data_5J8T # _entry.id 5J8T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5J8T WWPDB D_1000218219 BMRB 30064 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 30064 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5J8T _pdbx_database_status.recvd_initial_deposition_date 2016-04-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pantoja-Uceda, D.' 1 'Trevino, M.A.' 2 'Bruix, M.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Molecular Choline-bindind Protein L Involved in Pneumococcal Adhesion and Virulence through Exposed Excalibur domanin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gutierrez-Fernandez, J.' 1 ? primary 'Alcorlo, M.' 2 ? primary 'Galan-Bartual, S.' 3 ? primary 'Pantoja-Uceda, D.' 4 ? primary 'Trevino, M.A.' 5 ? primary 'Bruix, M.' 6 ? primary 'Hammerschmidt, S.' 7 ? primary 'Hermoso, J.A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Choline binding protein' 5145.461 1 3.2.1.96 ? ? ;the first three residues GAS correspond to the tag used in the production . the first residue of the protein is the first E in the sequence with the number 24 ; 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GASEENIHFSSCKEAWANGYSDIHEGEPGYSAKLDRDHDGVACELKN _entity_poly.pdbx_seq_one_letter_code_can GASEENIHFSSCKEAWANGYSDIHEGEPGYSAKLDRDHDGVACELKN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 SER n 1 4 GLU n 1 5 GLU n 1 6 ASN n 1 7 ILE n 1 8 HIS n 1 9 PHE n 1 10 SER n 1 11 SER n 1 12 CYS n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 TRP n 1 17 ALA n 1 18 ASN n 1 19 GLY n 1 20 TYR n 1 21 SER n 1 22 ASP n 1 23 ILE n 1 24 HIS n 1 25 GLU n 1 26 GLY n 1 27 GLU n 1 28 PRO n 1 29 GLY n 1 30 TYR n 1 31 SER n 1 32 ALA n 1 33 LYS n 1 34 LEU n 1 35 ASP n 1 36 ARG n 1 37 ASP n 1 38 HIS n 1 39 ASP n 1 40 GLY n 1 41 VAL n 1 42 ALA n 1 43 CYS n 1 44 GLU n 1 45 LEU n 1 46 LYS n 1 47 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 47 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lytB_2, ERS020147_00413' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1313 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pETTEV28 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0U0AG78_STREE _struct_ref.pdbx_db_accession A0A0U0AG78 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EENIHFSSCKEAWANGYSDIHEGEPGYSAKLDRDHDGVACELKN _struct_ref.pdbx_align_begin 27 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5J8T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0U0AG78 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 27 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5J8T GLY A 1 ? UNP A0A0U0AG78 ? ? 'expression tag' 24 1 1 5J8T ALA A 2 ? UNP A0A0U0AG78 ? ? 'expression tag' 25 2 1 5J8T SER A 3 ? UNP A0A0U0AG78 ? ? 'expression tag' 26 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 2 '2D 1H-1H TOCSY' 1 isotropic 4 1 2 '2D 1H-1H NOESY' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 6 1 1 '3D HNCOi' 1 isotropic 7 1 1 '3D HNCA' 1 isotropic 8 1 1 '3D HNCAi' 1 isotropic 9 1 1 '3D HNCACB' 1 isotropic 10 1 1 '3D CBCA(CO)NH' 1 isotropic 11 1 1 '3D H(CCCO)NH' 1 isotropic 12 1 1 '3D (H)CC(CO)NH' 1 isotropic 13 1 1 '3D HCCH-TOCSY' 1 isotropic 14 1 1 '3D HCCH-TOCSY' 1 isotropic 15 1 1 '3D H(NCOCA)NH' 1 isotropic 16 1 1 '3D (H)N(COCA)NH' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure unknown _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength unknown _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-99% 13C; U-99% 15N] Excalibur domain of CbpL, 3 mM CaCl2, 1 % DSS, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N_sample solution ? 2 '0.5 mM Excalibur domain of CbpL, 3 mM CaCl2, 1 % DSS, 90% H2O/10% D2O' '90% H2O/10% D2O' 1H_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details 'equiped with cryoprobe TCI' # _pdbx_nmr_refine.entry_id 5J8T _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ;the 20 conformers with the lowest targer funciotn values fo CYANA calculation were selected for further refinement and minimized with amber 9.0 using Gibbs-Boltzman continuum solvation model ; _pdbx_nmr_refine.software_ordinal 8 # _pdbx_nmr_ensemble.entry_id 5J8T _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5J8T _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 2.1 'Bruker Biospin' 2 processing TopSpin 2.1 'Bruker Biospin' 3 processing NMRPipe 3.0 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'data analysis' Sparky 3.113 Goddard 5 'peak picking' Sparky 3.113 Goddard 6 'data analysis' NMRView 5.0.20 'Johnson, One Moon Scientific' 7 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 8 refinement Amber 9.0 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5J8T _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5J8T _struct.title 'NMR structure of Excalibur domain of CbpL' _struct.pdbx_descriptor 'Choline binding protein (E.C.3.2.1.96)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5J8T _struct_keywords.text 'Excalibur, Choline-binding Protein L, Pneumococcal Adhesion, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 18 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 34 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 41 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 35 A CYS 66 1_555 ? ? ? ? ? ? ? 2.047 ? metalc1 metalc ? ? A ASP 35 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 58 A CA 101 1_555 ? ? ? ? ? ? ? 2.879 ? metalc2 metalc ? ? A ASP 35 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 58 A CA 101 1_555 ? ? ? ? ? ? ? 2.308 ? metalc3 metalc ? ? A ASP 37 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 60 A CA 101 1_555 ? ? ? ? ? ? ? 3.062 ? metalc4 metalc ? ? A ASP 37 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 60 A CA 101 1_555 ? ? ? ? ? ? ? 2.306 ? metalc5 metalc ? ? A ASP 39 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 62 A CA 101 1_555 ? ? ? ? ? ? ? 3.072 ? metalc6 metalc ? ? A ASP 39 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 62 A CA 101 1_555 ? ? ? ? ? ? ? 2.301 ? metalc7 metalc ? ? A GLU 44 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 67 A CA 101 1_555 ? ? ? ? ? ? ? 2.310 ? metalc8 metalc ? ? A GLU 44 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 67 A CA 101 1_555 ? ? ? ? ? ? ? 3.019 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue CA A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 35 ? ASP A 58 . ? 1_555 ? 2 AC1 5 ASP A 37 ? ASP A 60 . ? 1_555 ? 3 AC1 5 ASP A 39 ? ASP A 62 . ? 1_555 ? 4 AC1 5 VAL A 41 ? VAL A 64 . ? 1_555 ? 5 AC1 5 GLU A 44 ? GLU A 67 . ? 1_555 ? # _atom_sites.entry_id 5J8T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 24 24 GLY GLY A . n A 1 2 ALA 2 25 25 ALA ALA A . n A 1 3 SER 3 26 26 SER SER A . n A 1 4 GLU 4 27 27 GLU GLU A . n A 1 5 GLU 5 28 28 GLU GLU A . n A 1 6 ASN 6 29 29 ASN ASN A . n A 1 7 ILE 7 30 30 ILE ILE A . n A 1 8 HIS 8 31 31 HIS HIS A . n A 1 9 PHE 9 32 32 PHE PHE A . n A 1 10 SER 10 33 33 SER SER A . n A 1 11 SER 11 34 34 SER SER A . n A 1 12 CYS 12 35 35 CYS CYS A . n A 1 13 LYS 13 36 36 LYS LYS A . n A 1 14 GLU 14 37 37 GLU GLU A . n A 1 15 ALA 15 38 38 ALA ALA A . n A 1 16 TRP 16 39 39 TRP TRP A . n A 1 17 ALA 17 40 40 ALA ALA A . n A 1 18 ASN 18 41 41 ASN ASN A . n A 1 19 GLY 19 42 42 GLY GLY A . n A 1 20 TYR 20 43 43 TYR TYR A . n A 1 21 SER 21 44 44 SER SER A . n A 1 22 ASP 22 45 45 ASP ASP A . n A 1 23 ILE 23 46 46 ILE ILE A . n A 1 24 HIS 24 47 47 HIS HIS A . n A 1 25 GLU 25 48 48 GLU GLU A . n A 1 26 GLY 26 49 49 GLY GLY A . n A 1 27 GLU 27 50 50 GLU GLU A . n A 1 28 PRO 28 51 51 PRO PRO A . n A 1 29 GLY 29 52 52 GLY GLY A . n A 1 30 TYR 30 53 53 TYR TYR A . n A 1 31 SER 31 54 54 SER SER A . n A 1 32 ALA 32 55 55 ALA ALA A . n A 1 33 LYS 33 56 56 LYS LYS A . n A 1 34 LEU 34 57 57 LEU LEU A . n A 1 35 ASP 35 58 58 ASP ASP A . n A 1 36 ARG 36 59 59 ARG ARG A . n A 1 37 ASP 37 60 60 ASP ASP A . n A 1 38 HIS 38 61 61 HIS HIS A . n A 1 39 ASP 39 62 62 ASP ASP A . n A 1 40 GLY 40 63 63 GLY GLY A . n A 1 41 VAL 41 64 64 VAL VAL A . n A 1 42 ALA 42 65 65 ALA ALA A . n A 1 43 CYS 43 66 66 CYS CYS A . n A 1 44 GLU 44 67 67 GLU GLU A . n A 1 45 LEU 45 68 68 LEU LEU A . n A 1 46 LYS 46 69 69 LYS LYS A . n A 1 47 ASN 47 70 70 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 71 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -13 ? 1 'SSA (A^2)' 3860 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 35 ? A ASP 58 ? 1_555 47.5 ? 2 OD1 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 37 ? A ASP 60 ? 1_555 66.8 ? 3 OD2 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 37 ? A ASP 60 ? 1_555 70.2 ? 4 OD1 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 37 ? A ASP 60 ? 1_555 75.7 ? 5 OD2 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 37 ? A ASP 60 ? 1_555 107.0 ? 6 OD1 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 37 ? A ASP 60 ? 1_555 44.4 ? 7 OD1 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 39 ? A ASP 62 ? 1_555 107.5 ? 8 OD2 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 39 ? A ASP 62 ? 1_555 152.5 ? 9 OD1 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 39 ? A ASP 62 ? 1_555 114.3 ? 10 OD2 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 39 ? A ASP 62 ? 1_555 70.1 ? 11 OD1 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 39 ? A ASP 62 ? 1_555 71.6 ? 12 OD2 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 39 ? A ASP 62 ? 1_555 108.9 ? 13 OD1 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 39 ? A ASP 62 ? 1_555 120.2 ? 14 OD2 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 39 ? A ASP 62 ? 1_555 85.5 ? 15 OD1 ? A ASP 39 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 39 ? A ASP 62 ? 1_555 44.4 ? 16 OD1 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 44 ? A GLU 67 ? 1_555 134.7 ? 17 OD2 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 44 ? A GLU 67 ? 1_555 90.0 ? 18 OD1 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 44 ? A GLU 67 ? 1_555 119.2 ? 19 OD2 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 44 ? A GLU 67 ? 1_555 142.9 ? 20 OD1 ? A ASP 39 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 44 ? A GLU 67 ? 1_555 108.6 ? 21 OD2 ? A ASP 39 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 44 ? A GLU 67 ? 1_555 120.5 ? 22 OD1 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 67 ? 1_555 157.8 ? 23 OD2 ? A ASP 35 ? A ASP 58 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 67 ? 1_555 133.4 ? 24 OD1 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 67 ? 1_555 135.2 ? 25 OD2 ? A ASP 37 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 67 ? 1_555 116.7 ? 26 OD1 ? A ASP 39 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 67 ? 1_555 64.0 ? 27 OD2 ? A ASP 39 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 67 ? 1_555 90.4 ? 28 OE1 ? A GLU 44 ? A GLU 67 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 67 ? 1_555 44.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-10 2 'Structure model' 2 0 2017-09-06 3 'Structure model' 2 1 2019-05-08 4 'Structure model' 2 2 2019-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_exptl_sample_conditions 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' struct_site 7 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.occupancy' 2 2 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.temperature' 5 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.temperature_units' 6 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Excalibur domain of CbpL' 0.5 ? mM '[U-99% 13C; U-99% 15N]' 1 CaCl2 3 ? mM 'natural abundance' 1 DSS 1 ? % 'natural abundance' 2 'Excalibur domain of CbpL' 0.5 ? mM 'natural abundance' 2 CaCl2 3 ? mM 'natural abundance' 2 DSS 1 ? % 'natural abundance' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 OE1 A GLU 67 ? ? CD A GLU 67 ? ? OE2 A GLU 67 ? ? 114.24 123.30 -9.06 1.20 N 2 6 OE1 A GLU 67 ? ? CD A GLU 67 ? ? OE2 A GLU 67 ? ? 115.15 123.30 -8.15 1.20 N 3 12 OE1 A GLU 67 ? ? CD A GLU 67 ? ? OE2 A GLU 67 ? ? 114.63 123.30 -8.67 1.20 N 4 16 OE1 A GLU 67 ? ? CD A GLU 67 ? ? OE2 A GLU 67 ? ? 115.99 123.30 -7.31 1.20 N 5 20 OE1 A GLU 67 ? ? CD A GLU 67 ? ? OE2 A GLU 67 ? ? 115.65 123.30 -7.65 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 61 ? ? 30.96 55.78 2 2 GLU A 28 ? ? -69.38 14.09 3 2 ASN A 29 ? ? -72.20 35.92 4 2 HIS A 61 ? ? 31.36 48.36 5 3 HIS A 61 ? ? 30.14 48.76 6 4 GLU A 27 ? ? -118.94 61.49 7 4 HIS A 61 ? ? 29.65 52.52 8 5 HIS A 61 ? ? 31.67 45.03 9 5 LEU A 68 ? ? -144.47 29.26 10 6 HIS A 61 ? ? 33.43 49.90 11 6 LEU A 68 ? ? -133.18 -33.52 12 7 HIS A 61 ? ? 30.71 50.82 13 7 LYS A 69 ? ? -63.77 94.74 14 8 HIS A 61 ? ? 32.08 50.19 15 9 HIS A 61 ? ? 35.11 42.09 16 10 HIS A 61 ? ? 29.78 52.07 17 11 GLU A 27 ? ? -70.80 40.67 18 11 HIS A 61 ? ? 31.24 47.19 19 12 HIS A 61 ? ? 32.92 45.70 20 13 GLU A 28 ? ? -72.75 44.44 21 13 HIS A 61 ? ? 32.26 43.01 22 14 HIS A 61 ? ? 31.96 50.78 23 15 GLU A 28 ? ? -77.82 31.91 24 15 HIS A 61 ? ? 30.09 50.63 25 16 GLU A 28 ? ? -58.64 102.98 26 16 HIS A 61 ? ? 35.28 45.92 27 16 LYS A 69 ? ? -59.72 106.79 28 17 HIS A 61 ? ? 33.34 47.95 29 18 HIS A 61 ? ? 30.16 50.98 30 19 HIS A 61 ? ? 31.36 50.89 31 19 LEU A 68 ? ? -142.41 -21.59 32 20 HIS A 61 ? ? 36.89 42.74 # _pdbx_audit_support.funding_organization 'Spanish Ministry of Economy and Competitiveness' _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number CTQ2014-52633 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #