data_5IX5 # _entry.id 5IX5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IX5 pdb_00005ix5 10.2210/pdb5ix5/pdb WWPDB D_1000219283 ? ? BMRB 30039 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 30039 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5IX5 _pdbx_database_status.recvd_initial_deposition_date 2016-03-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Masakatsu, K.' 1 'Umetsu, Y.' 2 'Rumi, F.' 3 'Kikukawa, T.' 4 'Ohki, S.' 5 'Mizuguchi, M.' 6 'Demura, M.' 7 'Aizawa, T.' 8 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR structure of ABF-2 (antibacterial factor-2) from C. elegans and the interaction with membrane mimetic systems' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rumi, F.' 1 ? primary 'Kamiya, M.' 2 ? primary 'Umetsu, Y.' 3 ? primary 'Kikukawa, T.' 4 ? primary 'Demura, M.' 5 ? primary 'Aizawa, T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Antibacterial factor-related peptide 2' _entity.formula_weight 7140.460 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG _entity_poly.pdbx_seq_one_letter_code_can MDIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ILE n 1 4 ASP n 1 5 PHE n 1 6 SER n 1 7 THR n 1 8 CYS n 1 9 ALA n 1 10 ARG n 1 11 MET n 1 12 ASP n 1 13 VAL n 1 14 PRO n 1 15 ILE n 1 16 LEU n 1 17 LYS n 1 18 LYS n 1 19 ALA n 1 20 ALA n 1 21 GLN n 1 22 GLY n 1 23 LEU n 1 24 CYS n 1 25 ILE n 1 26 THR n 1 27 SER n 1 28 CYS n 1 29 SER n 1 30 MET n 1 31 GLN n 1 32 ASN n 1 33 CYS n 1 34 GLY n 1 35 THR n 1 36 GLY n 1 37 SER n 1 38 CYS n 1 39 LYS n 1 40 LYS n 1 41 ARG n 1 42 SER n 1 43 GLY n 1 44 ARG n 1 45 PRO n 1 46 THR n 1 47 CYS n 1 48 VAL n 1 49 CYS n 1 50 TYR n 1 51 ARG n 1 52 CYS n 1 53 ALA n 1 54 ASN n 1 55 GLY n 1 56 GLY n 1 57 GLY n 1 58 ASP n 1 59 ILE n 1 60 PRO n 1 61 LEU n 1 62 GLY n 1 63 ALA n 1 64 LEU n 1 65 ILE n 1 66 LYS n 1 67 ARG n 1 68 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 68 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'abf-2, C50F2.10' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABF2_CAEEL _struct_ref.pdbx_db_accession G5EC68 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IX5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G5EC68 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 68 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5IX5 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code G5EC68 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '3D HNCACB' 2 isotropic 3 1 1 '3D CBCA(CO)NH' 2 isotropic 6 1 1 '3D HNCA' 2 isotropic 15 1 1 '3D C(CO)NH' 2 isotropic 7 1 1 '3D H(CCO)NH' 2 isotropic 8 1 1 '3D HBHA(CO)NH' 2 isotropic 9 1 1 '3D HCCH-TOCSY' 2 isotropic 10 1 1 '3D HCCH-COSY' 2 isotropic 11 1 2 '3D 1H-15N NOESY' 2 isotropic 12 1 1 '3D 1H-13C NOESY' 2 isotropic 13 1 1 '2D 1H-13C HSQC' 2 isotropic 14 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 16 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N13C_sample solution ? 2 '1 mM [U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 DRX ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 5IX5 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 5IX5 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5IX5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' Sparky 3.115 Goddard 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 collection TopSpin ? 'Bruker Biospin' 4 refinement CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IX5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5IX5 _struct.title 'NMR structure of antibacterial factor-2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IX5 _struct_keywords.text 'antimicrobial peptide, CYANA 2.1, ANTIBIOTIC' _struct_keywords.pdbx_keywords ANTIBIOTIC # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 13 ? ILE A 15 ? VAL A 13 ILE A 15 5 ? 3 HELX_P HELX_P2 AA2 LEU A 16 ? MET A 30 ? LEU A 16 MET A 30 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 8 A CYS 38 1_555 ? ? ? ? ? ? ? 2.005 ? ? disulf2 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 24 A CYS 47 1_555 ? ? ? ? ? ? ? 1.991 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 28 A CYS 49 1_555 ? ? ? ? ? ? ? 1.911 ? ? disulf4 disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 33 A CYS 52 1_555 ? ? ? ? ? ? ? 1.859 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 38 ? ARG A 41 ? CYS A 38 ARG A 41 AA1 2 ARG A 44 ? CYS A 47 ? ARG A 44 CYS A 47 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 41 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 41 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 44 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 44 # _atom_sites.entry_id 5IX5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLY 68 68 68 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4740 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-29 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Antibacterial factor-2' 1 ? mM '[U-100% 13C; U-100% 15N]' 2 'Antibacterial factor-2' 1 ? mM '[U-100% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 62.88 -179.10 2 1 THR A 7 ? ? -151.20 18.20 3 1 MET A 11 ? ? -82.52 -70.76 4 1 ASP A 12 ? ? -154.98 -39.86 5 1 VAL A 13 ? ? -111.96 77.83 6 1 CYS A 24 ? ? -121.29 -52.57 7 1 PRO A 45 ? ? -69.72 88.19 8 2 THR A 7 ? ? -147.61 16.16 9 2 LEU A 16 ? ? 64.00 70.84 10 2 CYS A 24 ? ? -121.33 -52.83 11 2 PRO A 45 ? ? -69.72 87.82 12 2 ILE A 65 ? ? -55.88 109.08 13 3 THR A 7 ? ? -146.69 15.19 14 3 MET A 11 ? ? -82.74 -70.85 15 3 ASP A 12 ? ? -157.82 -39.11 16 3 VAL A 13 ? ? -110.97 79.84 17 3 LEU A 16 ? ? -117.05 60.56 18 3 CYS A 24 ? ? -121.30 -52.59 19 3 PRO A 45 ? ? -69.69 87.77 20 4 THR A 7 ? ? -151.39 18.19 21 4 VAL A 13 ? ? -112.12 78.14 22 4 LEU A 16 ? ? 63.92 81.16 23 4 CYS A 24 ? ? -121.41 -52.70 24 4 PRO A 45 ? ? -69.83 89.77 25 5 ASP A 2 ? ? -130.48 -63.25 26 5 THR A 7 ? ? -161.01 23.05 27 5 MET A 11 ? ? -67.00 -75.17 28 5 ASP A 12 ? ? -158.78 -39.74 29 5 PRO A 14 ? ? -69.75 74.82 30 5 CYS A 24 ? ? -121.43 -52.80 31 5 PRO A 45 ? ? -69.78 90.24 32 6 ASP A 2 ? ? -151.79 48.93 33 6 THR A 7 ? ? -160.48 23.78 34 6 VAL A 13 ? ? -111.98 78.62 35 6 LEU A 16 ? ? 63.18 85.30 36 6 CYS A 24 ? ? -120.43 -52.51 37 6 PRO A 45 ? ? -69.77 87.34 38 7 THR A 7 ? ? -152.85 -53.93 39 7 ASP A 12 ? ? -160.49 -39.93 40 7 VAL A 13 ? ? -112.04 78.16 41 7 PRO A 14 ? ? -69.81 77.59 42 7 CYS A 24 ? ? -121.19 -52.37 43 7 PRO A 45 ? ? -69.79 92.22 44 8 THR A 7 ? ? -153.58 19.47 45 8 ASP A 12 ? ? -156.89 -38.43 46 8 LEU A 16 ? ? 62.06 80.38 47 8 CYS A 24 ? ? -121.11 -52.32 48 8 PRO A 45 ? ? -69.75 91.21 49 9 THR A 7 ? ? -146.06 14.90 50 9 MET A 11 ? ? -82.38 -71.86 51 9 ASP A 12 ? ? -156.93 -39.15 52 9 VAL A 13 ? ? -110.94 79.96 53 9 LEU A 16 ? ? -116.92 60.88 54 9 CYS A 24 ? ? -121.17 -52.42 55 9 PRO A 45 ? ? -69.77 90.11 56 10 SER A 6 ? ? -164.93 99.91 57 10 THR A 7 ? ? -164.63 25.94 58 10 MET A 11 ? ? -65.97 -75.18 59 10 ASP A 12 ? ? -156.36 -39.52 60 10 CYS A 24 ? ? -120.60 -52.59 61 10 PRO A 45 ? ? -69.78 85.92 62 11 THR A 7 ? ? -144.26 13.69 63 11 MET A 11 ? ? -83.09 -72.66 64 11 ASP A 12 ? ? -156.21 -39.19 65 11 LEU A 16 ? ? -116.24 60.34 66 11 CYS A 24 ? ? -120.89 -52.28 67 11 PRO A 45 ? ? -69.77 91.09 68 12 THR A 7 ? ? -147.20 15.92 69 12 VAL A 13 ? ? -112.23 77.08 70 12 LEU A 16 ? ? 63.70 81.06 71 12 CYS A 24 ? ? -120.34 -52.44 72 12 PRO A 45 ? ? -69.78 88.63 73 12 ILE A 65 ? ? -55.29 109.29 74 13 ASP A 2 ? ? -173.18 -172.41 75 13 THR A 7 ? ? -149.99 17.95 76 13 VAL A 13 ? ? -112.00 78.09 77 13 LEU A 16 ? ? 61.29 79.79 78 13 CYS A 24 ? ? -121.25 -52.43 79 13 PRO A 45 ? ? -69.77 92.34 80 14 ASP A 2 ? ? -139.85 -68.80 81 14 THR A 7 ? ? -146.70 15.88 82 14 VAL A 13 ? ? -112.22 77.35 83 14 LEU A 16 ? ? 61.05 79.08 84 14 CYS A 24 ? ? -120.68 -52.23 85 14 PRO A 45 ? ? -69.73 92.61 86 15 ASP A 2 ? ? 62.95 169.60 87 15 THR A 7 ? ? -146.56 15.74 88 15 VAL A 13 ? ? -112.09 78.00 89 15 LEU A 16 ? ? 63.93 78.11 90 15 CYS A 24 ? ? -120.04 -52.25 91 15 PRO A 45 ? ? -69.75 89.73 92 16 THR A 7 ? ? -143.32 13.37 93 16 VAL A 13 ? ? -112.25 77.55 94 16 LEU A 16 ? ? 64.05 79.45 95 16 CYS A 24 ? ? -121.04 -52.46 96 16 PRO A 45 ? ? -69.80 93.37 97 17 ASP A 2 ? ? 62.83 164.21 98 17 THR A 7 ? ? -151.48 18.83 99 17 MET A 11 ? ? -83.94 -70.08 100 17 ASP A 12 ? ? -156.34 -39.52 101 17 VAL A 13 ? ? -111.76 78.23 102 17 CYS A 24 ? ? -121.01 -52.26 103 17 PRO A 45 ? ? -69.71 93.28 104 18 THR A 7 ? ? -146.87 15.72 105 18 VAL A 13 ? ? -112.16 77.81 106 18 LEU A 16 ? ? 63.89 79.22 107 18 CYS A 24 ? ? -121.04 -52.39 108 18 PRO A 45 ? ? -69.71 93.06 109 19 ASP A 12 ? ? -160.70 -38.41 110 19 LEU A 16 ? ? -112.70 60.66 111 19 CYS A 24 ? ? -121.09 -52.65 112 19 PRO A 45 ? ? -69.75 92.60 113 20 ASP A 2 ? ? -153.47 52.61 114 20 THR A 7 ? ? -156.09 21.65 115 20 VAL A 13 ? ? -112.54 75.43 116 20 CYS A 24 ? ? -120.33 -52.45 117 20 PRO A 45 ? ? -69.80 91.08 #