data_5IZF # _entry.id 5IZF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5IZF WWPDB D_1000219708 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IZF _pdbx_database_status.recvd_initial_deposition_date 2016-03-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pflug, A.' 1 'Enkvist, E.' 2 'Uri, A.' 3 'Engh, R.A.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioconjug.Chem. _citation.journal_id_ASTM BCCHES _citation.journal_id_CSD 2063 _citation.journal_id_ISSN 1043-1802 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 1900 _citation.page_last 1910 _citation.title 'Bifunctional Ligands for Inhibition of Tight-Binding Protein-Protein Interactions.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.bioconjchem.6b00293 _citation.pdbx_database_id_PubMed 27389935 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ivan, T.' 1 primary 'Enkvist, E.' 2 primary 'Viira, B.' 3 primary 'Manoharan, G.B.' 4 primary 'Raidaru, G.' 5 primary 'Pflug, A.' 6 primary 'Alam, K.A.' 7 primary 'Zaccolo, M.' 8 primary 'Engh, R.A.' 9 primary 'Uri, A.' 10 # _cell.entry_id 5IZF _cell.length_a 129.150 _cell.length_b 129.150 _cell.length_c 89.860 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IZF _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cAMP-dependent protein kinase catalytic subunit alpha' 40808.570 1 2.7.11.11 ? ? ? 2 polymer syn 6J9-ZEU-DAR-ACA-DAR-NH2 799.003 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 4 water nat water 18.015 44 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PKA C-alpha' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGY PPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFI PKFKGPGDTSNFDDYEEEEIRV(SEP)INEKCGKEFSEF ; ;MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK GPGDTSNFDDYEEEEIRVSINEKCGKEFSEF ; A ? 2 'polypeptide(D)' no yes '(6J9)(AZ1)(DAR)(ACA)(DAR)(NH2)' XXRXRX E ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 ALA n 1 8 LYS n 1 9 LYS n 1 10 GLY n 1 11 SER n 1 12 GLU n 1 13 GLN n 1 14 GLU n 1 15 SER n 1 16 VAL n 1 17 LYS n 1 18 GLU n 1 19 PHE n 1 20 LEU n 1 21 ALA n 1 22 LYS n 1 23 ALA n 1 24 LYS n 1 25 GLU n 1 26 ASP n 1 27 PHE n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 TRP n 1 32 GLU n 1 33 SER n 1 34 PRO n 1 35 ALA n 1 36 GLN n 1 37 ASN n 1 38 THR n 1 39 ALA n 1 40 HIS n 1 41 LEU n 1 42 ASP n 1 43 GLN n 1 44 PHE n 1 45 GLU n 1 46 ARG n 1 47 ILE n 1 48 LYS n 1 49 THR n 1 50 LEU n 1 51 GLY n 1 52 THR n 1 53 GLY n 1 54 SER n 1 55 PHE n 1 56 GLY n 1 57 ARG n 1 58 VAL n 1 59 MET n 1 60 LEU n 1 61 VAL n 1 62 LYS n 1 63 HIS n 1 64 LYS n 1 65 GLU n 1 66 THR n 1 67 GLY n 1 68 ASN n 1 69 HIS n 1 70 TYR n 1 71 ALA n 1 72 MET n 1 73 LYS n 1 74 ILE n 1 75 LEU n 1 76 ASP n 1 77 LYS n 1 78 GLN n 1 79 LYS n 1 80 VAL n 1 81 VAL n 1 82 LYS n 1 83 LEU n 1 84 LYS n 1 85 GLN n 1 86 ILE n 1 87 GLU n 1 88 HIS n 1 89 THR n 1 90 LEU n 1 91 ASN n 1 92 GLU n 1 93 LYS n 1 94 ARG n 1 95 ILE n 1 96 LEU n 1 97 GLN n 1 98 ALA n 1 99 VAL n 1 100 ASN n 1 101 PHE n 1 102 PRO n 1 103 PHE n 1 104 LEU n 1 105 VAL n 1 106 LYS n 1 107 LEU n 1 108 GLU n 1 109 PHE n 1 110 SER n 1 111 PHE n 1 112 LYS n 1 113 ASP n 1 114 ASN n 1 115 SER n 1 116 ASN n 1 117 LEU n 1 118 TYR n 1 119 MET n 1 120 VAL n 1 121 MET n 1 122 GLU n 1 123 TYR n 1 124 VAL n 1 125 PRO n 1 126 GLY n 1 127 GLY n 1 128 GLU n 1 129 MET n 1 130 PHE n 1 131 SER n 1 132 HIS n 1 133 LEU n 1 134 ARG n 1 135 ARG n 1 136 ILE n 1 137 GLY n 1 138 ARG n 1 139 PHE n 1 140 SER n 1 141 GLU n 1 142 PRO n 1 143 HIS n 1 144 ALA n 1 145 ARG n 1 146 PHE n 1 147 TYR n 1 148 ALA n 1 149 ALA n 1 150 GLN n 1 151 ILE n 1 152 VAL n 1 153 LEU n 1 154 THR n 1 155 PHE n 1 156 GLU n 1 157 TYR n 1 158 LEU n 1 159 HIS n 1 160 SER n 1 161 LEU n 1 162 ASP n 1 163 LEU n 1 164 ILE n 1 165 TYR n 1 166 ARG n 1 167 ASP n 1 168 LEU n 1 169 LYS n 1 170 PRO n 1 171 GLU n 1 172 ASN n 1 173 LEU n 1 174 LEU n 1 175 ILE n 1 176 ASP n 1 177 GLN n 1 178 GLN n 1 179 GLY n 1 180 TYR n 1 181 ILE n 1 182 GLN n 1 183 VAL n 1 184 THR n 1 185 ASP n 1 186 PHE n 1 187 GLY n 1 188 PHE n 1 189 ALA n 1 190 LYS n 1 191 ARG n 1 192 VAL n 1 193 LYS n 1 194 GLY n 1 195 ARG n 1 196 THR n 1 197 TRP n 1 198 TPO n 1 199 LEU n 1 200 CYS n 1 201 GLY n 1 202 THR n 1 203 PRO n 1 204 GLU n 1 205 TYR n 1 206 LEU n 1 207 ALA n 1 208 PRO n 1 209 GLU n 1 210 ILE n 1 211 ILE n 1 212 LEU n 1 213 SER n 1 214 LYS n 1 215 GLY n 1 216 TYR n 1 217 ASN n 1 218 LYS n 1 219 ALA n 1 220 VAL n 1 221 ASP n 1 222 TRP n 1 223 TRP n 1 224 ALA n 1 225 LEU n 1 226 GLY n 1 227 VAL n 1 228 LEU n 1 229 ILE n 1 230 TYR n 1 231 GLU n 1 232 MET n 1 233 ALA n 1 234 ALA n 1 235 GLY n 1 236 TYR n 1 237 PRO n 1 238 PRO n 1 239 PHE n 1 240 PHE n 1 241 ALA n 1 242 ASP n 1 243 GLN n 1 244 PRO n 1 245 ILE n 1 246 GLN n 1 247 ILE n 1 248 TYR n 1 249 GLU n 1 250 LYS n 1 251 ILE n 1 252 VAL n 1 253 SER n 1 254 GLY n 1 255 LYS n 1 256 VAL n 1 257 ARG n 1 258 PHE n 1 259 PRO n 1 260 SER n 1 261 HIS n 1 262 PHE n 1 263 SER n 1 264 SER n 1 265 ASP n 1 266 LEU n 1 267 LYS n 1 268 ASP n 1 269 LEU n 1 270 LEU n 1 271 ARG n 1 272 ASN n 1 273 LEU n 1 274 LEU n 1 275 GLN n 1 276 VAL n 1 277 ASP n 1 278 LEU n 1 279 THR n 1 280 LYS n 1 281 ARG n 1 282 PHE n 1 283 GLY n 1 284 ASN n 1 285 LEU n 1 286 LYS n 1 287 ASN n 1 288 GLY n 1 289 VAL n 1 290 ASN n 1 291 ASP n 1 292 ILE n 1 293 LYS n 1 294 ASN n 1 295 HIS n 1 296 LYS n 1 297 TRP n 1 298 PHE n 1 299 ALA n 1 300 THR n 1 301 THR n 1 302 ASP n 1 303 TRP n 1 304 ILE n 1 305 ALA n 1 306 ILE n 1 307 TYR n 1 308 GLN n 1 309 ARG n 1 310 LYS n 1 311 VAL n 1 312 GLU n 1 313 ALA n 1 314 PRO n 1 315 PHE n 1 316 ILE n 1 317 PRO n 1 318 LYS n 1 319 PHE n 1 320 LYS n 1 321 GLY n 1 322 PRO n 1 323 GLY n 1 324 ASP n 1 325 THR n 1 326 SER n 1 327 ASN n 1 328 PHE n 1 329 ASP n 1 330 ASP n 1 331 TYR n 1 332 GLU n 1 333 GLU n 1 334 GLU n 1 335 GLU n 1 336 ILE n 1 337 ARG n 1 338 VAL n 1 339 SEP n 1 340 ILE n 1 341 ASN n 1 342 GLU n 1 343 LYS n 1 344 CYS n 1 345 GLY n 1 346 LYS n 1 347 GLU n 1 348 PHE n 1 349 SER n 1 350 GLU n 1 351 PHE n 2 1 6J9 n 2 2 AZ1 n 2 3 DAR n 2 4 ACA n 2 5 DAR n 2 6 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 351 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PRKACA, PKACA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 6 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KAPCA_HUMAN P17612 ? 1 ;MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK GPGDTSNFDDYEEEEIRVSINEKCGKEFSEF ; 1 2 PDB 5IZF 5IZF ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5IZF A 1 ? 351 ? P17612 1 ? 351 ? 0 350 2 2 5IZF E 1 ? 6 ? 5IZF 1 ? 6 ? 1 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6J9 non-polymer . '4-(piperazin-1-yl)-7H-pyrrolo[2,3-d]pyrimidine' ? 'C10 H13 N5' 203.244 ACA 'peptide linking' . '6-AMINOHEXANOIC ACID' 'AMINOCAPROIC ACID' 'C6 H13 N O2' 131.173 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 AZ1 non-polymer . 'AZELAIC ACID' ? 'C9 H16 O4' 188.221 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DAR 'D-peptide linking' . D-ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IZF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M BisTris pH7.0, 0.2M amminium sulfate, 20%-24% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-06-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95373 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95373 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5IZF _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.100 _reflns.number_obs 26024 _reflns.number_all ? _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs 0.08100 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.6000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 13.50 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.15 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs 1.68800 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5IZF _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 24712 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 98.9 _refine.ls_R_factor_obs 0.232 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.230 _refine.ls_R_factor_R_free 0.270 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 1311 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.944 _refine.B_iso_mean 63.48 _refine.aniso_B[1][1] 2.18000 _refine.aniso_B[2][2] 2.18000 _refine.aniso_B[3][3] -7.07000 _refine.aniso_B[1][2] 1.09000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT ; _refine.pdbx_starting_model 1CDK _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.233 _refine.pdbx_overall_ESU_R_Free 0.198 _refine.overall_SU_ML 0.194 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 16.703 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2851 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 44 _refine_hist.number_atoms_total 2915 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.008 0.019 ? 2941 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.258 1.984 ? 3966 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.071 5.000 ? 336 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.834 24.043 ? 141 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.296 15.000 ? 516 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.668 15.000 ? 15 'X-RAY DIFFRACTION' ? r_chiral_restr 0.088 0.200 ? 411 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.021 ? 2216 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.221 5.070 ? 1358 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.122 7.590 ? 1690 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.358 5.272 ? 1583 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined 5.138 41.765 ? 4197 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.16 _refine_ls_shell.number_reflns_R_work 1773 _refine_ls_shell.R_factor_R_work 0.4110 _refine_ls_shell.percent_reflns_obs 97.92 _refine_ls_shell.R_factor_R_free 0.3840 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 107 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5IZF _struct.title 'Complex of PKA with the bisubstrate protein kinase inhibitor ARC-1408' _struct.pdbx_descriptor 'cAMP-dependent protein kinase catalytic subunit alpha (E.C.2.7.11.11), 6J9-ZEU-DAR-ACA-DAR-NH2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IZF _struct_keywords.text 'protein kinase, inhibitor, bisubstrate, oligoarginine, PKA, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 15 ? SER A 33 ? SER A 14 SER A 32 1 ? 19 HELX_P HELX_P2 AA2 HIS A 40 ? ASP A 42 ? HIS A 39 ASP A 41 5 ? 3 HELX_P HELX_P3 AA3 LYS A 77 ? LEU A 83 ? LYS A 76 LEU A 82 1 ? 7 HELX_P HELX_P4 AA4 GLN A 85 ? VAL A 99 ? GLN A 84 VAL A 98 1 ? 15 HELX_P HELX_P5 AA5 GLU A 128 ? GLY A 137 ? GLU A 127 GLY A 136 1 ? 10 HELX_P HELX_P6 AA6 SER A 140 ? LEU A 161 ? SER A 139 LEU A 160 1 ? 22 HELX_P HELX_P7 AA7 LYS A 169 ? GLU A 171 ? LYS A 168 GLU A 170 5 ? 3 HELX_P HELX_P8 AA8 THR A 202 ? LEU A 206 ? THR A 201 LEU A 205 5 ? 5 HELX_P HELX_P9 AA9 ALA A 207 ? LEU A 212 ? ALA A 206 LEU A 211 1 ? 6 HELX_P HELX_P10 AB1 LYS A 218 ? GLY A 235 ? LYS A 217 GLY A 234 1 ? 18 HELX_P HELX_P11 AB2 GLN A 243 ? GLY A 254 ? GLN A 242 GLY A 253 1 ? 12 HELX_P HELX_P12 AB3 SER A 263 ? LEU A 274 ? SER A 262 LEU A 273 1 ? 12 HELX_P HELX_P13 AB4 VAL A 289 ? ASN A 294 ? VAL A 288 ASN A 293 1 ? 6 HELX_P HELX_P14 AB5 HIS A 295 ? ALA A 299 ? HIS A 294 ALA A 298 5 ? 5 HELX_P HELX_P15 AB6 ASP A 302 ? GLN A 308 ? ASP A 301 GLN A 307 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? D SO4 . S ? ? ? 1_555 D SO4 . S ? ? A SO4 402 A SO4 402 9_555 ? ? ? ? ? ? ? 1.874 ? covale1 covale both ? A TRP 197 C ? ? ? 1_555 A TPO 198 N ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.338 ? covale2 covale both ? A TPO 198 C ? ? ? 1_555 A LEU 199 N ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.331 ? covale3 covale both ? A VAL 338 C ? ? ? 1_555 A SEP 339 N ? ? A VAL 337 A SEP 338 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale both ? A SEP 339 C ? ? ? 1_555 A ILE 340 N ? ? A SEP 338 A ILE 339 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale none ? B 6J9 1 N1 ? ? ? 1_555 B AZ1 2 C9 ? ? E 6J9 1 E AZ1 2 1_555 ? ? ? ? ? ? ? 1.355 ? covale6 covale one ? B AZ1 2 C1 ? ? ? 1_555 B DAR 3 N ? ? E AZ1 2 E DAR 3 1_555 ? ? ? ? ? ? ? 1.342 ? covale7 covale both ? B DAR 3 C ? ? ? 1_555 B ACA 4 N6 ? ? E DAR 3 E ACA 4 1_555 ? ? ? ? ? ? ? 1.338 ? covale8 covale both ? B ACA 4 C1 ? ? ? 1_555 B DAR 5 N ? ? E ACA 4 E DAR 5 1_555 ? ? ? ? ? ? ? 1.338 ? covale9 covale both ? B DAR 5 C ? ? ? 1_555 B NH2 6 N ? ? E DAR 5 E NH2 6 1_555 ? ? ? ? ? ? ? 1.422 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 44 ? THR A 52 ? PHE A 43 THR A 51 AA1 2 GLY A 56 ? HIS A 63 ? GLY A 55 HIS A 62 AA1 3 HIS A 69 ? ASP A 76 ? HIS A 68 ASP A 75 AA1 4 ASN A 116 ? GLU A 122 ? ASN A 115 GLU A 121 AA1 5 LEU A 107 ? LYS A 112 ? LEU A 106 LYS A 111 AA2 1 LEU A 163 ? ILE A 164 ? LEU A 162 ILE A 163 AA2 2 LYS A 190 ? ARG A 191 ? LYS A 189 ARG A 190 AA3 1 LEU A 173 ? ILE A 175 ? LEU A 172 ILE A 174 AA3 2 ILE A 181 ? VAL A 183 ? ILE A 180 VAL A 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 45 ? N GLU A 44 O LYS A 62 ? O LYS A 61 AA1 2 3 N ARG A 57 ? N ARG A 56 O ILE A 74 ? O ILE A 73 AA1 3 4 N LYS A 73 ? N LYS A 72 O MET A 119 ? O MET A 118 AA1 4 5 O VAL A 120 ? O VAL A 119 N PHE A 109 ? N PHE A 108 AA2 1 2 N ILE A 164 ? N ILE A 163 O LYS A 190 ? O LYS A 189 AA3 1 2 N LEU A 174 ? N LEU A 173 O GLN A 182 ? O GLN A 181 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 401 ? 5 'binding site for residue SO4 A 401' AC2 Software A SO4 402 ? 4 'binding site for residue SO4 A 402' AC3 Software A SO4 403 ? 3 'binding site for residue SO4 A 403' AC4 Software A SO4 404 ? 2 'binding site for residue SO4 A 404' AC5 Software E 6J9 1 ? 16 'binding site for residues 6J9 E 1 and AZ1 E 2' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 PHE A 258 ? PHE A 257 . ? 1_555 ? 2 AC1 5 LYS A 267 ? LYS A 266 . ? 1_555 ? 3 AC1 5 LYS A 267 ? LYS A 266 . ? 9_554 ? 4 AC1 5 ARG A 271 ? ARG A 270 . ? 1_555 ? 5 AC1 5 ARG A 271 ? ARG A 270 . ? 9_554 ? 6 AC2 4 TRP A 31 ? TRP A 30 . ? 1_555 ? 7 AC2 4 TRP A 31 ? TRP A 30 . ? 9_555 ? 8 AC2 4 ARG A 94 ? ARG A 93 . ? 1_555 ? 9 AC2 4 ARG A 94 ? ARG A 93 . ? 9_555 ? 10 AC3 3 PRO A 259 ? PRO A 258 . ? 1_555 ? 11 AC3 3 SER A 260 ? SER A 259 . ? 1_555 ? 12 AC3 3 HIS A 261 ? HIS A 260 . ? 1_555 ? 13 AC4 2 ILE A 304 ? ILE A 303 . ? 1_555 ? 14 AC4 2 TYR A 307 ? TYR A 306 . ? 1_555 ? 15 AC5 16 GLY A 51 ? GLY A 50 . ? 1_555 ? 16 AC5 16 THR A 52 ? THR A 51 . ? 1_555 ? 17 AC5 16 GLY A 53 ? GLY A 52 . ? 1_555 ? 18 AC5 16 SER A 54 ? SER A 53 . ? 1_555 ? 19 AC5 16 PHE A 55 ? PHE A 54 . ? 1_555 ? 20 AC5 16 GLY A 56 ? GLY A 55 . ? 1_555 ? 21 AC5 16 ALA A 71 ? ALA A 70 . ? 1_555 ? 22 AC5 16 GLU A 122 ? GLU A 121 . ? 1_555 ? 23 AC5 16 TYR A 123 ? TYR A 122 . ? 1_555 ? 24 AC5 16 VAL A 124 ? VAL A 123 . ? 1_555 ? 25 AC5 16 GLU A 128 ? GLU A 127 . ? 1_555 ? 26 AC5 16 LEU A 174 ? LEU A 173 . ? 1_555 ? 27 AC5 16 THR A 184 ? THR A 183 . ? 1_555 ? 28 AC5 16 PHE A 328 ? PHE A 327 . ? 1_555 ? 29 AC5 16 DAR B 3 ? DAR E 3 . ? 1_555 ? 30 AC5 16 ACA B 4 ? ACA E 4 . ? 1_555 ? # _atom_sites.entry_id 5IZF _atom_sites.fract_transf_matrix[1][1] 0.007743 _atom_sites.fract_transf_matrix[1][2] 0.004470 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008941 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011128 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 ? ? ? A . n A 1 3 ASN 3 2 ? ? ? A . n A 1 4 ALA 4 3 ? ? ? A . n A 1 5 ALA 5 4 ? ? ? A . n A 1 6 ALA 6 5 ? ? ? A . n A 1 7 ALA 7 6 ? ? ? A . n A 1 8 LYS 8 7 ? ? ? A . n A 1 9 LYS 9 8 ? ? ? A . n A 1 10 GLY 10 9 ? ? ? A . n A 1 11 SER 11 10 ? ? ? A . n A 1 12 GLU 12 11 ? ? ? A . n A 1 13 GLN 13 12 ? ? ? A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 PHE 19 18 18 PHE PHE A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 GLU 25 24 24 GLU GLU A . n A 1 26 ASP 26 25 25 ASP ASP A . n A 1 27 PHE 27 26 26 PHE PHE A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 TRP 31 30 30 TRP TRP A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 SER 33 32 32 SER SER A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 GLN 36 35 35 GLN GLN A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 THR 38 37 37 THR THR A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 HIS 40 39 39 HIS HIS A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 ASP 42 41 41 ASP ASP A . n A 1 43 GLN 43 42 42 GLN GLN A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 THR 49 48 48 THR THR A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 SER 54 53 53 SER SER A . n A 1 55 PHE 55 54 54 PHE PHE A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 ARG 57 56 56 ARG ARG A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 MET 59 58 58 MET MET A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 VAL 61 60 60 VAL VAL A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 HIS 63 62 62 HIS HIS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 THR 66 65 65 THR THR A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 ASN 68 67 67 ASN ASN A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 TYR 70 69 69 TYR TYR A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 MET 72 71 71 MET MET A . n A 1 73 LYS 73 72 72 LYS LYS A . n A 1 74 ILE 74 73 73 ILE ILE A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 ASP 76 75 75 ASP ASP A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 GLN 78 77 77 GLN GLN A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 VAL 81 80 80 VAL VAL A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 LYS 84 83 83 LYS LYS A . n A 1 85 GLN 85 84 84 GLN GLN A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 HIS 88 87 87 HIS HIS A . n A 1 89 THR 89 88 88 THR THR A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ASN 91 90 90 ASN ASN A . n A 1 92 GLU 92 91 91 GLU GLU A . n A 1 93 LYS 93 92 92 LYS LYS A . n A 1 94 ARG 94 93 93 ARG ARG A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 LEU 96 95 95 LEU LEU A . n A 1 97 GLN 97 96 96 GLN GLN A . n A 1 98 ALA 98 97 97 ALA ALA A . n A 1 99 VAL 99 98 98 VAL VAL A . n A 1 100 ASN 100 99 99 ASN ASN A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 PRO 102 101 101 PRO PRO A . n A 1 103 PHE 103 102 102 PHE PHE A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 LYS 106 105 105 LYS LYS A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 PHE 109 108 108 PHE PHE A . n A 1 110 SER 110 109 109 SER SER A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 LYS 112 111 111 LYS LYS A . n A 1 113 ASP 113 112 112 ASP ASP A . n A 1 114 ASN 114 113 113 ASN ASN A . n A 1 115 SER 115 114 114 SER SER A . n A 1 116 ASN 116 115 115 ASN ASN A . n A 1 117 LEU 117 116 116 LEU LEU A . n A 1 118 TYR 118 117 117 TYR TYR A . n A 1 119 MET 119 118 118 MET MET A . n A 1 120 VAL 120 119 119 VAL VAL A . n A 1 121 MET 121 120 120 MET MET A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 TYR 123 122 122 TYR TYR A . n A 1 124 VAL 124 123 123 VAL VAL A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 GLY 126 125 125 GLY GLY A . n A 1 127 GLY 127 126 126 GLY GLY A . n A 1 128 GLU 128 127 127 GLU GLU A . n A 1 129 MET 129 128 128 MET MET A . n A 1 130 PHE 130 129 129 PHE PHE A . n A 1 131 SER 131 130 130 SER SER A . n A 1 132 HIS 132 131 131 HIS HIS A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 ARG 134 133 133 ARG ARG A . n A 1 135 ARG 135 134 134 ARG ARG A . n A 1 136 ILE 136 135 135 ILE ILE A . n A 1 137 GLY 137 136 136 GLY GLY A . n A 1 138 ARG 138 137 137 ARG ARG A . n A 1 139 PHE 139 138 138 PHE PHE A . n A 1 140 SER 140 139 139 SER SER A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 PRO 142 141 141 PRO PRO A . n A 1 143 HIS 143 142 142 HIS HIS A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ARG 145 144 144 ARG ARG A . n A 1 146 PHE 146 145 145 PHE PHE A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 ALA 148 147 147 ALA ALA A . n A 1 149 ALA 149 148 148 ALA ALA A . n A 1 150 GLN 150 149 149 GLN GLN A . n A 1 151 ILE 151 150 150 ILE ILE A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 THR 154 153 153 THR THR A . n A 1 155 PHE 155 154 154 PHE PHE A . n A 1 156 GLU 156 155 155 GLU GLU A . n A 1 157 TYR 157 156 156 TYR TYR A . n A 1 158 LEU 158 157 157 LEU LEU A . n A 1 159 HIS 159 158 158 HIS HIS A . n A 1 160 SER 160 159 159 SER SER A . n A 1 161 LEU 161 160 160 LEU LEU A . n A 1 162 ASP 162 161 161 ASP ASP A . n A 1 163 LEU 163 162 162 LEU LEU A . n A 1 164 ILE 164 163 163 ILE ILE A . n A 1 165 TYR 165 164 164 TYR TYR A . n A 1 166 ARG 166 165 165 ARG ARG A . n A 1 167 ASP 167 166 166 ASP ASP A . n A 1 168 LEU 168 167 167 LEU LEU A . n A 1 169 LYS 169 168 168 LYS LYS A . n A 1 170 PRO 170 169 169 PRO PRO A . n A 1 171 GLU 171 170 170 GLU GLU A . n A 1 172 ASN 172 171 171 ASN ASN A . n A 1 173 LEU 173 172 172 LEU LEU A . n A 1 174 LEU 174 173 173 LEU LEU A . n A 1 175 ILE 175 174 174 ILE ILE A . n A 1 176 ASP 176 175 175 ASP ASP A . n A 1 177 GLN 177 176 176 GLN GLN A . n A 1 178 GLN 178 177 177 GLN GLN A . n A 1 179 GLY 179 178 178 GLY GLY A . n A 1 180 TYR 180 179 179 TYR TYR A . n A 1 181 ILE 181 180 180 ILE ILE A . n A 1 182 GLN 182 181 181 GLN GLN A . n A 1 183 VAL 183 182 182 VAL VAL A . n A 1 184 THR 184 183 183 THR THR A . n A 1 185 ASP 185 184 184 ASP ASP A . n A 1 186 PHE 186 185 185 PHE PHE A . n A 1 187 GLY 187 186 186 GLY GLY A . n A 1 188 PHE 188 187 187 PHE PHE A . n A 1 189 ALA 189 188 188 ALA ALA A . n A 1 190 LYS 190 189 189 LYS LYS A . n A 1 191 ARG 191 190 190 ARG ARG A . n A 1 192 VAL 192 191 191 VAL VAL A . n A 1 193 LYS 193 192 192 LYS LYS A . n A 1 194 GLY 194 193 193 GLY GLY A . n A 1 195 ARG 195 194 194 ARG ARG A . n A 1 196 THR 196 195 195 THR THR A . n A 1 197 TRP 197 196 196 TRP TRP A . n A 1 198 TPO 198 197 197 TPO TPO A . n A 1 199 LEU 199 198 198 LEU LEU A . n A 1 200 CYS 200 199 199 CYS CYS A . n A 1 201 GLY 201 200 200 GLY GLY A . n A 1 202 THR 202 201 201 THR THR A . n A 1 203 PRO 203 202 202 PRO PRO A . n A 1 204 GLU 204 203 203 GLU GLU A . n A 1 205 TYR 205 204 204 TYR TYR A . n A 1 206 LEU 206 205 205 LEU LEU A . n A 1 207 ALA 207 206 206 ALA ALA A . n A 1 208 PRO 208 207 207 PRO PRO A . n A 1 209 GLU 209 208 208 GLU GLU A . n A 1 210 ILE 210 209 209 ILE ILE A . n A 1 211 ILE 211 210 210 ILE ILE A . n A 1 212 LEU 212 211 211 LEU LEU A . n A 1 213 SER 213 212 212 SER SER A . n A 1 214 LYS 214 213 213 LYS LYS A . n A 1 215 GLY 215 214 214 GLY GLY A . n A 1 216 TYR 216 215 215 TYR TYR A . n A 1 217 ASN 217 216 216 ASN ASN A . n A 1 218 LYS 218 217 217 LYS LYS A . n A 1 219 ALA 219 218 218 ALA ALA A . n A 1 220 VAL 220 219 219 VAL VAL A . n A 1 221 ASP 221 220 220 ASP ASP A . n A 1 222 TRP 222 221 221 TRP TRP A . n A 1 223 TRP 223 222 222 TRP TRP A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 LEU 225 224 224 LEU LEU A . n A 1 226 GLY 226 225 225 GLY GLY A . n A 1 227 VAL 227 226 226 VAL VAL A . n A 1 228 LEU 228 227 227 LEU LEU A . n A 1 229 ILE 229 228 228 ILE ILE A . n A 1 230 TYR 230 229 229 TYR TYR A . n A 1 231 GLU 231 230 230 GLU GLU A . n A 1 232 MET 232 231 231 MET MET A . n A 1 233 ALA 233 232 232 ALA ALA A . n A 1 234 ALA 234 233 233 ALA ALA A . n A 1 235 GLY 235 234 234 GLY GLY A . n A 1 236 TYR 236 235 235 TYR TYR A . n A 1 237 PRO 237 236 236 PRO PRO A . n A 1 238 PRO 238 237 237 PRO PRO A . n A 1 239 PHE 239 238 238 PHE PHE A . n A 1 240 PHE 240 239 239 PHE PHE A . n A 1 241 ALA 241 240 240 ALA ALA A . n A 1 242 ASP 242 241 241 ASP ASP A . n A 1 243 GLN 243 242 242 GLN GLN A . n A 1 244 PRO 244 243 243 PRO PRO A . n A 1 245 ILE 245 244 244 ILE ILE A . n A 1 246 GLN 246 245 245 GLN GLN A . n A 1 247 ILE 247 246 246 ILE ILE A . n A 1 248 TYR 248 247 247 TYR TYR A . n A 1 249 GLU 249 248 248 GLU GLU A . n A 1 250 LYS 250 249 249 LYS LYS A . n A 1 251 ILE 251 250 250 ILE ILE A . n A 1 252 VAL 252 251 251 VAL VAL A . n A 1 253 SER 253 252 252 SER SER A . n A 1 254 GLY 254 253 253 GLY GLY A . n A 1 255 LYS 255 254 254 LYS LYS A . n A 1 256 VAL 256 255 255 VAL VAL A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 PHE 258 257 257 PHE PHE A . n A 1 259 PRO 259 258 258 PRO PRO A . n A 1 260 SER 260 259 259 SER SER A . n A 1 261 HIS 261 260 260 HIS HIS A . n A 1 262 PHE 262 261 261 PHE PHE A . n A 1 263 SER 263 262 262 SER SER A . n A 1 264 SER 264 263 263 SER SER A . n A 1 265 ASP 265 264 264 ASP ASP A . n A 1 266 LEU 266 265 265 LEU LEU A . n A 1 267 LYS 267 266 266 LYS LYS A . n A 1 268 ASP 268 267 267 ASP ASP A . n A 1 269 LEU 269 268 268 LEU LEU A . n A 1 270 LEU 270 269 269 LEU LEU A . n A 1 271 ARG 271 270 270 ARG ARG A . n A 1 272 ASN 272 271 271 ASN ASN A . n A 1 273 LEU 273 272 272 LEU LEU A . n A 1 274 LEU 274 273 273 LEU LEU A . n A 1 275 GLN 275 274 274 GLN GLN A . n A 1 276 VAL 276 275 275 VAL VAL A . n A 1 277 ASP 277 276 276 ASP ASP A . n A 1 278 LEU 278 277 277 LEU LEU A . n A 1 279 THR 279 278 278 THR THR A . n A 1 280 LYS 280 279 279 LYS LYS A . n A 1 281 ARG 281 280 280 ARG ARG A . n A 1 282 PHE 282 281 281 PHE PHE A . n A 1 283 GLY 283 282 282 GLY GLY A . n A 1 284 ASN 284 283 283 ASN ASN A . n A 1 285 LEU 285 284 284 LEU LEU A . n A 1 286 LYS 286 285 285 LYS LYS A . n A 1 287 ASN 287 286 286 ASN ASN A . n A 1 288 GLY 288 287 287 GLY GLY A . n A 1 289 VAL 289 288 288 VAL VAL A . n A 1 290 ASN 290 289 289 ASN ASN A . n A 1 291 ASP 291 290 290 ASP ASP A . n A 1 292 ILE 292 291 291 ILE ILE A . n A 1 293 LYS 293 292 292 LYS LYS A . n A 1 294 ASN 294 293 293 ASN ASN A . n A 1 295 HIS 295 294 294 HIS HIS A . n A 1 296 LYS 296 295 295 LYS LYS A . n A 1 297 TRP 297 296 296 TRP TRP A . n A 1 298 PHE 298 297 297 PHE PHE A . n A 1 299 ALA 299 298 298 ALA ALA A . n A 1 300 THR 300 299 299 THR THR A . n A 1 301 THR 301 300 300 THR THR A . n A 1 302 ASP 302 301 301 ASP ASP A . n A 1 303 TRP 303 302 302 TRP TRP A . n A 1 304 ILE 304 303 303 ILE ILE A . n A 1 305 ALA 305 304 304 ALA ALA A . n A 1 306 ILE 306 305 305 ILE ILE A . n A 1 307 TYR 307 306 306 TYR TYR A . n A 1 308 GLN 308 307 307 GLN GLN A . n A 1 309 ARG 309 308 308 ARG ARG A . n A 1 310 LYS 310 309 309 LYS LYS A . n A 1 311 VAL 311 310 310 VAL VAL A . n A 1 312 GLU 312 311 311 GLU GLU A . n A 1 313 ALA 313 312 312 ALA ALA A . n A 1 314 PRO 314 313 313 PRO PRO A . n A 1 315 PHE 315 314 314 PHE PHE A . n A 1 316 ILE 316 315 315 ILE ILE A . n A 1 317 PRO 317 316 316 PRO PRO A . n A 1 318 LYS 318 317 317 LYS LYS A . n A 1 319 PHE 319 318 318 PHE PHE A . n A 1 320 LYS 320 319 319 LYS LYS A . n A 1 321 GLY 321 320 320 GLY GLY A . n A 1 322 PRO 322 321 321 PRO PRO A . n A 1 323 GLY 323 322 322 GLY GLY A . n A 1 324 ASP 324 323 323 ASP ASP A . n A 1 325 THR 325 324 324 THR THR A . n A 1 326 SER 326 325 325 SER SER A . n A 1 327 ASN 327 326 326 ASN ASN A . n A 1 328 PHE 328 327 327 PHE PHE A . n A 1 329 ASP 329 328 328 ASP ASP A . n A 1 330 ASP 330 329 329 ASP ASP A . n A 1 331 TYR 331 330 330 TYR TYR A . n A 1 332 GLU 332 331 331 GLU GLU A . n A 1 333 GLU 333 332 332 GLU GLU A . n A 1 334 GLU 334 333 333 GLU GLU A . n A 1 335 GLU 335 334 334 GLU GLU A . n A 1 336 ILE 336 335 335 ILE ILE A . n A 1 337 ARG 337 336 336 ARG ARG A . n A 1 338 VAL 338 337 337 VAL VAL A . n A 1 339 SEP 339 338 338 SEP SEP A . n A 1 340 ILE 340 339 339 ILE ILE A . n A 1 341 ASN 341 340 340 ASN ASN A . n A 1 342 GLU 342 341 341 GLU GLU A . n A 1 343 LYS 343 342 342 LYS LYS A . n A 1 344 CYS 344 343 343 CYS CYS A . n A 1 345 GLY 345 344 344 GLY GLY A . n A 1 346 LYS 346 345 345 LYS LYS A . n A 1 347 GLU 347 346 346 GLU GLU A . n A 1 348 PHE 348 347 347 PHE PHE A . n A 1 349 SER 349 348 348 SER SER A . n A 1 350 GLU 350 349 349 GLU GLU A . n A 1 351 PHE 351 350 350 PHE PHE A . n B 2 1 6J9 1 1 1 6J9 6J9 E . n B 2 2 AZ1 2 2 2 AZ1 AZ1 E . n B 2 3 DAR 3 3 3 DAR DAR E . n B 2 4 ACA 4 4 4 ACA ACA E . n B 2 5 DAR 5 5 5 DAR DAR E . n B 2 6 NH2 6 6 6 NH2 NH2 E . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 401 401 SO4 SO4 A . D 3 SO4 1 402 402 SO4 SO4 A . E 3 SO4 1 403 403 SO4 SO4 A . F 3 SO4 1 404 404 SO4 SO4 A . G 4 HOH 1 501 501 HOH HOH A . G 4 HOH 2 502 502 HOH HOH A . G 4 HOH 3 503 503 HOH HOH A . G 4 HOH 4 504 504 HOH HOH A . G 4 HOH 5 505 505 HOH HOH A . G 4 HOH 6 506 506 HOH HOH A . G 4 HOH 7 507 507 HOH HOH A . G 4 HOH 8 508 508 HOH HOH A . G 4 HOH 9 509 509 HOH HOH A . G 4 HOH 10 510 510 HOH HOH A . G 4 HOH 11 511 511 HOH HOH A . G 4 HOH 12 512 512 HOH HOH A . G 4 HOH 13 513 513 HOH HOH A . G 4 HOH 14 514 514 HOH HOH A . G 4 HOH 15 515 515 HOH HOH A . G 4 HOH 16 516 516 HOH HOH A . G 4 HOH 17 517 517 HOH HOH A . G 4 HOH 18 518 518 HOH HOH A . G 4 HOH 19 519 519 HOH HOH A . G 4 HOH 20 520 520 HOH HOH A . G 4 HOH 21 521 521 HOH HOH A . G 4 HOH 22 522 522 HOH HOH A . G 4 HOH 23 523 523 HOH HOH A . G 4 HOH 24 524 524 HOH HOH A . G 4 HOH 25 525 525 HOH HOH A . G 4 HOH 26 526 526 HOH HOH A . G 4 HOH 27 527 527 HOH HOH A . G 4 HOH 28 528 528 HOH HOH A . G 4 HOH 29 529 529 HOH HOH A . G 4 HOH 30 530 530 HOH HOH A . G 4 HOH 31 531 531 HOH HOH A . G 4 HOH 32 532 532 HOH HOH A . G 4 HOH 33 533 533 HOH HOH A . G 4 HOH 34 534 534 HOH HOH A . G 4 HOH 35 535 535 HOH HOH A . G 4 HOH 36 536 536 HOH HOH A . G 4 HOH 37 537 537 HOH HOH A . G 4 HOH 38 538 538 HOH HOH A . G 4 HOH 39 539 539 HOH HOH A . G 4 HOH 40 540 540 HOH HOH A . G 4 HOH 41 541 541 HOH HOH A . G 4 HOH 42 542 542 HOH HOH A . G 4 HOH 43 543 543 HOH HOH A . G 4 HOH 44 544 544 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A TPO 198 A TPO 197 ? THR 'modified residue' 2 A SEP 339 A SEP 338 ? SER 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3010 ? 1 MORE -19 ? 1 'SSA (A^2)' 16340 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-20 2 'Structure model' 1 1 2016-08-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -12.0210 _pdbx_refine_tls.origin_y 45.5630 _pdbx_refine_tls.origin_z -2.9620 _pdbx_refine_tls.T[1][1] 0.0277 _pdbx_refine_tls.T[2][2] 0.0810 _pdbx_refine_tls.T[3][3] 0.1451 _pdbx_refine_tls.T[1][2] -0.0149 _pdbx_refine_tls.T[1][3] 0.0380 _pdbx_refine_tls.T[2][3] 0.0083 _pdbx_refine_tls.L[1][1] 0.5160 _pdbx_refine_tls.L[2][2] 0.1621 _pdbx_refine_tls.L[3][3] 1.7955 _pdbx_refine_tls.L[1][2] -0.0805 _pdbx_refine_tls.L[1][3] -0.2717 _pdbx_refine_tls.L[2][3] 0.2054 _pdbx_refine_tls.S[1][1] -0.0947 _pdbx_refine_tls.S[1][2] -0.0004 _pdbx_refine_tls.S[1][3] -0.0586 _pdbx_refine_tls.S[2][1] 0.0191 _pdbx_refine_tls.S[2][2] 0.0086 _pdbx_refine_tls.S[2][3] 0.0838 _pdbx_refine_tls.S[3][1] -0.0068 _pdbx_refine_tls.S[3][2] 0.1431 _pdbx_refine_tls.S[3][3] 0.0860 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 13 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 350 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 112 ? ? -121.72 -160.93 2 1 ASP A 184 ? ? 66.79 92.72 3 1 ASN A 216 ? ? -128.43 -169.01 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 36 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 THR _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 37 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -146.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 1 ? A GLY 2 3 1 Y 1 A ASN 2 ? A ASN 3 4 1 Y 1 A ALA 3 ? A ALA 4 5 1 Y 1 A ALA 4 ? A ALA 5 6 1 Y 1 A ALA 5 ? A ALA 6 7 1 Y 1 A ALA 6 ? A ALA 7 8 1 Y 1 A LYS 7 ? A LYS 8 9 1 Y 1 A LYS 8 ? A LYS 9 10 1 Y 1 A GLY 9 ? A GLY 10 11 1 Y 1 A SER 10 ? A SER 11 12 1 Y 1 A GLU 11 ? A GLU 12 13 1 Y 1 A GLN 12 ? A GLN 13 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH #