? ? ? A . n A 1 60 PRO 60 1144 1144 PRO PRO A . n A 1 61 LEU 61 1145 1145 LEU LEU A . n A 1 62 GLN 62 1146 1146 GLN GLN A . n A 1 63 VAL 63 1147 1147 VAL VAL A . n A 1 64 ALA 64 1148 1148 ALA ALA A . n A 1 65 VAL 65 1149 1149 VAL VAL A . n A 1 66 LYS 66 1150 1150 LYS LYS A . n A 1 67 THR 67 1151 1151 THR THR A . n A 1 68 LEU 68 1152 1152 LEU LEU A . n A 1 69 PRO 69 1153 ? ? ? A . n A 1 70 GLU 70 1154 ? ? ? A . n A 1 71 VAL 71 1155 ? ? ? A . n A 1 72 CYS 72 1156 ? ? ? A . n A 1 73 SER 73 1157 ? ? ? A . n A 1 74 GLU 74 1158 ? ? ? A . n A 1 75 GLN 75 1159 ? ? ? A . n A 1 76 ASP 76 1160 ? ? ? A . n A 1 77 GLU 77 1161 ? ? ? A . n A 1 78 LEU 78 1162 1162 LEU LEU A . n A 1 79 ASP 79 1163 1163 ASP ASP A . n A 1 80 PHE 80 1164 1164 PHE PHE A . n A 1 81 LEU 81 1165 1165 LEU LEU A . n A 1 82 MET 82 1166 1166 MET MET A . n A 1 83 GLU 83 1167 1167 GLU GLU A . n A 1 84 ALA 84 1168 1168 ALA ALA A . n A 1 85 LEU 85 1169 1169 LEU LEU A . n A 1 86 ILE 86 1170 1170 ILE ILE A . n A 1 87 ILE 87 1171 1171 ILE ILE A . n A 1 88 SER 88 1172 1172 SER SER A . n A 1 89 LYS 89 1173 1173 LYS LYS A . n A 1 90 PHE 90 1174 1174 PHE PHE A . n A 1 91 ASN 91 1175 1175 ASN ASN A . n A 1 92 HIS 92 1176 1176 HIS HIS A . n A 1 93 GLN 93 1177 1177 GLN GLN A . n A 1 94 ASN 94 1178 1178 ASN ASN A . n A 1 95 ILE 95 1179 1179 ILE ILE A . n A 1 96 VAL 96 1180 1180 VAL VAL A . n A 1 97 ARG 97 1181 1181 ARG ARG A . n A 1 98 CYS 98 1182 1182 CYS CYS A . n A 1 99 ILE 99 1183 1183 ILE ILE A . n A 1 100 GLY 100 1184 1184 GLY GLY A . n A 1 101 VAL 101 1185 1185 VAL VAL A . n A 1 102 SER 102 1186 1186 SER SER A . n A 1 103 LEU 103 1187 1187 LEU LEU A . n A 1 104 GLN 104 1188 1188 GLN GLN A . n A 1 105 SER 105 1189 1189 SER SER A . n A 1 106 LEU 106 1190 1190 LEU LEU A . n A 1 107 PRO 107 1191 1191 PRO PRO A . n A 1 108 ARG 108 1192 1192 ARG ARG A . n A 1 109 PHE 109 1193 1193 PHE PHE A . n A 1 110 ILE 110 1194 1194 ILE ILE A . n A 1 111 LEU 111 1195 1195 LEU LEU A . n A 1 112 LEU 112 1196 1196 LEU LEU A . n A 1 113 GLU 113 1197 1197 GLU GLU A . n A 1 114 LEU 114 1198 1198 LEU LEU A . n A 1 115 MET 115 1199 1199 MET MET A . n A 1 116 ALA 116 1200 1200 ALA ALA A . n A 1 117 GLY 117 1201 1201 GLY GLY A . n A 1 118 GLY 118 1202 1202 GLY GLY A . n A 1 119 ASP 119 1203 1203 ASP ASP A . n A 1 120 LEU 120 1204 1204 LEU LEU A . n A 1 121 LYS 121 1205 1205 LYS LYS A . n A 1 122 SER 122 1206 1206 SER SER A . n A 1 123 PHE 123 1207 1207 PHE PHE A . n A 1 124 LEU 124 1208 1208 LEU LEU A . n A 1 125 ARG 125 1209 1209 ARG ARG A . n A 1 126 GLU 126 1210 1210 GLU GLU A . n A 1 127 THR 127 1211 1211 THR THR A . n A 1 128 ARG 128 1212 1212 ARG ARG A . n A 1 129 PRO 129 1213 1213 PRO PRO A . n A 1 130 ARG 130 1214 1214 ARG ARG A . n A 1 131 PRO 131 1215 1215 PRO PRO A . n A 1 132 SER 132 1216 1216 SER SER A . n A 1 133 GLN 133 1217 1217 GLN GLN A . n A 1 134 PRO 134 1218 1218 PRO PRO A . n A 1 135 SER 135 1219 1219 SER SER A . n A 1 136 SER 136 1220 1220 SER SER A . n A 1 137 LEU 137 1221 1221 LEU LEU A . n A 1 138 ALA 138 1222 1222 ALA ALA A . n A 1 139 MET 139 1223 1223 MET MET A . n A 1 140 LEU 140 1224 1224 LEU LEU A . n A 1 141 ASP 141 1225 1225 ASP ASP A . n A 1 142 LEU 142 1226 1226 LEU LEU A . n A 1 143 LEU 143 1227 1227 LEU LEU A . n A 1 144 HIS 144 1228 1228 HIS HIS A . n A 1 145 VAL 145 1229 1229 VAL VAL A . n A 1 146 ALA 146 1230 1230 ALA ALA A . n A 1 147 ARG 147 1231 1231 ARG ARG A . n A 1 148 ASP 148 1232 1232 ASP ASP A . n A 1 149 ILE 149 1233 1233 ILE ILE A . n A 1 150 ALA 150 1234 1234 ALA ALA A . n A 1 151 CYS 151 1235 1235 CYS CYS A . n A 1 152 GLY 152 1236 1236 GLY GLY A . n A 1 153 CYS 153 1237 1237 CYS CYS A . n A 1 154 GLN 154 1238 1238 GLN GLN A . n A 1 155 TYR 155 1239 1239 TYR TYR A . n A 1 156 LEU 156 1240 1240 LEU LEU A . n A 1 157 GLU 157 1241 1241 GLU GLU A . n A 1 158 GLU 158 1242 1242 GLU GLU A . n A 1 159 ASN 159 1243 1243 ASN ASN A . n A 1 160 HIS 160 1244 1244 HIS HIS A . n A 1 161 PHE 161 1245 1245 PHE PHE A . n A 1 162 ILE 162 1246 1246 ILE ILE A . n A 1 163 HIS 163 1247 1247 HIS HIS A . n A 1 164 ARG 164 1248 1248 ARG ARG A . n A 1 165 ASP 165 1249 1249 ASP ASP A . n A 1 166 ILE 166 1250 1250 ILE ILE A . n A 1 167 ALA 167 1251 1251 ALA ALA A . n A 1 168 ALA 168 1252 1252 ALA ALA A . n A 1 169 ARG 169 1253 1253 ARG ARG A . n A 1 170 ASN 170 1254 1254 ASN ASN A . n A 1 171 CYS 171 1255 1255 CYS CYS A . n A 1 172 LEU 172 1256 1256 LEU LEU A . n A 1 173 LEU 173 1257 1257 LEU LEU A . n A 1 174 THR 174 1258 1258 THR THR A . n A 1 175 CYS 175 1259 1259 CYS CYS A . n A 1 176 PRO 176 1260 1260 PRO PRO A . n A 1 177 GLY 177 1261 1261 GLY GLY A . n A 1 178 PRO 178 1262 1262 PRO PRO A . n A 1 179 GLY 179 1263 1263 GLY GLY A . n A 1 180 ARG 180 1264 1264 ARG ARG A . n A 1 181 VAL 181 1265 1265 VAL VAL A . n A 1 182 ALA 182 1266 1266 ALA ALA A . n A 1 183 LYS 183 1267 1267 LYS LYS A . n A 1 184 ILE 184 1268 1268 ILE ILE A . n A 1 185 GLY 185 1269 1269 GLY GLY A . n A 1 186 ASP 186 1270 1270 ASP ASP A . n A 1 187 PHE 187 1271 1271 PHE PHE A . n A 1 188 GLY 188 1272 1272 GLY GLY A . n A 1 189 MET 189 1273 1273 MET MET A . n A 1 190 ALA 190 1274 1274 ALA ALA A . n A 1 191 ARG 191 1275 1275 ARG ARG A . n A 1 192 ASP 192 1276 1276 ASP ASP A . n A 1 193 ILE 193 1277 1277 ILE ALA A . n A 1 194 TYR 194 1278 ? ? ? A . n A 1 195 ARG 195 1279 ? ? ? A . n A 1 196 ALA 196 1280 ? ? ? A . n A 1 197 SER 197 1281 ? ? ? A . n A 1 198 TYR 198 1282 ? ? ? A . n A 1 199 TYR 199 1283 ? ? ? A . n A 1 200 ARG 200 1284 ? ? ? A . n A 1 201 LYS 201 1285 ? ? ? A . n A 1 202 GLY 202 1286 ? ? ? A . n A 1 203 GLY 203 1287 ? ? ? A . n A 1 204 CYS 204 1288 1288 CYS ALA A . n A 1 205 ALA 205 1289 1289 ALA ALA A . n A 1 206 MET 206 1290 1290 MET MET A . n A 1 207 LEU 207 1291 1291 LEU LEU A . n A 1 208 PRO 208 1292 1292 PRO PRO A . n A 1 209 VAL 209 1293 1293 VAL VAL A . n A 1 210 LYS 210 1294 1294 LYS LYS A . n A 1 211 TRP 211 1295 1295 TRP TRP A . n A 1 212 MET 212 1296 1296 MET MET A . n A 1 213 PRO 213 1297 1297 PRO PRO A . n A 1 214 PRO 214 1298 1298 PRO PRO A . n A 1 215 GLU 215 1299 1299 GLU GLU A . n A 1 216 ALA 216 1300 1300 ALA ALA A . n A 1 217 PHE 217 1301 1301 PHE PHE A . n A 1 218 MET 218 1302 1302 MET MET A . n A 1 219 GLU 219 1303 1303 GLU GLU A . n A 1 220 GLY 220 1304 1304 GLY GLY A . n A 1 221 ILE 221 1305 1305 ILE ILE A . n A 1 222 PHE 222 1306 1306 PHE PHE A . n A 1 223 THR 223 1307 1307 THR THR A . n A 1 224 SER 224 1308 1308 SER SER A . n A 1 225 LYS 225 1309 1309 LYS LYS A . n A 1 226 THR 226 1310 1310 THR THR A . n A 1 227 ASP 227 1311 1311 ASP ASP A . n A 1 228 THR 228 1312 1312 THR THR A . n A 1 229 TRP 229 1313 1313 TRP TRP A . n A 1 230 SER 230 1314 1314 SER SER A . n A 1 231 PHE 231 1315 1315 PHE PHE A . n A 1 232 GLY 232 1316 1316 GLY GLY A . n A 1 233 VAL 233 1317 1317 VAL VAL A . n A 1 234 LEU 234 1318 1318 LEU LEU A . n A 1 235 LEU 235 1319 1319 LEU LEU A . n A 1 236 TRP 236 1320 1320 TRP TRP A . n A 1 237 GLU 237 1321 1321 GLU GLU A . n A 1 238 ILE 238 1322 1322 ILE ILE A . n A 1 239 PHE 239 1323 1323 PHE PHE A . n A 1 240 SER 240 1324 1324 SER SER A . n A 1 241 LEU 241 1325 1325 LEU LEU A . n A 1 242 GLY 242 1326 1326 GLY GLY A . n A 1 243 TYR 243 1327 1327 TYR TYR A . n A 1 244 MET 244 1328 1328 MET MET A . n A 1 245 PRO 245 1329 1329 PRO PRO A . n A 1 246 TYR 246 1330 1330 TYR TYR A . n A 1 247 PRO 247 1331 1331 PRO PRO A . n A 1 248 SER 248 1332 1332 SER SER A . n A 1 249 LYS 249 1333 1333 LYS LYS A . n A 1 250 SER 250 1334 1334 SER SER A . n A 1 251 ASN 251 1335 1335 ASN ASN A . n A 1 252 GLN 252 1336 1336 GLN GLN A . n A 1 253 GLU 253 1337 1337 GLU GLU A . n A 1 254 VAL 254 1338 1338 VAL VAL A . n A 1 255 LEU 255 1339 1339 LEU LEU A . n A 1 256 GLU 256 1340 1340 GLU GLU A . n A 1 257 PHE 257 1341 1341 PHE PHE A . n A 1 258 VAL 258 1342 1342 VAL VAL A . n A 1 259 THR 259 1343 1343 THR THR A . n A 1 260 SER 260 1344 1344 SER SER A . n A 1 261 GLY 261 1345 1345 GLY GLY A . n A 1 262 GLY 262 1346 1346 GLY GLY A . n A 1 263 ARG 263 1347 1347 ARG ARG A . n A 1 264 MET 264 1348 1348 MET MET A . n A 1 265 ASP 265 1349 1349 ASP ASP A . n A 1 266 PRO 266 1350 1350 PRO PRO A . n A 1 267 PRO 267 1351 1351 PRO PRO A . n A 1 268 LYS 268 1352 1352 LYS LYS A . n A 1 269 ASN 269 1353 1353 ASN ASN A . n A 1 270 CYS 270 1354 1354 CYS CYS A . n A 1 271 PRO 271 1355 1355 PRO PRO A . n A 1 272 GLY 272 1356 1356 GLY GLY A . n A 1 273 PRO 273 1357 1357 PRO PRO A . n A 1 274 VAL 274 1358 1358 VAL VAL A . n A 1 275 TYR 275 1359 1359 TYR TYR A . n A 1 276 ARG 276 1360 1360 ARG ARG A . n A 1 277 ILE 277 1361 1361 ILE ILE A . n A 1 278 MET 278 1362 1362 MET MET A . n A 1 279 THR 279 1363 1363 THR THR A . n A 1 280 GLN 280 1364 1364 GLN GLN A . n A 1 281 CYS 281 1365 1365 CYS CYS A . n A 1 282 TRP 282 1366 1366 TRP TRP A . n A 1 283 GLN 283 1367 1367 GLN GLN A . n A 1 284 HIS 284 1368 1368 HIS HIS A . n A 1 285 GLN 285 1369 1369 GLN GLN A . n A 1 286 PRO 286 1370 1370 PRO PRO A . n A 1 287 GLU 287 1371 1371 GLU GLU A . n A 1 288 ASP 288 1372 1372 ASP ASP A . n A 1 289 ARG 289 1373 1373 ARG ARG A . n A 1 290 PRO 290 1374 1374 PRO PRO A . n A 1 291 ASN 291 1375 1375 ASN ASN A . n A 1 292 PHE 292 1376 1376 PHE PHE A . n A 1 293 ALA 293 1377 1377 ALA ALA A . n A 1 294 ILE 294 1378 1378 ILE ILE A . n A 1 295 ILE 295 1379 1379 ILE ILE A . n A 1 296 LEU 296 1380 1380 LEU LEU A . n A 1 297 GLU 297 1381 1381 GLU GLU A . n A 1 298 ARG 298 1382 1382 ARG ARG A . n A 1 299 ILE 299 1383 1383 ILE ILE A . n A 1 300 GLU 300 1384 1384 GLU GLU A . n A 1 301 TYR 301 1385 1385 TYR TYR A . n A 1 302 CYS 302 1386 1386 CYS CYS A . n A 1 303 THR 303 1387 1387 THR THR A . n A 1 304 GLN 304 1388 1388 GLN GLN A . n A 1 305 ASP 305 1389 1389 ASP ASP A . n A 1 306 PRO 306 1390 1390 PRO PRO A . n A 1 307 ASP 307 1391 1391 ASP ASP A . n A 1 308 VAL 308 1392 1392 VAL VAL A . n A 1 309 ILE 309 1393 1393 ILE ILE A . n A 1 310 ASN 310 1394 1394 ASN ASN A . n A 1 311 THR 311 1395 1395 THR THR A . n A 1 312 ALA 312 1396 1396 ALA ALA A . n A 1 313 LEU 313 1397 1397 LEU LEU A . n A 1 314 PRO 314 1398 1398 PRO PRO A . n A 1 315 ILE 315 1399 1399 ILE ILE A . n A 1 316 GLU 316 1400 1400 GLU GLU A . n A 1 317 TYR 317 1401 ? ? ? A . n A 1 318 GLY 318 1402 ? ? ? A . n A 1 319 PRO 319 1403 ? ? ? A . n A 1 320 LEU 320 1404 ? ? ? A . n A 1 321 VAL 321 1405 ? ? ? A . n A 1 322 GLU 322 1406 ? ? ? A . n A 1 323 GLU 323 1407 ? ? ? A . n A 1 324 GLU 324 1408 ? ? ? A . n A 1 325 GLU 325 1409 ? ? ? A . n A 1 326 LYS 326 1410 ? ? ? A . n A 1 327 VAL 327 1411 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CZ4 1 1501 1 CZ4 C04 A . C 3 HOH 1 1601 13 HOH HOH A . C 3 HOH 2 1602 20 HOH HOH A . C 3 HOH 3 1603 3 HOH HOH A . C 3 HOH 4 1604 18 HOH HOH A . C 3 HOH 5 1605 23 HOH HOH A . C 3 HOH 6 1606 26 HOH HOH A . C 3 HOH 7 1607 14 HOH HOH A . C 3 HOH 8 1608 6 HOH HOH A . C 3 HOH 9 1609 16 HOH HOH A . C 3 HOH 10 1610 8 HOH HOH A . C 3 HOH 11 1611 24 HOH HOH A . C 3 HOH 12 1612 27 HOH HOH A . C 3 HOH 13 1613 15 HOH HOH A . C 3 HOH 14 1614 19 HOH HOH A . C 3 HOH 15 1615 17 HOH HOH A . C 3 HOH 16 1616 25 HOH HOH A . C 3 HOH 17 1617 7 HOH HOH A . C 3 HOH 18 1618 22 HOH HOH A . C 3 HOH 19 1619 12 HOH HOH A . C 3 HOH 20 1620 4 HOH HOH A . C 3 HOH 21 1621 10 HOH HOH A . C 3 HOH 22 1622 2 HOH HOH A . C 3 HOH 23 1623 1 HOH HOH A . C 3 HOH 24 1624 21 HOH HOH A . C 3 HOH 25 1625 11 HOH HOH A . C 3 HOH 26 1626 5 HOH HOH A . C 3 HOH 27 1627 9 HOH HOH A . C 3 HOH 28 1628 28 HOH HOH A . C 3 HOH 29 1629 30 HOH HOH A . C 3 HOH 30 1630 29 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12370 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-05-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 1181 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 1181 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 1181 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.46 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.84 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 1113 ? ? 123.20 -24.68 2 1 ILE A 1119 ? ? -130.13 -43.94 3 1 ASP A 1163 ? ? 17.55 -64.42 4 1 ALA A 1168 ? ? -56.22 -75.04 5 1 GLU A 1197 ? ? -39.93 125.13 6 1 SER A 1216 ? ? -50.42 -176.32 7 1 GLN A 1217 ? ? -31.95 112.98 8 1 ARG A 1248 ? ? 80.57 -2.35 9 1 ASP A 1249 ? ? -152.40 45.10 10 1 ASP A 1276 ? ? -87.64 -126.17 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PRO _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 1218 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 1219 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -145.41 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 1114 ? CG ? A LYS 30 CG 2 1 Y 1 A LYS 1114 ? CD ? A LYS 30 CD 3 1 Y 1 A LYS 1114 ? CE ? A LYS 30 CE 4 1 Y 1 A LYS 1114 ? NZ ? A LYS 30 NZ 5 1 Y 1 A ARG 1120 ? CG ? A ARG 36 CG 6 1 Y 1 A ARG 1120 ? CD ? A ARG 36 CD 7 1 Y 1 A ARG 1120 ? NE ? A ARG 36 NE 8 1 Y 1 A ARG 1120 ? CZ ? A ARG 36 CZ 9 1 Y 1 A ARG 1120 ? NH1 ? A ARG 36 NH1 10 1 Y 1 A ARG 1120 ? NH2 ? A ARG 36 NH2 11 1 Y 1 A PHE 1164 ? CG ? A PHE 80 CG 12 1 Y 1 A PHE 1164 ? CD1 ? A PHE 80 CD1 13 1 Y 1 A PHE 1164 ? CD2 ? A PHE 80 CD2 14 1 Y 1 A PHE 1164 ? CE1 ? A PHE 80 CE1 15 1 Y 1 A PHE 1164 ? CE2 ? A PHE 80 CE2 16 1 Y 1 A PHE 1164 ? CZ ? A PHE 80 CZ 17 1 Y 1 A MET 1166 ? CG ? A MET 82 CG 18 1 Y 1 A MET 1166 ? SD ? A MET 82 SD 19 1 Y 1 A MET 1166 ? CE ? A MET 82 CE 20 1 Y 1 A LYS 1173 ? CG ? A LYS 89 CG 21 1 Y 1 A LYS 1173 ? CD ? A LYS 89 CD 22 1 Y 1 A LYS 1173 ? CE ? A LYS 89 CE 23 1 Y 1 A LYS 1173 ? NZ ? A LYS 89 NZ 24 1 Y 1 A ARG 1275 ? CG ? A ARG 191 CG 25 1 Y 1 A ARG 1275 ? CD ? A ARG 191 CD 26 1 Y 1 A ARG 1275 ? NE ? A ARG 191 NE 27 1 Y 1 A ARG 1275 ? CZ ? A ARG 191 CZ 28 1 Y 1 A ARG 1275 ? NH1 ? A ARG 191 NH1 29 1 Y 1 A ARG 1275 ? NH2 ? A ARG 191 NH2 30 1 Y 1 A ILE 1277 ? CG1 ? A ILE 193 CG1 31 1 Y 1 A ILE 1277 ? CG2 ? A ILE 193 CG2 32 1 Y 1 A ILE 1277 ? CD1 ? A ILE 193 CD1 33 1 Y 1 A CYS 1288 ? SG ? A CYS 204 SG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1085 ? A MET 1 2 1 Y 1 A ALA 1086 ? A ALA 2 3 1 Y 1 A HIS 1087 ? A HIS 3 4 1 Y 1 A HIS 1088 ? A HIS 4 5 1 Y 1 A HIS 1089 ? A HIS 5 6 1 Y 1 A HIS 1090 ? A HIS 6 7 1 Y 1 A HIS 1091 ? A HIS 7 8 1 Y 1 A HIS 1092 ? A HIS 8 9 1 Y 1 A ASN 1093 ? A ASN 9 10 1 Y 1 A PRO 1094 ? A PRO 10 11 1 Y 1 A ASN 1095 ? A ASN 11 12 1 Y 1 A TYR 1096 ? A TYR 12 13 1 Y 1 A CYS 1097 ? A CYS 13 14 1 Y 1 A PHE 1098 ? A PHE 14 15 1 Y 1 A ALA 1099 ? A ALA 15 16 1 Y 1 A GLY 1100 ? A GLY 16 17 1 Y 1 A LYS 1101 ? A LYS 17 18 1 Y 1 A THR 1102 ? A THR 18 19 1 Y 1 A SER 1103 ? A SER 19 20 1 Y 1 A SER 1104 ? A SER 20 21 1 Y 1 A ILE 1105 ? A ILE 21 22 1 Y 1 A SER 1106 ? A SER 22 23 1 Y 1 A ASP 1107 ? A ASP 23 24 1 Y 1 A LEU 1108 ? A LEU 24 25 1 Y 1 A GLY 1137 ? A GLY 53 26 1 Y 1 A MET 1138 ? A MET 54 27 1 Y 1 A PRO 1139 ? A PRO 55 28 1 Y 1 A ASN 1140 ? A ASN 56 29 1 Y 1 A ASP 1141 ? A ASP 57 30 1 Y 1 A PRO 1142 ? A PRO 58 31 1 Y 1 A SER 1143 ? A SER 59 32 1 Y 1 A PRO 1153 ? A PRO 69 33 1 Y 1 A GLU 1154 ? A GLU 70 34 1 Y 1 A VAL 1155 ? A VAL 71 35 1 Y 1 A CYS 1156 ? A CYS 72 36 1 Y 1 A SER 1157 ? A SER 73 37 1 Y 1 A GLU 1158 ? A GLU 74 38 1 Y 1 A GLN 1159 ? A GLN 75 39 1 Y 1 A ASP 1160 ? A ASP 76 40 1 Y 1 A GLU 1161 ? A GLU 77 41 1 Y 1 A TYR 1278 ? A TYR 194 42 1 Y 1 A ARG 1279 ? A ARG 195 43 1 Y 1 A ALA 1280 ? A ALA 196 44 1 Y 1 A SER 1281 ? A SER 197 45 1 Y 1 A TYR 1282 ? A TYR 198 46 1 Y 1 A TYR 1283 ? A TYR 199 47 1 Y 1 A ARG 1284 ? A ARG 200 48 1 Y 1 A LYS 1285 ? A LYS 201 49 1 Y 1 A GLY 1286 ? A GLY 202 50 1 Y 1 A GLY 1287 ? A GLY 203 51 1 Y 1 A TYR 1401 ? A TYR 317 52 1 Y 1 A GLY 1402 ? A GLY 318 53 1 Y 1 A PRO 1403 ? A PRO 319 54 1 Y 1 A LEU 1404 ? A LEU 320 55 1 Y 1 A VAL 1405 ? A VAL 321 56 1 Y 1 A GLU 1406 ? A GLU 322 57 1 Y 1 A GLU 1407 ? A GLU 323 58 1 Y 1 A GLU 1408 ? A GLU 324 59 1 Y 1 A GLU 1409 ? A GLU 325 60 1 Y 1 A LYS 1410 ? A LYS 326 61 1 Y 1 A VAL 1411 ? A VAL 327 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;5-chloro-N~2~-{5-methyl-4-(1-methylpiperidin-4-yl)-2-[(propan-2-yl)oxy]phenyl}-N~4~-{1-methyl-3-[(propan-2-yl)sulfonyl]-1H-pyrazol-4-yl}pyrimidine-2,4-diamine ; CZ4 3 water HOH #