data_5IRS # _entry.id 5IRS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IRS pdb_00005irs 10.2210/pdb5irs/pdb WWPDB D_1000219325 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-20 2 'Structure model' 1 1 2016-08-03 3 'Structure model' 1 2 2016-08-17 4 'Structure model' 1 3 2023-09-27 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' citation 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_struct_oper_list 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature 9 5 'Structure model' struct_conn 10 5 'Structure model' struct_conn_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 5 'Structure model' '_struct_conn.conn_type_id' 6 5 'Structure model' '_struct_conn.id' 7 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 8 5 'Structure model' '_struct_conn_type.id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IRS _pdbx_database_status.recvd_initial_deposition_date 2016-03-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, X.' 1 'Shi, K.' 2 'Walters, K.' 3 'Aihara, H.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 24 _citation.language ? _citation.page_first 1257 _citation.page_last 1270 _citation.title ;Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2016.05.018 _citation.pdbx_database_id_PubMed 27396824 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, X.' 1 ? primary 'Randles, L.' 2 ? primary 'Shi, K.' 3 ? primary 'Tarasov, S.G.' 4 ? primary 'Aihara, H.' 5 ? primary 'Walters, K.J.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proteasomal ubiquitin receptor ADRM1' 16610.850 1 ? ? ? ? 2 non-polymer syn 2,3-DIHYDROXY-1,4-DITHIOBUTANE 154.251 2 ? ? ? ? 3 water nat water 18.015 67 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;110 kDa cell membrane glycoprotein,Gp110,Adhesion-regulating molecule 1,ARM-1,Proteasome regulatory particle non-ATPase 13,hRpn13,Rpn13 homolog ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCE FKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSAL ; _entity_poly.pdbx_seq_one_letter_code_can ;TTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCE FKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSAL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2,3-DIHYDROXY-1,4-DITHIOBUTANE DTT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 SER n 1 4 GLY n 1 5 ALA n 1 6 LEU n 1 7 PHE n 1 8 PRO n 1 9 SER n 1 10 LEU n 1 11 VAL n 1 12 PRO n 1 13 GLY n 1 14 SER n 1 15 ARG n 1 16 GLY n 1 17 ALA n 1 18 SER n 1 19 ASN n 1 20 LYS n 1 21 TYR n 1 22 LEU n 1 23 VAL n 1 24 GLU n 1 25 PHE n 1 26 ARG n 1 27 ALA n 1 28 GLY n 1 29 LYS n 1 30 MET n 1 31 SER n 1 32 LEU n 1 33 LYS n 1 34 GLY n 1 35 THR n 1 36 THR n 1 37 VAL n 1 38 THR n 1 39 PRO n 1 40 ASP n 1 41 LYS n 1 42 ARG n 1 43 LYS n 1 44 GLY n 1 45 LEU n 1 46 VAL n 1 47 TYR n 1 48 ILE n 1 49 GLN n 1 50 GLN n 1 51 THR n 1 52 ASP n 1 53 ASP n 1 54 SER n 1 55 LEU n 1 56 ILE n 1 57 HIS n 1 58 PHE n 1 59 CYS n 1 60 TRP n 1 61 LYS n 1 62 ASP n 1 63 ARG n 1 64 THR n 1 65 SER n 1 66 GLY n 1 67 ASN n 1 68 VAL n 1 69 GLU n 1 70 ASP n 1 71 ASP n 1 72 LEU n 1 73 ILE n 1 74 ILE n 1 75 PHE n 1 76 PRO n 1 77 ASP n 1 78 ASP n 1 79 CYS n 1 80 GLU n 1 81 PHE n 1 82 LYS n 1 83 ARG n 1 84 VAL n 1 85 PRO n 1 86 GLN n 1 87 CYS n 1 88 PRO n 1 89 SER n 1 90 GLY n 1 91 ARG n 1 92 VAL n 1 93 TYR n 1 94 VAL n 1 95 LEU n 1 96 LYS n 1 97 PHE n 1 98 LYS n 1 99 ALA n 1 100 GLY n 1 101 SER n 1 102 LYS n 1 103 ARG n 1 104 LEU n 1 105 PHE n 1 106 PHE n 1 107 TRP n 1 108 MET n 1 109 GLN n 1 110 GLU n 1 111 PRO n 1 112 LYS n 1 113 THR n 1 114 ASP n 1 115 GLN n 1 116 ASP n 1 117 GLU n 1 118 GLU n 1 119 HIS n 1 120 CYS n 1 121 ARG n 1 122 LYS n 1 123 VAL n 1 124 ASN n 1 125 GLU n 1 126 TYR n 1 127 LEU n 1 128 ASN n 1 129 ASN n 1 130 PRO n 1 131 PRO n 1 132 MET n 1 133 PRO n 1 134 GLY n 1 135 ALA n 1 136 LEU n 1 137 GLY n 1 138 ALA n 1 139 SER n 1 140 GLY n 1 141 SER n 1 142 SER n 1 143 GLY n 1 144 HIS n 1 145 GLU n 1 146 LEU n 1 147 SER n 1 148 ALA n 1 149 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 149 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ADRM1, GP110' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DTT non-polymer . 2,3-DIHYDROXY-1,4-DITHIOBUTANE 1,4-DITHIOTHREITOL 'C4 H10 O2 S2' 154.251 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 2 ? ? ? A . n A 1 2 THR 2 3 ? ? ? A . n A 1 3 SER 3 4 ? ? ? A . n A 1 4 GLY 4 5 ? ? ? A . n A 1 5 ALA 5 6 ? ? ? A . n A 1 6 LEU 6 7 ? ? ? A . n A 1 7 PHE 7 8 ? ? ? A . n A 1 8 PRO 8 9 ? ? ? A . n A 1 9 SER 9 10 ? ? ? A . n A 1 10 LEU 10 11 ? ? ? A . n A 1 11 VAL 11 12 ? ? ? A . n A 1 12 PRO 12 13 ? ? ? A . n A 1 13 GLY 13 14 ? ? ? A . n A 1 14 SER 14 15 ? ? ? A . n A 1 15 ARG 15 16 ? ? ? A . n A 1 16 GLY 16 17 ? ? ? A . n A 1 17 ALA 17 18 ? ? ? A . n A 1 18 SER 18 19 ? ? ? A . n A 1 19 ASN 19 20 ? ? ? A . n A 1 20 LYS 20 21 21 LYS LYS A . n A 1 21 TYR 21 22 22 TYR TYR A . n A 1 22 LEU 22 23 23 LEU LEU A . n A 1 23 VAL 23 24 24 VAL VAL A . n A 1 24 GLU 24 25 25 GLU GLU A . n A 1 25 PHE 25 26 26 PHE PHE A . n A 1 26 ARG 26 27 27 ARG ARG A . n A 1 27 ALA 27 28 28 ALA ALA A . n A 1 28 GLY 28 29 29 GLY GLY A . n A 1 29 LYS 29 30 30 LYS LYS A . n A 1 30 MET 30 31 31 MET MET A . n A 1 31 SER 31 32 32 SER SER A . n A 1 32 LEU 32 33 33 LEU LEU A . n A 1 33 LYS 33 34 34 LYS LYS A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 THR 35 36 36 THR THR A . n A 1 36 THR 36 37 37 THR THR A . n A 1 37 VAL 37 38 38 VAL VAL A . n A 1 38 THR 38 39 39 THR THR A . n A 1 39 PRO 39 40 40 PRO PRO A . n A 1 40 ASP 40 41 41 ASP ASP A . n A 1 41 LYS 41 42 42 LYS LYS A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 LYS 43 44 44 LYS LYS A . n A 1 44 GLY 44 45 45 GLY GLY A . n A 1 45 LEU 45 46 46 LEU LEU A . n A 1 46 VAL 46 47 47 VAL VAL A . n A 1 47 TYR 47 48 48 TYR TYR A . n A 1 48 ILE 48 49 49 ILE ILE A . n A 1 49 GLN 49 50 50 GLN GLN A . n A 1 50 GLN 50 51 51 GLN GLN A . n A 1 51 THR 51 52 52 THR THR A . n A 1 52 ASP 52 53 53 ASP ASP A . n A 1 53 ASP 53 54 54 ASP ASP A . n A 1 54 SER 54 55 55 SER SER A . n A 1 55 LEU 55 56 56 LEU LEU A . n A 1 56 ILE 56 57 57 ILE ILE A . n A 1 57 HIS 57 58 58 HIS HIS A . n A 1 58 PHE 58 59 59 PHE PHE A . n A 1 59 CYS 59 60 60 CYS CYS A . n A 1 60 TRP 60 61 61 TRP TRP A . n A 1 61 LYS 61 62 62 LYS LYS A . n A 1 62 ASP 62 63 63 ASP ASP A . n A 1 63 ARG 63 64 64 ARG ARG A . n A 1 64 THR 64 65 65 THR THR A . n A 1 65 SER 65 66 66 SER SER A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 ASN 67 68 68 ASN ASN A . n A 1 68 VAL 68 69 69 VAL VAL A . n A 1 69 GLU 69 70 70 GLU GLU A . n A 1 70 ASP 70 71 71 ASP ASP A . n A 1 71 ASP 71 72 72 ASP ASP A . n A 1 72 LEU 72 73 73 LEU LEU A . n A 1 73 ILE 73 74 74 ILE ILE A . n A 1 74 ILE 74 75 75 ILE ILE A . n A 1 75 PHE 75 76 76 PHE PHE A . n A 1 76 PRO 76 77 77 PRO PRO A . n A 1 77 ASP 77 78 78 ASP ASP A . n A 1 78 ASP 78 79 79 ASP ASP A . n A 1 79 CYS 79 80 80 CYS CYS A . n A 1 80 GLU 80 81 81 GLU GLU A . n A 1 81 PHE 81 82 82 PHE PHE A . n A 1 82 LYS 82 83 83 LYS LYS A . n A 1 83 ARG 83 84 84 ARG ARG A . n A 1 84 VAL 84 85 85 VAL VAL A . n A 1 85 PRO 85 86 86 PRO PRO A . n A 1 86 GLN 86 87 87 GLN GLN A . n A 1 87 CYS 87 88 88 CYS CYS A . n A 1 88 PRO 88 89 89 PRO PRO A . n A 1 89 SER 89 90 90 SER SER A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 ARG 91 92 92 ARG ARG A . n A 1 92 VAL 92 93 93 VAL VAL A . n A 1 93 TYR 93 94 94 TYR TYR A . n A 1 94 VAL 94 95 95 VAL VAL A . n A 1 95 LEU 95 96 96 LEU LEU A . n A 1 96 LYS 96 97 97 LYS LYS A . n A 1 97 PHE 97 98 98 PHE PHE A . n A 1 98 LYS 98 99 99 LYS LYS A . n A 1 99 ALA 99 100 100 ALA ALA A . n A 1 100 GLY 100 101 101 GLY GLY A . n A 1 101 SER 101 102 102 SER SER A . n A 1 102 LYS 102 103 103 LYS LYS A . n A 1 103 ARG 103 104 104 ARG ARG A . n A 1 104 LEU 104 105 105 LEU LEU A . n A 1 105 PHE 105 106 106 PHE PHE A . n A 1 106 PHE 106 107 107 PHE PHE A . n A 1 107 TRP 107 108 108 TRP TRP A . n A 1 108 MET 108 109 109 MET MET A . n A 1 109 GLN 109 110 110 GLN GLN A . n A 1 110 GLU 110 111 111 GLU GLU A . n A 1 111 PRO 111 112 112 PRO PRO A . n A 1 112 LYS 112 113 113 LYS LYS A . n A 1 113 THR 113 114 114 THR THR A . n A 1 114 ASP 114 115 115 ASP ASP A . n A 1 115 GLN 115 116 116 GLN GLN A . n A 1 116 ASP 116 117 117 ASP ASP A . n A 1 117 GLU 117 118 118 GLU GLU A . n A 1 118 GLU 118 119 119 GLU GLU A . n A 1 119 HIS 119 120 120 HIS HIS A . n A 1 120 CYS 120 121 121 CYS CYS A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 LYS 122 123 123 LYS LYS A . n A 1 123 VAL 123 124 124 VAL VAL A . n A 1 124 ASN 124 125 125 ASN ASN A . n A 1 125 GLU 125 126 126 GLU GLU A . n A 1 126 TYR 126 127 127 TYR TYR A . n A 1 127 LEU 127 128 128 LEU LEU A . n A 1 128 ASN 128 129 129 ASN ASN A . n A 1 129 ASN 129 130 130 ASN ASN A . n A 1 130 PRO 130 131 ? ? ? A . n A 1 131 PRO 131 132 ? ? ? A . n A 1 132 MET 132 133 ? ? ? A . n A 1 133 PRO 133 134 ? ? ? A . n A 1 134 GLY 134 135 ? ? ? A . n A 1 135 ALA 135 136 ? ? ? A . n A 1 136 LEU 136 137 ? ? ? A . n A 1 137 GLY 137 138 ? ? ? A . n A 1 138 ALA 138 139 ? ? ? A . n A 1 139 SER 139 140 ? ? ? A . n A 1 140 GLY 140 141 ? ? ? A . n A 1 141 SER 141 142 ? ? ? A . n A 1 142 SER 142 143 ? ? ? A . n A 1 143 GLY 143 144 ? ? ? A . n A 1 144 HIS 144 145 ? ? ? A . n A 1 145 GLU 145 146 ? ? ? A . n A 1 146 LEU 146 147 ? ? ? A . n A 1 147 SER 147 148 ? ? ? A . n A 1 148 ALA 148 149 ? ? ? A . n A 1 149 LEU 149 150 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DTT 1 201 1 DTT DTT A . C 2 DTT 1 202 2 DTT DTT A . D 3 HOH 1 301 54 HOH HOH A . D 3 HOH 2 302 51 HOH HOH A . D 3 HOH 3 303 10 HOH HOH A . D 3 HOH 4 304 23 HOH HOH A . D 3 HOH 5 305 36 HOH HOH A . D 3 HOH 6 306 30 HOH HOH A . D 3 HOH 7 307 69 HOH HOH A . D 3 HOH 8 308 8 HOH HOH A . D 3 HOH 9 309 68 HOH HOH A . D 3 HOH 10 310 18 HOH HOH A . D 3 HOH 11 311 42 HOH HOH A . D 3 HOH 12 312 44 HOH HOH A . D 3 HOH 13 313 34 HOH HOH A . D 3 HOH 14 314 14 HOH HOH A . D 3 HOH 15 315 21 HOH HOH A . D 3 HOH 16 316 12 HOH HOH A . D 3 HOH 17 317 2 HOH HOH A . D 3 HOH 18 318 11 HOH HOH A . D 3 HOH 19 319 16 HOH HOH A . D 3 HOH 20 320 33 HOH HOH A . D 3 HOH 21 321 17 HOH HOH A . D 3 HOH 22 322 39 HOH HOH A . D 3 HOH 23 323 1 HOH HOH A . D 3 HOH 24 324 5 HOH HOH A . D 3 HOH 25 325 28 HOH HOH A . D 3 HOH 26 326 19 HOH HOH A . D 3 HOH 27 327 63 HOH HOH A . D 3 HOH 28 328 61 HOH HOH A . D 3 HOH 29 329 31 HOH HOH A . D 3 HOH 30 330 6 HOH HOH A . D 3 HOH 31 331 3 HOH HOH A . D 3 HOH 32 332 7 HOH HOH A . D 3 HOH 33 333 38 HOH HOH A . D 3 HOH 34 334 56 HOH HOH A . D 3 HOH 35 335 46 HOH HOH A . D 3 HOH 36 336 20 HOH HOH A . D 3 HOH 37 337 65 HOH HOH A . D 3 HOH 38 338 22 HOH HOH A . D 3 HOH 39 339 35 HOH HOH A . D 3 HOH 40 340 53 HOH HOH A . D 3 HOH 41 341 15 HOH HOH A . D 3 HOH 42 342 67 HOH HOH A . D 3 HOH 43 343 4 HOH HOH A . D 3 HOH 44 344 13 HOH HOH A . D 3 HOH 45 345 24 HOH HOH A . D 3 HOH 46 346 9 HOH HOH A . D 3 HOH 47 347 43 HOH HOH A . D 3 HOH 48 348 32 HOH HOH A . D 3 HOH 49 349 57 HOH HOH A . D 3 HOH 50 350 41 HOH HOH A . D 3 HOH 51 351 29 HOH HOH A . D 3 HOH 52 352 50 HOH HOH A . D 3 HOH 53 353 25 HOH HOH A . D 3 HOH 54 354 58 HOH HOH A . D 3 HOH 55 355 62 HOH HOH A . D 3 HOH 56 356 45 HOH HOH A . D 3 HOH 57 357 47 HOH HOH A . D 3 HOH 58 358 40 HOH HOH A . D 3 HOH 59 359 64 HOH HOH A . D 3 HOH 60 360 27 HOH HOH A . D 3 HOH 61 361 49 HOH HOH A . D 3 HOH 62 362 55 HOH HOH A . D 3 HOH 63 363 37 HOH HOH A . D 3 HOH 64 364 48 HOH HOH A . D 3 HOH 65 365 52 HOH HOH A . D 3 HOH 66 366 66 HOH HOH A . D 3 HOH 67 367 26 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1218 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? HKL-2000 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? HKL-2000 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5IRS _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.555 _cell.length_a_esd ? _cell.length_b 56.476 _cell.length_b_esd ? _cell.length_c 64.089 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IRS _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IRS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG4000, Sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-11-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5IRS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.796 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14838 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.06 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.72 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.82 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.35 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.96 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5IRS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.796 _refine.ls_d_res_low 35.451 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14367 _refine.ls_number_reflns_R_free 1433 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.91 _refine.ls_percent_reflns_R_free 9.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1713 _refine.ls_R_factor_R_free 0.2092 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1670 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 2R2Y _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.63 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 911 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 994 _refine_hist.d_res_high 1.796 _refine_hist.d_res_low 35.451 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 ? 972 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.501 ? 1307 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.881 ? 375 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.100 ? 137 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 170 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7956 1.8598 . . 131 1191 89.00 . . . 0.2699 . 0.2395 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8598 1.9342 . . 137 1237 94.00 . . . 0.2528 . 0.2304 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9342 2.0222 . . 136 1275 95.00 . . . 0.2433 . 0.1881 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0222 2.1288 . . 136 1257 95.00 . . . 0.2015 . 0.1751 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1288 2.2622 . . 143 1273 97.00 . . . 0.2272 . 0.1735 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2622 2.4368 . . 146 1294 97.00 . . . 0.2541 . 0.1826 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4368 2.6820 . . 147 1301 96.00 . . . 0.2070 . 0.1705 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6820 3.0699 . . 147 1318 98.00 . . . 0.2210 . 0.1775 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0699 3.8670 . . 151 1360 99.00 . . . 0.1905 . 0.1503 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8670 35.4584 . . 159 1428 99.00 . . . 0.1983 . 0.1577 . . . . . . . . . . # _struct.entry_id 5IRS _struct.title 'crystal structure of the proteasomal Rpn13 PRU-domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IRS _struct_keywords.text 'Ubiquitin, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ADRM1_HUMAN _struct_ref.pdbx_db_accession Q16186 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCE FKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSAL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IRS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16186 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 150 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 115 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 129 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 116 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 130 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 87 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id A _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id DTT _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id S1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 88 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id DTT _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.132 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id DTT _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 87 _pdbx_modification_feature.modified_residue_label_alt_id A _pdbx_modification_feature.auth_comp_id DTT _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 88 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom S1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id DTT _pdbx_modification_feature.type None _pdbx_modification_feature.category Crosslinker # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 36 ? PRO A 39 ? THR A 37 PRO A 40 AA1 2 VAL A 23 ? LYS A 33 ? VAL A 24 LYS A 34 AA1 3 GLY A 44 ? GLN A 50 ? GLY A 45 GLN A 51 AA1 4 ILE A 56 ? ASP A 62 ? ILE A 57 ASP A 63 AA1 5 VAL A 68 ? ILE A 73 ? VAL A 69 ILE A 74 AA2 1 THR A 36 ? PRO A 39 ? THR A 37 PRO A 40 AA2 2 VAL A 23 ? LYS A 33 ? VAL A 24 LYS A 34 AA2 3 ARG A 103 ? MET A 108 ? ARG A 104 MET A 109 AA2 4 VAL A 92 ? PHE A 97 ? VAL A 93 PHE A 98 AA2 5 CYS A 79 ? ARG A 83 ? CYS A 80 ARG A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 38 ? O THR A 39 N SER A 31 ? N SER A 32 AA1 2 3 N PHE A 25 ? N PHE A 26 O VAL A 46 ? O VAL A 47 AA1 3 4 N TYR A 47 ? N TYR A 48 O CYS A 59 ? O CYS A 60 AA1 4 5 N PHE A 58 ? N PHE A 59 O LEU A 72 ? O LEU A 73 AA2 1 2 O THR A 38 ? O THR A 39 N SER A 31 ? N SER A 32 AA2 2 3 N GLY A 28 ? N GLY A 29 O TRP A 107 ? O TRP A 108 AA2 3 4 O LEU A 104 ? O LEU A 105 N LEU A 95 ? N LEU A 96 AA2 4 5 O LYS A 96 ? O LYS A 97 N GLU A 80 ? N GLU A 81 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A DTT 201 ? 7 'binding site for residue DTT A 201' AC2 Software A DTT 202 ? 7 'binding site for residue DTT A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 78 ? ASP A 79 . ? 3_645 ? 2 AC1 7 CYS A 87 ? CYS A 88 . ? 1_555 ? 3 AC1 7 PRO A 88 ? PRO A 89 . ? 1_555 ? 4 AC1 7 SER A 89 ? SER A 90 . ? 1_555 ? 5 AC1 7 DTT C . ? DTT A 202 . ? 1_555 ? 6 AC1 7 HOH D . ? HOH A 305 . ? 3_645 ? 7 AC1 7 HOH D . ? HOH A 356 . ? 1_555 ? 8 AC2 7 PRO A 39 ? PRO A 40 . ? 1_555 ? 9 AC2 7 ASP A 78 ? ASP A 79 . ? 3_645 ? 10 AC2 7 TRP A 107 ? TRP A 108 . ? 1_555 ? 11 AC2 7 DTT B . ? DTT A 201 . ? 1_555 ? 12 AC2 7 HOH D . ? HOH A 311 . ? 1_555 ? 13 AC2 7 HOH D . ? HOH A 312 . ? 1_555 ? 14 AC2 7 HOH D . ? HOH A 356 . ? 1_555 ? # _pdbx_entry_details.entry_id 5IRS _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 55 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 73.89 _pdbx_validate_torsion.psi -1.38 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 14.7463 52.0946 1.0626 0.4285 0.4461 0.2854 0.0536 -0.0948 0.0869 1.1001 0.7948 2.8740 -0.0779 -0.9509 1.3219 -0.6498 0.6454 0.3509 -0.6213 0.5799 0.7731 -1.3008 -1.7865 -0.0972 'X-RAY DIFFRACTION' 2 ? refined 13.6056 41.6566 3.1515 0.2745 0.3785 0.1484 0.0473 -0.0507 -0.0501 2.4277 7.6794 0.1311 2.1358 -0.4565 0.0843 -0.0439 1.0642 -0.1867 -1.3731 -0.1440 0.2955 -0.6958 -1.2266 -0.3808 'X-RAY DIFFRACTION' 3 ? refined 13.5631 38.1462 16.6615 0.3722 0.3956 0.3623 0.0170 -0.0253 0.0291 0.5576 3.2278 0.6640 -0.0171 0.5761 -0.4955 0.0426 -0.9123 -0.1788 0.9776 0.0413 1.1822 0.1900 -0.1575 0.0034 'X-RAY DIFFRACTION' 4 ? refined 14.8728 36.1156 27.0272 1.1428 0.6532 -0.0040 0.5175 0.2272 -0.1732 0.6033 0.4320 1.3556 0.4195 0.4751 0.1350 -0.1071 -0.4766 -0.1979 0.1867 0.0541 -0.0228 0.4947 0.7746 0.2084 'X-RAY DIFFRACTION' 5 ? refined 12.2988 33.6962 19.2824 0.3828 0.3536 0.3062 0.0240 0.0233 0.0403 2.5520 0.8347 7.3167 0.1125 2.8275 0.7334 0.2032 -1.2846 -0.5871 0.8202 0.2510 0.0849 1.0274 -1.5432 0.0103 'X-RAY DIFFRACTION' 6 ? refined 10.8423 43.6271 8.0941 0.2022 0.2343 0.2448 -0.0209 -0.0132 -0.0104 1.0821 1.0082 0.6864 -1.0732 0.2957 -0.3247 0.0105 0.1031 -0.1410 0.0152 0.0718 0.0880 -0.1986 -0.6594 0.0118 'X-RAY DIFFRACTION' 7 ? refined 17.0828 60.2584 7.4434 0.5895 0.2678 0.4618 -0.0261 -0.1417 0.0039 1.5243 1.2282 1.9952 0.7270 -0.6063 0.9495 -0.6821 0.6730 1.1646 -0.1782 -0.2232 1.6048 -1.4454 -0.6976 -0.1150 'X-RAY DIFFRACTION' 8 ? refined 13.1440 48.4243 10.7049 0.2208 0.2042 0.2537 -0.0119 -0.0172 -0.0136 0.3759 0.7559 1.4606 0.5045 0.2639 0.7728 -0.1541 -0.0655 0.2173 -0.5046 -0.0787 0.5532 -0.8270 -0.1833 0.0002 'X-RAY DIFFRACTION' 9 ? refined 4.3132 44.6734 10.7960 0.1016 0.4212 0.4117 0.0155 0.0404 -0.0770 0.3597 5.8291 5.0414 -0.1366 1.2030 1.1964 0.5907 -0.5316 0.0452 0.4593 -0.3561 1.2042 0.4246 -1.5808 0.5306 'X-RAY DIFFRACTION' 10 ? refined 19.6089 53.6399 14.1195 0.2440 0.2109 0.2654 -0.0262 -0.0226 -0.0478 0.2966 0.5728 0.2121 0.1056 0.0565 0.2883 0.2941 -0.7541 0.2961 0.1771 -0.2991 0.1986 -0.2008 -0.0733 0.0031 'X-RAY DIFFRACTION' 11 ? refined 27.5276 46.7135 12.5128 0.3015 0.3941 0.4879 -0.0697 -0.0184 -0.0220 0.8897 1.5862 2.0568 0.8565 -0.2691 0.9832 -0.1105 -0.3367 0.3934 0.6387 0.7727 -1.2944 -0.1150 1.2759 0.1836 'X-RAY DIFFRACTION' 12 ? refined 27.1603 31.4911 11.5607 0.4630 0.3654 0.5828 0.0993 0.1284 0.0800 1.8513 3.1075 1.0104 -1.3992 1.1541 -0.1381 0.1207 0.0002 -2.0507 -1.5078 -0.4491 -1.4242 1.4554 1.1450 -0.0274 'X-RAY DIFFRACTION' 13 ? refined 22.1605 27.9529 11.0411 0.8118 0.4498 0.5523 0.1487 -0.1273 -0.0739 0.1013 0.1880 0.1477 0.0245 -0.0657 -0.1658 0.6309 0.1032 -0.4685 -1.6928 0.0190 -1.1812 -0.0733 -0.0543 0.0072 'X-RAY DIFFRACTION' 14 ? refined 21.3957 35.4837 9.4801 0.2480 0.2005 0.2929 0.0188 -0.0378 -0.0426 0.4497 0.3929 0.5433 -0.0830 -0.2379 -0.2639 -0.1044 0.1367 -0.3330 -0.6132 -0.2048 -0.0386 0.2414 0.4883 -0.0027 'X-RAY DIFFRACTION' 15 ? refined 27.0357 46.5735 17.4046 0.2735 0.3432 0.4485 -0.1510 -0.0898 -0.0114 1.7003 0.3253 1.0898 -0.3007 0.4465 0.4205 0.4060 -0.5333 -0.6423 0.9394 -0.1808 -1.2360 -0.2226 1.0557 -0.0425 'X-RAY DIFFRACTION' 16 ? refined 23.7915 43.7322 20.9750 0.5622 0.3536 0.3352 -0.0223 -0.1966 0.0310 0.1857 2.8777 3.7407 -0.6692 -0.8090 3.2620 -0.4039 -0.7001 0.0172 2.2855 0.0840 -0.3777 -0.0389 -0.4995 -0.3634 'X-RAY DIFFRACTION' 17 ? refined 15.5513 35.6693 6.9825 0.2428 0.3077 0.3256 -0.0145 -0.0477 -0.0943 2.0712 1.6291 0.8193 -0.5305 -0.8112 -0.6848 -0.0424 0.9904 -0.6920 -0.1733 0.3483 0.2140 0.1633 0.5123 0.0200 'X-RAY DIFFRACTION' 18 ? refined 22.5557 37.2328 -0.1901 0.4694 0.3588 0.3694 -0.0016 0.1077 -0.0538 1.4732 6.6968 1.1835 -0.2596 -1.2720 0.8030 -0.1844 0.4726 -0.6768 -1.8972 -0.0958 -0.0958 0.5941 -0.3411 -0.0462 'X-RAY DIFFRACTION' 19 ? refined 25.2619 46.6383 2.8318 0.3271 0.3419 0.2705 -0.0684 0.0296 0.0104 0.7216 0.5196 0.5526 0.3254 -0.3684 0.2632 -0.1322 0.2391 0.0747 -0.8478 0.1647 -0.8285 -0.4021 0.2375 0.0019 'X-RAY DIFFRACTION' 20 ? refined 27.7627 52.3832 6.7676 0.3447 0.4374 0.4500 -0.1652 0.1128 -0.0442 3.9713 1.6016 1.9980 -0.0390 -3.4825 -3.7680 -0.2377 0.6223 0.6961 -0.5205 0.4055 -1.5360 -0.5585 2.5492 0.2539 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 21:24)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 25:28)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 29:32)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain A and resid 33:36)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(chain A and resid 37:42)' 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? '(chain A and resid 43:49)' 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? '(chain A and resid 50:57)' 'X-RAY DIFFRACTION' 8 8 ? ? ? ? ? ? ? ? ? '(chain A and resid 58:62)' 'X-RAY DIFFRACTION' 9 9 ? ? ? ? ? ? ? ? ? '(chain A and resid 63:70)' 'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain A and resid 71:77)' 'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(chain A and resid 78:83)' 'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(chain A and resid 84:87)' 'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(chain A and resid 88:91)' 'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(chain A and resid 92:95)' 'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(chain A and resid 96:100)' 'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(chain A and resid 101:105)' 'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(chain A and resid 106:113)' 'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(chain A and resid 114:120)' 'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(chain A and resid 121:127)' 'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(chain A and resid 128:131)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 2 ? A THR 1 2 1 Y 1 A THR 3 ? A THR 2 3 1 Y 1 A SER 4 ? A SER 3 4 1 Y 1 A GLY 5 ? A GLY 4 5 1 Y 1 A ALA 6 ? A ALA 5 6 1 Y 1 A LEU 7 ? A LEU 6 7 1 Y 1 A PHE 8 ? A PHE 7 8 1 Y 1 A PRO 9 ? A PRO 8 9 1 Y 1 A SER 10 ? A SER 9 10 1 Y 1 A LEU 11 ? A LEU 10 11 1 Y 1 A VAL 12 ? A VAL 11 12 1 Y 1 A PRO 13 ? A PRO 12 13 1 Y 1 A GLY 14 ? A GLY 13 14 1 Y 1 A SER 15 ? A SER 14 15 1 Y 1 A ARG 16 ? A ARG 15 16 1 Y 1 A GLY 17 ? A GLY 16 17 1 Y 1 A ALA 18 ? A ALA 17 18 1 Y 1 A SER 19 ? A SER 18 19 1 Y 1 A ASN 20 ? A ASN 19 20 1 Y 1 A PRO 131 ? A PRO 130 21 1 Y 1 A PRO 132 ? A PRO 131 22 1 Y 1 A MET 133 ? A MET 132 23 1 Y 1 A PRO 134 ? A PRO 133 24 1 Y 1 A GLY 135 ? A GLY 134 25 1 Y 1 A ALA 136 ? A ALA 135 26 1 Y 1 A LEU 137 ? A LEU 136 27 1 Y 1 A GLY 138 ? A GLY 137 28 1 Y 1 A ALA 139 ? A ALA 138 29 1 Y 1 A SER 140 ? A SER 139 30 1 Y 1 A GLY 141 ? A GLY 140 31 1 Y 1 A SER 142 ? A SER 141 32 1 Y 1 A SER 143 ? A SER 142 33 1 Y 1 A GLY 144 ? A GLY 143 34 1 Y 1 A HIS 145 ? A HIS 144 35 1 Y 1 A GLU 146 ? A GLU 145 36 1 Y 1 A LEU 147 ? A LEU 146 37 1 Y 1 A SER 148 ? A SER 147 38 1 Y 1 A ALA 149 ? A ALA 148 39 1 Y 1 A LEU 150 ? A LEU 149 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DTT S1 S N N 88 DTT C1 C N N 89 DTT C2 C N R 90 DTT O2 O N N 91 DTT C3 C N R 92 DTT O3 O N N 93 DTT C4 C N N 94 DTT S4 S N N 95 DTT HS1 H N N 96 DTT H11 H N N 97 DTT H12 H N N 98 DTT H2 H N N 99 DTT HO2 H N N 100 DTT H3 H N N 101 DTT HO3 H N N 102 DTT H41 H N N 103 DTT H42 H N N 104 DTT HS2 H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DTT S1 C1 sing N N 83 DTT S1 HS1 sing N N 84 DTT C1 C2 sing N N 85 DTT C1 H11 sing N N 86 DTT C1 H12 sing N N 87 DTT C2 O2 sing N N 88 DTT C2 C3 sing N N 89 DTT C2 H2 sing N N 90 DTT O2 HO2 sing N N 91 DTT C3 O3 sing N N 92 DTT C3 C4 sing N N 93 DTT C3 H3 sing N N 94 DTT O3 HO3 sing N N 95 DTT C4 S4 sing N N 96 DTT C4 H41 sing N N 97 DTT C4 H42 sing N N 98 DTT S4 HS2 sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HIS N CA sing N N 146 HIS N H sing N N 147 HIS N H2 sing N N 148 HIS CA C sing N N 149 HIS CA CB sing N N 150 HIS CA HA sing N N 151 HIS C O doub N N 152 HIS C OXT sing N N 153 HIS CB CG sing N N 154 HIS CB HB2 sing N N 155 HIS CB HB3 sing N N 156 HIS CG ND1 sing Y N 157 HIS CG CD2 doub Y N 158 HIS ND1 CE1 doub Y N 159 HIS ND1 HD1 sing N N 160 HIS CD2 NE2 sing Y N 161 HIS CD2 HD2 sing N N 162 HIS CE1 NE2 sing Y N 163 HIS CE1 HE1 sing N N 164 HIS NE2 HE2 sing N N 165 HIS OXT HXT sing N N 166 HOH O H1 sing N N 167 HOH O H2 sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 MET N CA sing N N 235 MET N H sing N N 236 MET N H2 sing N N 237 MET CA C sing N N 238 MET CA CB sing N N 239 MET CA HA sing N N 240 MET C O doub N N 241 MET C OXT sing N N 242 MET CB CG sing N N 243 MET CB HB2 sing N N 244 MET CB HB3 sing N N 245 MET CG SD sing N N 246 MET CG HG2 sing N N 247 MET CG HG3 sing N N 248 MET SD CE sing N N 249 MET CE HE1 sing N N 250 MET CE HE2 sing N N 251 MET CE HE3 sing N N 252 MET OXT HXT sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2R2Y _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5IRS _atom_sites.fract_transf_matrix[1][1] 0.023499 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017707 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015603 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_