data_5IZ9 # _entry.id 5IZ9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5IZ9 WWPDB D_1000219700 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5IZ6 unspecified PDB . 5IZ8 unspecified PDB . 5IZA unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IZ9 _pdbx_database_status.recvd_initial_deposition_date 2016-03-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhao, Y.' 1 ? 'Jiang, H.' 2 ? 'Yang, X.' 3 ? 'Jiang, F.' 4 ? 'Song, K.' 5 ? 'Zhang, J.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 994 _citation.page_last 1001 _citation.title 'Peptidomimetic inhibitors of APC-Asef interaction block colorectal cancer migration.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nchembio.2442 _citation.pdbx_database_id_PubMed 28759015 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, H.' 1 ? primary 'Deng, R.' 2 ? primary 'Yang, X.' 3 ? primary 'Shang, J.' 4 ? primary 'Lu, S.' 5 ? primary 'Zhao, Y.' 6 ? primary 'Song, K.' 7 ? primary 'Liu, X.' 8 ? primary 'Zhang, Q.' 9 ? primary 'Chen, Y.' 10 0000-0002-8206-3325 primary 'Chinn, Y.E.' 11 ? primary 'Wu, G.' 12 ? primary 'Li, J.' 13 ? primary 'Chen, G.' 14 ? primary 'Yu, J.' 15 ? primary 'Zhang, J.' 16 ? # _cell.entry_id 5IZ9 _cell.length_a 64.133 _cell.length_b 64.559 _cell.length_c 84.912 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IZ9 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Adenomatous polyposis coli protein' 39268.246 1 ? ? 'UNP RESIDUES 407-751' ? 2 polymer syn ACE-GLY-GLY-GLU-ALA-LEU-ALA-ASP-NH2 655.679 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein APC,Deleted in polyposis 2.5' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGHHHHHHMLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAE LLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADV NSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGG ILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKM IAMGSAAALRNLMANRPAKYKDANIMSPGSSLPS ; ;MGHHHHHHMLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAE LLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADV NSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGG ILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKM IAMGSAAALRNLMANRPAKYKDANIMSPGSSLPS ; A ? 2 'polypeptide(L)' no yes '(ACE)GGEALAD(NH2)' XGGEALADX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 LEU n 1 11 HIS n 1 12 LEU n 1 13 LEU n 1 14 GLU n 1 15 GLN n 1 16 ILE n 1 17 ARG n 1 18 ALA n 1 19 TYR n 1 20 CYS n 1 21 GLU n 1 22 THR n 1 23 CYS n 1 24 TRP n 1 25 GLU n 1 26 TRP n 1 27 GLN n 1 28 GLU n 1 29 ALA n 1 30 HIS n 1 31 GLU n 1 32 PRO n 1 33 GLY n 1 34 MET n 1 35 ASP n 1 36 GLN n 1 37 ASP n 1 38 LYS n 1 39 ASN n 1 40 PRO n 1 41 MET n 1 42 PRO n 1 43 ALA n 1 44 PRO n 1 45 VAL n 1 46 GLU n 1 47 HIS n 1 48 GLN n 1 49 ILE n 1 50 CYS n 1 51 PRO n 1 52 ALA n 1 53 VAL n 1 54 CYS n 1 55 VAL n 1 56 LEU n 1 57 MET n 1 58 LYS n 1 59 LEU n 1 60 SER n 1 61 PHE n 1 62 ASP n 1 63 GLU n 1 64 GLU n 1 65 HIS n 1 66 ARG n 1 67 HIS n 1 68 ALA n 1 69 MET n 1 70 ASN n 1 71 GLU n 1 72 LEU n 1 73 GLY n 1 74 GLY n 1 75 LEU n 1 76 GLN n 1 77 ALA n 1 78 ILE n 1 79 ALA n 1 80 GLU n 1 81 LEU n 1 82 LEU n 1 83 GLN n 1 84 VAL n 1 85 ASP n 1 86 CYS n 1 87 GLU n 1 88 MET n 1 89 TYR n 1 90 GLY n 1 91 LEU n 1 92 THR n 1 93 ASN n 1 94 ASP n 1 95 HIS n 1 96 TYR n 1 97 SER n 1 98 ILE n 1 99 THR n 1 100 LEU n 1 101 ARG n 1 102 ARG n 1 103 TYR n 1 104 ALA n 1 105 GLY n 1 106 MET n 1 107 ALA n 1 108 LEU n 1 109 THR n 1 110 ASN n 1 111 LEU n 1 112 THR n 1 113 PHE n 1 114 GLY n 1 115 ASP n 1 116 VAL n 1 117 ALA n 1 118 ASN n 1 119 LYS n 1 120 ALA n 1 121 THR n 1 122 LEU n 1 123 CYS n 1 124 SER n 1 125 MET n 1 126 LYS n 1 127 GLY n 1 128 CYS n 1 129 MET n 1 130 ARG n 1 131 ALA n 1 132 LEU n 1 133 VAL n 1 134 ALA n 1 135 GLN n 1 136 LEU n 1 137 LYS n 1 138 SER n 1 139 GLU n 1 140 SER n 1 141 GLU n 1 142 ASP n 1 143 LEU n 1 144 GLN n 1 145 GLN n 1 146 VAL n 1 147 ILE n 1 148 ALA n 1 149 SER n 1 150 VAL n 1 151 LEU n 1 152 ARG n 1 153 ASN n 1 154 LEU n 1 155 SER n 1 156 TRP n 1 157 ARG n 1 158 ALA n 1 159 ASP n 1 160 VAL n 1 161 ASN n 1 162 SER n 1 163 LYS n 1 164 LYS n 1 165 THR n 1 166 LEU n 1 167 ARG n 1 168 GLU n 1 169 VAL n 1 170 GLY n 1 171 SER n 1 172 VAL n 1 173 LYS n 1 174 ALA n 1 175 LEU n 1 176 MET n 1 177 GLU n 1 178 CYS n 1 179 ALA n 1 180 LEU n 1 181 GLU n 1 182 VAL n 1 183 LYS n 1 184 LYS n 1 185 GLU n 1 186 SER n 1 187 THR n 1 188 LEU n 1 189 LYS n 1 190 SER n 1 191 VAL n 1 192 LEU n 1 193 SER n 1 194 ALA n 1 195 LEU n 1 196 TRP n 1 197 ASN n 1 198 LEU n 1 199 SER n 1 200 ALA n 1 201 HIS n 1 202 CYS n 1 203 THR n 1 204 GLU n 1 205 ASN n 1 206 LYS n 1 207 ALA n 1 208 ASP n 1 209 ILE n 1 210 CYS n 1 211 ALA n 1 212 VAL n 1 213 ASP n 1 214 GLY n 1 215 ALA n 1 216 LEU n 1 217 ALA n 1 218 PHE n 1 219 LEU n 1 220 VAL n 1 221 GLY n 1 222 THR n 1 223 LEU n 1 224 THR n 1 225 TYR n 1 226 ARG n 1 227 SER n 1 228 GLN n 1 229 THR n 1 230 ASN n 1 231 THR n 1 232 LEU n 1 233 ALA n 1 234 ILE n 1 235 ILE n 1 236 GLU n 1 237 SER n 1 238 GLY n 1 239 GLY n 1 240 GLY n 1 241 ILE n 1 242 LEU n 1 243 ARG n 1 244 ASN n 1 245 VAL n 1 246 SER n 1 247 SER n 1 248 LEU n 1 249 ILE n 1 250 ALA n 1 251 THR n 1 252 ASN n 1 253 GLU n 1 254 ASP n 1 255 HIS n 1 256 ARG n 1 257 GLN n 1 258 ILE n 1 259 LEU n 1 260 ARG n 1 261 GLU n 1 262 ASN n 1 263 ASN n 1 264 CYS n 1 265 LEU n 1 266 GLN n 1 267 THR n 1 268 LEU n 1 269 LEU n 1 270 GLN n 1 271 HIS n 1 272 LEU n 1 273 LYS n 1 274 SER n 1 275 HIS n 1 276 SER n 1 277 LEU n 1 278 THR n 1 279 ILE n 1 280 VAL n 1 281 SER n 1 282 ASN n 1 283 ALA n 1 284 CYS n 1 285 GLY n 1 286 THR n 1 287 LEU n 1 288 TRP n 1 289 ASN n 1 290 LEU n 1 291 SER n 1 292 ALA n 1 293 ARG n 1 294 ASN n 1 295 PRO n 1 296 LYS n 1 297 ASP n 1 298 GLN n 1 299 GLU n 1 300 ALA n 1 301 LEU n 1 302 TRP n 1 303 ASP n 1 304 MET n 1 305 GLY n 1 306 ALA n 1 307 VAL n 1 308 SER n 1 309 MET n 1 310 LEU n 1 311 LYS n 1 312 ASN n 1 313 LEU n 1 314 ILE n 1 315 HIS n 1 316 SER n 1 317 LYS n 1 318 HIS n 1 319 LYS n 1 320 MET n 1 321 ILE n 1 322 ALA n 1 323 MET n 1 324 GLY n 1 325 SER n 1 326 ALA n 1 327 ALA n 1 328 ALA n 1 329 LEU n 1 330 ARG n 1 331 ASN n 1 332 LEU n 1 333 MET n 1 334 ALA n 1 335 ASN n 1 336 ARG n 1 337 PRO n 1 338 ALA n 1 339 LYS n 1 340 TYR n 1 341 LYS n 1 342 ASP n 1 343 ALA n 1 344 ASN n 1 345 ILE n 1 346 MET n 1 347 SER n 1 348 PRO n 1 349 GLY n 1 350 SER n 1 351 SER n 1 352 LEU n 1 353 PRO n 1 354 SER n 2 1 ACE n 2 2 GLY n 2 3 GLY n 2 4 GLU n 2 5 ALA n 2 6 LEU n 2 7 ALA n 2 8 ASP n 2 9 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 354 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'APC, DP2.5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 9 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP APC_HUMAN P25054 ? 1 ;LHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMY GLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREV GSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLI ATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAAL RNLMANRPAKYKDANIMSPGSSLPS ; 407 2 PDB 5IZ9 5IZ9 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5IZ9 A 10 ? 354 ? P25054 407 ? 751 ? 407 751 2 2 5IZ9 B 1 ? 9 ? 5IZ9 0 ? 8 ? 0 8 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5IZ9 MET A 1 ? UNP P25054 ? ? 'expression tag' 398 1 1 5IZ9 GLY A 2 ? UNP P25054 ? ? 'expression tag' 399 2 1 5IZ9 HIS A 3 ? UNP P25054 ? ? 'expression tag' 400 3 1 5IZ9 HIS A 4 ? UNP P25054 ? ? 'expression tag' 401 4 1 5IZ9 HIS A 5 ? UNP P25054 ? ? 'expression tag' 402 5 1 5IZ9 HIS A 6 ? UNP P25054 ? ? 'expression tag' 403 6 1 5IZ9 HIS A 7 ? UNP P25054 ? ? 'expression tag' 404 7 1 5IZ9 HIS A 8 ? UNP P25054 ? ? 'expression tag' 405 8 1 5IZ9 MET A 9 ? UNP P25054 ? ? 'expression tag' 406 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IZ9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Ammonium sulfate, 0.1M Tris pH 8.0, 25 % w/v PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5IZ9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.91 _reflns.d_resolution_low 51.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7853 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.45 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.91 _reflns_shell.d_res_low 3.01 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.48 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.605 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5IZ9 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7441 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 51.44 _refine.ls_d_res_high 2.93 _refine.ls_percent_reflns_obs 98.61 _refine.ls_R_factor_obs 0.23568 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23304 _refine.ls_R_factor_R_free 0.28234 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 387 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.939 _refine.correlation_coeff_Fo_to_Fc_free 0.894 _refine.B_iso_mean 79.098 _refine.aniso_B[1][1] 8.78 _refine.aniso_B[2][2] 1.87 _refine.aniso_B[3][3] -10.64 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 3NMW _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.500 _refine.overall_SU_ML 0.421 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 23.027 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2579 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2589 _refine_hist.d_res_high 2.93 _refine_hist.d_res_low 51.44 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.007 0.019 ? 2628 'X-RAY DIFFRACTION' ? r_bond_other_d 0.006 0.020 ? 2575 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.169 1.960 ? 3551 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.112 3.000 ? 5912 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.950 5.000 ? 334 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 41.661 24.685 ? 111 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.780 15.000 ? 484 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.443 15.000 ? 16 'X-RAY DIFFRACTION' ? r_chiral_restr 0.054 0.200 ? 413 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 2978 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.003 0.020 ? 583 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.601 7.796 ? 1345 'X-RAY DIFFRACTION' ? r_mcbond_other 2.602 7.797 ? 1343 'X-RAY DIFFRACTION' ? r_mcangle_it 4.278 11.682 ? 1678 'X-RAY DIFFRACTION' ? r_mcangle_other 4.278 11.682 ? 1678 'X-RAY DIFFRACTION' ? r_scbond_it 2.322 8.159 ? 1283 'X-RAY DIFFRACTION' ? r_scbond_other 2.321 8.159 ? 1284 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 4.037 12.126 ? 1874 'X-RAY DIFFRACTION' ? r_long_range_B_refined 6.669 60.347 ? 2939 'X-RAY DIFFRACTION' ? r_long_range_B_other 6.662 60.358 ? 2939 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.935 _refine_ls_shell.d_res_low 3.011 _refine_ls_shell.number_reflns_R_work 482 _refine_ls_shell.R_factor_R_work 0.335 _refine_ls_shell.percent_reflns_obs 90.89 _refine_ls_shell.R_factor_R_free 0.283 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 5IZ9 _struct.title 'Protein-protein interaction' _struct.pdbx_descriptor 'Adenomatous polyposis coli protein, ACE-GLY-GLY-GLU-ALA-LEU-ALA-ASP-NH2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5IZ9 _struct_keywords.text 'APC, ASEF, Colon CANCER, Drug discovery, PROTEIN BINDING-INHIBITOR complex' _struct_keywords.pdbx_keywords 'PROTEIN BINDING/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 11 ? HIS A 30 ? HIS A 408 HIS A 427 1 ? 20 HELX_P HELX_P2 AA2 GLN A 48 ? SER A 60 ? GLN A 445 SER A 457 1 ? 13 HELX_P HELX_P3 AA3 ASP A 62 ? GLY A 73 ? ASP A 459 GLY A 470 1 ? 12 HELX_P HELX_P4 AA4 GLY A 73 ? GLY A 90 ? GLY A 470 GLY A 487 1 ? 18 HELX_P HELX_P5 AA5 ASP A 94 ? PHE A 113 ? ASP A 491 PHE A 510 1 ? 20 HELX_P HELX_P6 AA6 ASP A 115 ? MET A 125 ? ASP A 512 MET A 522 1 ? 11 HELX_P HELX_P7 AA7 MET A 125 ? GLN A 135 ? MET A 522 GLN A 532 1 ? 11 HELX_P HELX_P8 AA8 LEU A 136 ? SER A 138 ? LEU A 533 SER A 535 5 ? 3 HELX_P HELX_P9 AA9 SER A 140 ? TRP A 156 ? SER A 537 TRP A 553 1 ? 17 HELX_P HELX_P10 AB1 ASP A 159 ? VAL A 169 ? ASP A 556 VAL A 566 1 ? 11 HELX_P HELX_P11 AB2 GLY A 170 ? VAL A 182 ? GLY A 567 VAL A 579 1 ? 13 HELX_P HELX_P12 AB3 LYS A 184 ? ALA A 200 ? LYS A 581 ALA A 597 1 ? 17 HELX_P HELX_P13 AB4 CYS A 202 ? VAL A 212 ? CYS A 599 VAL A 609 1 ? 11 HELX_P HELX_P14 AB5 GLY A 214 ? THR A 224 ? GLY A 611 THR A 621 1 ? 11 HELX_P HELX_P15 AB6 LEU A 232 ? ASN A 252 ? LEU A 629 ASN A 649 1 ? 21 HELX_P HELX_P16 AB7 ASN A 252 ? ASN A 262 ? ASN A 649 ASN A 659 1 ? 11 HELX_P HELX_P17 AB8 ASN A 263 ? LEU A 272 ? ASN A 660 LEU A 669 1 ? 10 HELX_P HELX_P18 AB9 SER A 276 ? SER A 291 ? SER A 673 SER A 688 1 ? 16 HELX_P HELX_P19 AC1 ASN A 294 ? MET A 304 ? ASN A 691 MET A 701 1 ? 11 HELX_P HELX_P20 AC2 GLY A 305 ? ILE A 314 ? GLY A 702 ILE A 711 1 ? 10 HELX_P HELX_P21 AC3 HIS A 318 ? ASN A 335 ? HIS A 715 ASN A 732 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? B ACE 1 C ? ? ? 1_555 B GLY 2 N ? ? B ACE 0 B GLY 1 1_555 ? ? ? ? ? ? ? 1.349 ? covale2 covale both ? B ASP 8 C ? ? ? 1_555 B NH2 9 N ? ? B ASP 7 B NH2 8 1_555 ? ? ? ? ? ? ? 1.418 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 5IZ9 _atom_sites.fract_transf_matrix[1][1] 0.015593 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015490 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011777 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 398 ? ? ? A . n A 1 2 GLY 2 399 ? ? ? A . n A 1 3 HIS 3 400 ? ? ? A . n A 1 4 HIS 4 401 ? ? ? A . n A 1 5 HIS 5 402 ? ? ? A . n A 1 6 HIS 6 403 ? ? ? A . n A 1 7 HIS 7 404 ? ? ? A . n A 1 8 HIS 8 405 ? ? ? A . n A 1 9 MET 9 406 406 MET MET A . n A 1 10 LEU 10 407 407 LEU LEU A . n A 1 11 HIS 11 408 408 HIS HIS A . n A 1 12 LEU 12 409 409 LEU LEU A . n A 1 13 LEU 13 410 410 LEU LEU A . n A 1 14 GLU 14 411 411 GLU GLU A . n A 1 15 GLN 15 412 412 GLN GLN A . n A 1 16 ILE 16 413 413 ILE ILE A . n A 1 17 ARG 17 414 414 ARG ARG A . n A 1 18 ALA 18 415 415 ALA ALA A . n A 1 19 TYR 19 416 416 TYR TYR A . n A 1 20 CYS 20 417 417 CYS CYS A . n A 1 21 GLU 21 418 418 GLU GLU A . n A 1 22 THR 22 419 419 THR THR A . n A 1 23 CYS 23 420 420 CYS CYS A . n A 1 24 TRP 24 421 421 TRP TRP A . n A 1 25 GLU 25 422 422 GLU GLU A . n A 1 26 TRP 26 423 423 TRP TRP A . n A 1 27 GLN 27 424 424 GLN GLN A . n A 1 28 GLU 28 425 425 GLU GLU A . n A 1 29 ALA 29 426 426 ALA ALA A . n A 1 30 HIS 30 427 427 HIS HIS A . n A 1 31 GLU 31 428 428 GLU GLU A . n A 1 32 PRO 32 429 429 PRO PRO A . n A 1 33 GLY 33 430 430 GLY GLY A . n A 1 34 MET 34 431 ? ? ? A . n A 1 35 ASP 35 432 ? ? ? A . n A 1 36 GLN 36 433 ? ? ? A . n A 1 37 ASP 37 434 ? ? ? A . n A 1 38 LYS 38 435 ? ? ? A . n A 1 39 ASN 39 436 436 ASN ASN A . n A 1 40 PRO 40 437 437 PRO PRO A . n A 1 41 MET 41 438 438 MET MET A . n A 1 42 PRO 42 439 439 PRO PRO A . n A 1 43 ALA 43 440 440 ALA ALA A . n A 1 44 PRO 44 441 441 PRO PRO A . n A 1 45 VAL 45 442 442 VAL VAL A . n A 1 46 GLU 46 443 443 GLU GLU A . n A 1 47 HIS 47 444 444 HIS HIS A . n A 1 48 GLN 48 445 445 GLN GLN A . n A 1 49 ILE 49 446 446 ILE ILE A . n A 1 50 CYS 50 447 447 CYS CYS A . n A 1 51 PRO 51 448 448 PRO PRO A . n A 1 52 ALA 52 449 449 ALA ALA A . n A 1 53 VAL 53 450 450 VAL VAL A . n A 1 54 CYS 54 451 451 CYS CYS A . n A 1 55 VAL 55 452 452 VAL VAL A . n A 1 56 LEU 56 453 453 LEU LEU A . n A 1 57 MET 57 454 454 MET MET A . n A 1 58 LYS 58 455 455 LYS LYS A . n A 1 59 LEU 59 456 456 LEU LEU A . n A 1 60 SER 60 457 457 SER SER A . n A 1 61 PHE 61 458 458 PHE PHE A . n A 1 62 ASP 62 459 459 ASP ASP A . n A 1 63 GLU 63 460 460 GLU GLU A . n A 1 64 GLU 64 461 461 GLU GLU A . n A 1 65 HIS 65 462 462 HIS HIS A . n A 1 66 ARG 66 463 463 ARG ARG A . n A 1 67 HIS 67 464 464 HIS HIS A . n A 1 68 ALA 68 465 465 ALA ALA A . n A 1 69 MET 69 466 466 MET MET A . n A 1 70 ASN 70 467 467 ASN ASN A . n A 1 71 GLU 71 468 468 GLU GLU A . n A 1 72 LEU 72 469 469 LEU LEU A . n A 1 73 GLY 73 470 470 GLY GLY A . n A 1 74 GLY 74 471 471 GLY GLY A . n A 1 75 LEU 75 472 472 LEU LEU A . n A 1 76 GLN 76 473 473 GLN GLN A . n A 1 77 ALA 77 474 474 ALA ALA A . n A 1 78 ILE 78 475 475 ILE ILE A . n A 1 79 ALA 79 476 476 ALA ALA A . n A 1 80 GLU 80 477 477 GLU GLU A . n A 1 81 LEU 81 478 478 LEU LEU A . n A 1 82 LEU 82 479 479 LEU LEU A . n A 1 83 GLN 83 480 480 GLN GLN A . n A 1 84 VAL 84 481 481 VAL VAL A . n A 1 85 ASP 85 482 482 ASP ASP A . n A 1 86 CYS 86 483 483 CYS CYS A . n A 1 87 GLU 87 484 484 GLU GLU A . n A 1 88 MET 88 485 485 MET MET A . n A 1 89 TYR 89 486 486 TYR TYR A . n A 1 90 GLY 90 487 487 GLY GLY A . n A 1 91 LEU 91 488 488 LEU LEU A . n A 1 92 THR 92 489 489 THR THR A . n A 1 93 ASN 93 490 490 ASN ASN A . n A 1 94 ASP 94 491 491 ASP ASP A . n A 1 95 HIS 95 492 492 HIS HIS A . n A 1 96 TYR 96 493 493 TYR TYR A . n A 1 97 SER 97 494 494 SER SER A . n A 1 98 ILE 98 495 495 ILE ILE A . n A 1 99 THR 99 496 496 THR THR A . n A 1 100 LEU 100 497 497 LEU LEU A . n A 1 101 ARG 101 498 498 ARG ARG A . n A 1 102 ARG 102 499 499 ARG ARG A . n A 1 103 TYR 103 500 500 TYR TYR A . n A 1 104 ALA 104 501 501 ALA ALA A . n A 1 105 GLY 105 502 502 GLY GLY A . n A 1 106 MET 106 503 503 MET MET A . n A 1 107 ALA 107 504 504 ALA ALA A . n A 1 108 LEU 108 505 505 LEU LEU A . n A 1 109 THR 109 506 506 THR THR A . n A 1 110 ASN 110 507 507 ASN ASN A . n A 1 111 LEU 111 508 508 LEU LEU A . n A 1 112 THR 112 509 509 THR THR A . n A 1 113 PHE 113 510 510 PHE PHE A . n A 1 114 GLY 114 511 511 GLY GLY A . n A 1 115 ASP 115 512 512 ASP ASP A . n A 1 116 VAL 116 513 513 VAL VAL A . n A 1 117 ALA 117 514 514 ALA ALA A . n A 1 118 ASN 118 515 515 ASN ASN A . n A 1 119 LYS 119 516 516 LYS LYS A . n A 1 120 ALA 120 517 517 ALA ALA A . n A 1 121 THR 121 518 518 THR THR A . n A 1 122 LEU 122 519 519 LEU LEU A . n A 1 123 CYS 123 520 520 CYS CYS A . n A 1 124 SER 124 521 521 SER SER A . n A 1 125 MET 125 522 522 MET MET A . n A 1 126 LYS 126 523 523 LYS LYS A . n A 1 127 GLY 127 524 524 GLY GLY A . n A 1 128 CYS 128 525 525 CYS CYS A . n A 1 129 MET 129 526 526 MET MET A . n A 1 130 ARG 130 527 527 ARG ARG A . n A 1 131 ALA 131 528 528 ALA ALA A . n A 1 132 LEU 132 529 529 LEU LEU A . n A 1 133 VAL 133 530 530 VAL VAL A . n A 1 134 ALA 134 531 531 ALA ALA A . n A 1 135 GLN 135 532 532 GLN GLN A . n A 1 136 LEU 136 533 533 LEU LEU A . n A 1 137 LYS 137 534 534 LYS LYS A . n A 1 138 SER 138 535 535 SER SER A . n A 1 139 GLU 139 536 536 GLU GLU A . n A 1 140 SER 140 537 537 SER SER A . n A 1 141 GLU 141 538 538 GLU GLU A . n A 1 142 ASP 142 539 539 ASP ASP A . n A 1 143 LEU 143 540 540 LEU LEU A . n A 1 144 GLN 144 541 541 GLN GLN A . n A 1 145 GLN 145 542 542 GLN GLN A . n A 1 146 VAL 146 543 543 VAL VAL A . n A 1 147 ILE 147 544 544 ILE ILE A . n A 1 148 ALA 148 545 545 ALA ALA A . n A 1 149 SER 149 546 546 SER SER A . n A 1 150 VAL 150 547 547 VAL VAL A . n A 1 151 LEU 151 548 548 LEU LEU A . n A 1 152 ARG 152 549 549 ARG ARG A . n A 1 153 ASN 153 550 550 ASN ASN A . n A 1 154 LEU 154 551 551 LEU LEU A . n A 1 155 SER 155 552 552 SER SER A . n A 1 156 TRP 156 553 553 TRP TRP A . n A 1 157 ARG 157 554 554 ARG ARG A . n A 1 158 ALA 158 555 555 ALA ALA A . n A 1 159 ASP 159 556 556 ASP ASP A . n A 1 160 VAL 160 557 557 VAL VAL A . n A 1 161 ASN 161 558 558 ASN ASN A . n A 1 162 SER 162 559 559 SER SER A . n A 1 163 LYS 163 560 560 LYS LYS A . n A 1 164 LYS 164 561 561 LYS LYS A . n A 1 165 THR 165 562 562 THR THR A . n A 1 166 LEU 166 563 563 LEU LEU A . n A 1 167 ARG 167 564 564 ARG ARG A . n A 1 168 GLU 168 565 565 GLU GLU A . n A 1 169 VAL 169 566 566 VAL VAL A . n A 1 170 GLY 170 567 567 GLY GLY A . n A 1 171 SER 171 568 568 SER SER A . n A 1 172 VAL 172 569 569 VAL VAL A . n A 1 173 LYS 173 570 570 LYS LYS A . n A 1 174 ALA 174 571 571 ALA ALA A . n A 1 175 LEU 175 572 572 LEU LEU A . n A 1 176 MET 176 573 573 MET MET A . n A 1 177 GLU 177 574 574 GLU GLU A . n A 1 178 CYS 178 575 575 CYS CYS A . n A 1 179 ALA 179 576 576 ALA ALA A . n A 1 180 LEU 180 577 577 LEU LEU A . n A 1 181 GLU 181 578 578 GLU GLU A . n A 1 182 VAL 182 579 579 VAL VAL A . n A 1 183 LYS 183 580 580 LYS LYS A . n A 1 184 LYS 184 581 581 LYS LYS A . n A 1 185 GLU 185 582 582 GLU GLU A . n A 1 186 SER 186 583 583 SER SER A . n A 1 187 THR 187 584 584 THR THR A . n A 1 188 LEU 188 585 585 LEU LEU A . n A 1 189 LYS 189 586 586 LYS LYS A . n A 1 190 SER 190 587 587 SER SER A . n A 1 191 VAL 191 588 588 VAL VAL A . n A 1 192 LEU 192 589 589 LEU LEU A . n A 1 193 SER 193 590 590 SER SER A . n A 1 194 ALA 194 591 591 ALA ALA A . n A 1 195 LEU 195 592 592 LEU LEU A . n A 1 196 TRP 196 593 593 TRP TRP A . n A 1 197 ASN 197 594 594 ASN ASN A . n A 1 198 LEU 198 595 595 LEU LEU A . n A 1 199 SER 199 596 596 SER SER A . n A 1 200 ALA 200 597 597 ALA ALA A . n A 1 201 HIS 201 598 598 HIS HIS A . n A 1 202 CYS 202 599 599 CYS CYS A . n A 1 203 THR 203 600 600 THR THR A . n A 1 204 GLU 204 601 601 GLU GLU A . n A 1 205 ASN 205 602 602 ASN ASN A . n A 1 206 LYS 206 603 603 LYS LYS A . n A 1 207 ALA 207 604 604 ALA ALA A . n A 1 208 ASP 208 605 605 ASP ASP A . n A 1 209 ILE 209 606 606 ILE ILE A . n A 1 210 CYS 210 607 607 CYS CYS A . n A 1 211 ALA 211 608 608 ALA ALA A . n A 1 212 VAL 212 609 609 VAL VAL A . n A 1 213 ASP 213 610 610 ASP ASP A . n A 1 214 GLY 214 611 611 GLY GLY A . n A 1 215 ALA 215 612 612 ALA ALA A . n A 1 216 LEU 216 613 613 LEU LEU A . n A 1 217 ALA 217 614 614 ALA ALA A . n A 1 218 PHE 218 615 615 PHE PHE A . n A 1 219 LEU 219 616 616 LEU LEU A . n A 1 220 VAL 220 617 617 VAL VAL A . n A 1 221 GLY 221 618 618 GLY GLY A . n A 1 222 THR 222 619 619 THR THR A . n A 1 223 LEU 223 620 620 LEU LEU A . n A 1 224 THR 224 621 621 THR THR A . n A 1 225 TYR 225 622 622 TYR TYR A . n A 1 226 ARG 226 623 623 ARG ARG A . n A 1 227 SER 227 624 624 SER SER A . n A 1 228 GLN 228 625 625 GLN GLN A . n A 1 229 THR 229 626 626 THR THR A . n A 1 230 ASN 230 627 627 ASN ASN A . n A 1 231 THR 231 628 628 THR THR A . n A 1 232 LEU 232 629 629 LEU LEU A . n A 1 233 ALA 233 630 630 ALA ALA A . n A 1 234 ILE 234 631 631 ILE ILE A . n A 1 235 ILE 235 632 632 ILE ILE A . n A 1 236 GLU 236 633 633 GLU GLU A . n A 1 237 SER 237 634 634 SER SER A . n A 1 238 GLY 238 635 635 GLY GLY A . n A 1 239 GLY 239 636 636 GLY GLY A . n A 1 240 GLY 240 637 637 GLY GLY A . n A 1 241 ILE 241 638 638 ILE ILE A . n A 1 242 LEU 242 639 639 LEU LEU A . n A 1 243 ARG 243 640 640 ARG ARG A . n A 1 244 ASN 244 641 641 ASN ASN A . n A 1 245 VAL 245 642 642 VAL VAL A . n A 1 246 SER 246 643 643 SER SER A . n A 1 247 SER 247 644 644 SER SER A . n A 1 248 LEU 248 645 645 LEU LEU A . n A 1 249 ILE 249 646 646 ILE ILE A . n A 1 250 ALA 250 647 647 ALA ALA A . n A 1 251 THR 251 648 648 THR THR A . n A 1 252 ASN 252 649 649 ASN ASN A . n A 1 253 GLU 253 650 650 GLU GLU A . n A 1 254 ASP 254 651 651 ASP ASP A . n A 1 255 HIS 255 652 652 HIS HIS A . n A 1 256 ARG 256 653 653 ARG ARG A . n A 1 257 GLN 257 654 654 GLN GLN A . n A 1 258 ILE 258 655 655 ILE ILE A . n A 1 259 LEU 259 656 656 LEU LEU A . n A 1 260 ARG 260 657 657 ARG ARG A . n A 1 261 GLU 261 658 658 GLU GLU A . n A 1 262 ASN 262 659 659 ASN ASN A . n A 1 263 ASN 263 660 660 ASN ASN A . n A 1 264 CYS 264 661 661 CYS CYS A . n A 1 265 LEU 265 662 662 LEU LEU A . n A 1 266 GLN 266 663 663 GLN GLN A . n A 1 267 THR 267 664 664 THR THR A . n A 1 268 LEU 268 665 665 LEU LEU A . n A 1 269 LEU 269 666 666 LEU LEU A . n A 1 270 GLN 270 667 667 GLN GLN A . n A 1 271 HIS 271 668 668 HIS HIS A . n A 1 272 LEU 272 669 669 LEU LEU A . n A 1 273 LYS 273 670 670 LYS LYS A . n A 1 274 SER 274 671 671 SER SER A . n A 1 275 HIS 275 672 672 HIS HIS A . n A 1 276 SER 276 673 673 SER SER A . n A 1 277 LEU 277 674 674 LEU LEU A . n A 1 278 THR 278 675 675 THR THR A . n A 1 279 ILE 279 676 676 ILE ILE A . n A 1 280 VAL 280 677 677 VAL VAL A . n A 1 281 SER 281 678 678 SER SER A . n A 1 282 ASN 282 679 679 ASN ASN A . n A 1 283 ALA 283 680 680 ALA ALA A . n A 1 284 CYS 284 681 681 CYS CYS A . n A 1 285 GLY 285 682 682 GLY GLY A . n A 1 286 THR 286 683 683 THR THR A . n A 1 287 LEU 287 684 684 LEU LEU A . n A 1 288 TRP 288 685 685 TRP TRP A . n A 1 289 ASN 289 686 686 ASN ASN A . n A 1 290 LEU 290 687 687 LEU LEU A . n A 1 291 SER 291 688 688 SER SER A . n A 1 292 ALA 292 689 689 ALA ALA A . n A 1 293 ARG 293 690 690 ARG ARG A . n A 1 294 ASN 294 691 691 ASN ASN A . n A 1 295 PRO 295 692 692 PRO PRO A . n A 1 296 LYS 296 693 693 LYS LYS A . n A 1 297 ASP 297 694 694 ASP ASP A . n A 1 298 GLN 298 695 695 GLN GLN A . n A 1 299 GLU 299 696 696 GLU GLU A . n A 1 300 ALA 300 697 697 ALA ALA A . n A 1 301 LEU 301 698 698 LEU LEU A . n A 1 302 TRP 302 699 699 TRP TRP A . n A 1 303 ASP 303 700 700 ASP ASP A . n A 1 304 MET 304 701 701 MET MET A . n A 1 305 GLY 305 702 702 GLY GLY A . n A 1 306 ALA 306 703 703 ALA ALA A . n A 1 307 VAL 307 704 704 VAL VAL A . n A 1 308 SER 308 705 705 SER SER A . n A 1 309 MET 309 706 706 MET MET A . n A 1 310 LEU 310 707 707 LEU LEU A . n A 1 311 LYS 311 708 708 LYS LYS A . n A 1 312 ASN 312 709 709 ASN ASN A . n A 1 313 LEU 313 710 710 LEU LEU A . n A 1 314 ILE 314 711 711 ILE ILE A . n A 1 315 HIS 315 712 712 HIS HIS A . n A 1 316 SER 316 713 713 SER SER A . n A 1 317 LYS 317 714 714 LYS LYS A . n A 1 318 HIS 318 715 715 HIS HIS A . n A 1 319 LYS 319 716 716 LYS LYS A . n A 1 320 MET 320 717 717 MET MET A . n A 1 321 ILE 321 718 718 ILE ILE A . n A 1 322 ALA 322 719 719 ALA ALA A . n A 1 323 MET 323 720 720 MET MET A . n A 1 324 GLY 324 721 721 GLY GLY A . n A 1 325 SER 325 722 722 SER SER A . n A 1 326 ALA 326 723 723 ALA ALA A . n A 1 327 ALA 327 724 724 ALA ALA A . n A 1 328 ALA 328 725 725 ALA ALA A . n A 1 329 LEU 329 726 726 LEU LEU A . n A 1 330 ARG 330 727 727 ARG ARG A . n A 1 331 ASN 331 728 728 ASN ASN A . n A 1 332 LEU 332 729 729 LEU LEU A . n A 1 333 MET 333 730 730 MET MET A . n A 1 334 ALA 334 731 731 ALA ALA A . n A 1 335 ASN 335 732 732 ASN ASN A . n A 1 336 ARG 336 733 733 ARG ARG A . n A 1 337 PRO 337 734 734 PRO PRO A . n A 1 338 ALA 338 735 735 ALA ALA A . n A 1 339 LYS 339 736 736 LYS LYS A . n A 1 340 TYR 340 737 737 TYR TYR A . n A 1 341 LYS 341 738 738 LYS LYS A . n A 1 342 ASP 342 739 ? ? ? A . n A 1 343 ALA 343 740 ? ? ? A . n A 1 344 ASN 344 741 ? ? ? A . n A 1 345 ILE 345 742 ? ? ? A . n A 1 346 MET 346 743 ? ? ? A . n A 1 347 SER 347 744 ? ? ? A . n A 1 348 PRO 348 745 ? ? ? A . n A 1 349 GLY 349 746 ? ? ? A . n A 1 350 SER 350 747 ? ? ? A . n A 1 351 SER 351 748 ? ? ? A . n A 1 352 LEU 352 749 ? ? ? A . n A 1 353 PRO 353 750 ? ? ? A . n A 1 354 SER 354 751 ? ? ? A . n B 2 1 ACE 1 0 0 ACE ACE B . n B 2 2 GLY 2 1 1 GLY GLY B . n B 2 3 GLY 3 2 2 GLY GLY B . n B 2 4 GLU 4 3 3 GLU GLU B . n B 2 5 ALA 5 4 4 ALA ALA B . n B 2 6 LEU 6 5 5 LEU LEU B . n B 2 7 ALA 7 6 6 ALA ALA B . n B 2 8 ASP 8 7 7 ASP ASP B . n B 2 9 NH2 9 8 8 NH2 NH2 B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 801 8 HOH HOH A . C 3 HOH 2 802 10 HOH HOH A . C 3 HOH 3 803 7 HOH HOH A . C 3 HOH 4 804 3 HOH HOH A . C 3 HOH 5 805 1 HOH HOH A . C 3 HOH 6 806 4 HOH HOH A . C 3 HOH 7 807 6 HOH HOH A . C 3 HOH 8 808 5 HOH HOH A . C 3 HOH 9 809 2 HOH HOH A . D 3 HOH 1 101 9 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1400 ? 1 MORE -7 ? 1 'SSA (A^2)' 15750 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-05 2 'Structure model' 1 1 2019-01-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 GLY _pdbx_validate_rmsd_angle.auth_seq_id_1 1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 GLY _pdbx_validate_rmsd_angle.auth_seq_id_2 1 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 GLY _pdbx_validate_rmsd_angle.auth_seq_id_3 1 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 83.27 _pdbx_validate_rmsd_angle.angle_target_value 113.10 _pdbx_validate_rmsd_angle.angle_deviation -29.83 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 427 ? ? -115.11 60.17 2 1 PRO A 429 ? ? -64.92 98.88 3 1 ARG A 690 ? ? 70.97 -10.82 4 1 HIS A 712 ? ? -106.34 54.36 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 398 ? A MET 1 2 1 Y 1 A GLY 399 ? A GLY 2 3 1 Y 1 A HIS 400 ? A HIS 3 4 1 Y 1 A HIS 401 ? A HIS 4 5 1 Y 1 A HIS 402 ? A HIS 5 6 1 Y 1 A HIS 403 ? A HIS 6 7 1 Y 1 A HIS 404 ? A HIS 7 8 1 Y 1 A HIS 405 ? A HIS 8 9 1 Y 1 A MET 431 ? A MET 34 10 1 Y 1 A ASP 432 ? A ASP 35 11 1 Y 1 A GLN 433 ? A GLN 36 12 1 Y 1 A ASP 434 ? A ASP 37 13 1 Y 1 A LYS 435 ? A LYS 38 14 1 Y 1 A ASP 739 ? A ASP 342 15 1 Y 1 A ALA 740 ? A ALA 343 16 1 Y 1 A ASN 741 ? A ASN 344 17 1 Y 1 A ILE 742 ? A ILE 345 18 1 Y 1 A MET 743 ? A MET 346 19 1 Y 1 A SER 744 ? A SER 347 20 1 Y 1 A PRO 745 ? A PRO 348 21 1 Y 1 A GLY 746 ? A GLY 349 22 1 Y 1 A SER 747 ? A SER 350 23 1 Y 1 A SER 748 ? A SER 351 24 1 Y 1 A LEU 749 ? A LEU 352 25 1 Y 1 A PRO 750 ? A PRO 353 26 1 Y 1 A SER 751 ? A SER 354 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #