data_5J9L # _entry.id 5J9L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5J9L pdb_00005j9l 10.2210/pdb5j9l/pdb WWPDB D_1000220200 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5J9L _pdbx_database_status.recvd_initial_deposition_date 2016-04-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gurbani, D.' 1 'Westover, K.D.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Bioorg. Med. Chem.' _citation.journal_id_ASTM BMECEP _citation.journal_id_CSD 1200 _citation.journal_id_ISSN 1464-3391 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 25 _citation.language ? _citation.page_first 838 _citation.page_last 846 _citation.title 'Structure-guided development of covalent TAK1 inhibitors.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmc.2016.11.035 _citation.pdbx_database_id_PubMed 28011204 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tan, L.' 1 ? primary 'Gurbani, D.' 2 ? primary 'Weisberg, E.L.' 3 ? primary 'Hunter, J.C.' 4 ? primary 'Li, L.' 5 ? primary 'Jones, D.S.' 6 ? primary 'Ficarro, S.B.' 7 ? primary 'Mowafy, S.' 8 ? primary 'Tam, C.P.' 9 ? primary 'Rao, S.' 10 ? primary 'Du, G.' 11 ? primary 'Griffin, J.D.' 12 ? primary 'Sorger, P.K.' 13 ? primary 'Marto, J.A.' 14 ? primary 'Westover, K.D.' 15 ? primary 'Gray, N.S.' 16 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5J9L _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.208 _cell.length_a_esd ? _cell.length_b 133.407 _cell.length_b_esd ? _cell.length_c 144.898 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5J9L _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase kinase kinase 7,TGF-beta-activated kinase 1 and MAP3K7-binding protein 1' 34781.105 1 2.7.11.25 ? ? ? 2 non-polymer syn 'N-(4-((2-((4-(4-methylpiperazin-1-yl)phenyl)amino)-7H-pyrrolo[2,3-d]pyrimidin-4-yl)oxy)phenyl)acrylamide' 469.538 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Transforming growth factor-beta-activated kinase 1,TGF-beta-activated kinase 1,Mitogen-activated protein kinase kinase kinase 7-interacting protein 1,TGF-beta-activated kinase 1-binding protein 1,TAK1-binding protein 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEY AEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHM TNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRC WSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHGE ; _entity_poly.pdbx_seq_one_letter_code_can ;SLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEY AEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHM TNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRC WSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 HIS n 1 4 MET n 1 5 ILE n 1 6 ASP n 1 7 TYR n 1 8 LYS n 1 9 GLU n 1 10 ILE n 1 11 GLU n 1 12 VAL n 1 13 GLU n 1 14 GLU n 1 15 VAL n 1 16 VAL n 1 17 GLY n 1 18 ARG n 1 19 GLY n 1 20 ALA n 1 21 PHE n 1 22 GLY n 1 23 VAL n 1 24 VAL n 1 25 CYS n 1 26 LYS n 1 27 ALA n 1 28 LYS n 1 29 TRP n 1 30 ARG n 1 31 ALA n 1 32 LYS n 1 33 ASP n 1 34 VAL n 1 35 ALA n 1 36 ILE n 1 37 LYS n 1 38 GLN n 1 39 ILE n 1 40 GLU n 1 41 SER n 1 42 GLU n 1 43 SER n 1 44 GLU n 1 45 ARG n 1 46 LYS n 1 47 ALA n 1 48 PHE n 1 49 ILE n 1 50 VAL n 1 51 GLU n 1 52 LEU n 1 53 ARG n 1 54 GLN n 1 55 LEU n 1 56 SER n 1 57 ARG n 1 58 VAL n 1 59 ASN n 1 60 HIS n 1 61 PRO n 1 62 ASN n 1 63 ILE n 1 64 VAL n 1 65 LYS n 1 66 LEU n 1 67 TYR n 1 68 GLY n 1 69 ALA n 1 70 CYS n 1 71 LEU n 1 72 ASN n 1 73 PRO n 1 74 VAL n 1 75 CYS n 1 76 LEU n 1 77 VAL n 1 78 MET n 1 79 GLU n 1 80 TYR n 1 81 ALA n 1 82 GLU n 1 83 GLY n 1 84 GLY n 1 85 SER n 1 86 LEU n 1 87 TYR n 1 88 ASN n 1 89 VAL n 1 90 LEU n 1 91 HIS n 1 92 GLY n 1 93 ALA n 1 94 GLU n 1 95 PRO n 1 96 LEU n 1 97 PRO n 1 98 TYR n 1 99 TYR n 1 100 THR n 1 101 ALA n 1 102 ALA n 1 103 HIS n 1 104 ALA n 1 105 MET n 1 106 SER n 1 107 TRP n 1 108 CYS n 1 109 LEU n 1 110 GLN n 1 111 CYS n 1 112 SER n 1 113 GLN n 1 114 GLY n 1 115 VAL n 1 116 ALA n 1 117 TYR n 1 118 LEU n 1 119 HIS n 1 120 SER n 1 121 MET n 1 122 GLN n 1 123 PRO n 1 124 LYS n 1 125 ALA n 1 126 LEU n 1 127 ILE n 1 128 HIS n 1 129 ARG n 1 130 ASP n 1 131 LEU n 1 132 LYS n 1 133 PRO n 1 134 PRO n 1 135 ASN n 1 136 LEU n 1 137 LEU n 1 138 LEU n 1 139 VAL n 1 140 ALA n 1 141 GLY n 1 142 GLY n 1 143 THR n 1 144 VAL n 1 145 LEU n 1 146 LYS n 1 147 ILE n 1 148 CYS n 1 149 ASP n 1 150 PHE n 1 151 GLY n 1 152 THR n 1 153 ALA n 1 154 CYS n 1 155 ASP n 1 156 ILE n 1 157 GLN n 1 158 THR n 1 159 HIS n 1 160 MET n 1 161 THR n 1 162 ASN n 1 163 ASN n 1 164 LYS n 1 165 GLY n 1 166 SER n 1 167 ALA n 1 168 ALA n 1 169 TRP n 1 170 MET n 1 171 ALA n 1 172 PRO n 1 173 GLU n 1 174 VAL n 1 175 PHE n 1 176 GLU n 1 177 GLY n 1 178 SER n 1 179 ASN n 1 180 TYR n 1 181 SER n 1 182 GLU n 1 183 LYS n 1 184 CYS n 1 185 ASP n 1 186 VAL n 1 187 PHE n 1 188 SER n 1 189 TRP n 1 190 GLY n 1 191 ILE n 1 192 ILE n 1 193 LEU n 1 194 TRP n 1 195 GLU n 1 196 VAL n 1 197 ILE n 1 198 THR n 1 199 ARG n 1 200 ARG n 1 201 LYS n 1 202 PRO n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ILE n 1 207 GLY n 1 208 GLY n 1 209 PRO n 1 210 ALA n 1 211 PHE n 1 212 ARG n 1 213 ILE n 1 214 MET n 1 215 TRP n 1 216 ALA n 1 217 VAL n 1 218 HIS n 1 219 ASN n 1 220 GLY n 1 221 THR n 1 222 ARG n 1 223 PRO n 1 224 PRO n 1 225 LEU n 1 226 ILE n 1 227 LYS n 1 228 ASN n 1 229 LEU n 1 230 PRO n 1 231 LYS n 1 232 PRO n 1 233 ILE n 1 234 GLU n 1 235 SER n 1 236 LEU n 1 237 MET n 1 238 THR n 1 239 ARG n 1 240 CYS n 1 241 TRP n 1 242 SER n 1 243 LYS n 1 244 ASP n 1 245 PRO n 1 246 SER n 1 247 GLN n 1 248 ARG n 1 249 PRO n 1 250 SER n 1 251 MET n 1 252 GLU n 1 253 GLU n 1 254 ILE n 1 255 VAL n 1 256 LYS n 1 257 ILE n 1 258 MET n 1 259 THR n 1 260 HIS n 1 261 LEU n 1 262 MET n 1 263 ARG n 1 264 TYR n 1 265 PHE n 1 266 PRO n 1 267 GLY n 1 268 ALA n 1 269 ASP n 1 270 GLU n 1 271 PRO n 1 272 LEU n 1 273 GLN n 1 274 TYR n 1 275 PRO n 1 276 CYS n 1 277 GLN n 1 278 HIS n 1 279 SER n 1 280 LEU n 1 281 PRO n 1 282 PRO n 1 283 GLY n 1 284 GLU n 1 285 ASP n 1 286 GLY n 1 287 ARG n 1 288 VAL n 1 289 GLU n 1 290 PRO n 1 291 TYR n 1 292 VAL n 1 293 ASP n 1 294 PHE n 1 295 ALA n 1 296 GLU n 1 297 PHE n 1 298 TYR n 1 299 ARG n 1 300 LEU n 1 301 TRP n 1 302 SER n 1 303 VAL n 1 304 ASP n 1 305 HIS n 1 306 GLY n 1 307 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 277 Human ? 'MAP3K7, TAK1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 278 307 Human ? 'TAB1, MAP3K7IP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP M3K7_HUMAN O43318 O43318-4 1 ;IDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGG SLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNK GSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKD PSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQ ; 31 2 UNP TAB1_HUMAN Q15750 ? 1 HSLPPGEDGRVEPYVDFAEFYRLWSVDHGE 468 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5J9L A 5 ? 277 ? O43318 31 ? 303 ? 31 303 2 2 5J9L A 278 ? 307 ? Q15750 468 ? 497 ? 468 497 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5J9L SER A 1 ? UNP O43318 ? ? 'expression tag' 27 1 1 5J9L LEU A 2 ? UNP O43318 ? ? 'expression tag' 28 2 1 5J9L HIS A 3 ? UNP O43318 ? ? 'expression tag' 29 3 1 5J9L MET A 4 ? UNP O43318 ? ? 'expression tag' 30 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6HF non-polymer . 'N-(4-((2-((4-(4-methylpiperazin-1-yl)phenyl)amino)-7H-pyrrolo[2,3-d]pyrimidin-4-yl)oxy)phenyl)acrylamide' 'CPT-1691; N-{4-[(2-{[4-(4-methylpiperazin-1-yl)phenyl]amino}-7H-pyrrolo[2,3-d]pyrimidin-4-yl)oxy]phenyl}prop-2-enamide' 'C26 H27 N7 O2' 469.538 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5J9L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.97 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.75M NaCitrate, 0.1M Tris-HCL, 0.2M NaCl, pH 7.0, 5mM Adenosine' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Rosenbaum-Rock high-resolution double-crystal monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97926 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97926 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5J9L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.75 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13998 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.0 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.25 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.75 _reflns_shell.d_res_low 2.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5J9L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7515 _refine.ls_d_res_low 49.072 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13980 _refine.ls_number_reflns_R_free 703 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.73 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2142 _refine.ls_R_factor_R_free 0.2430 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2127 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4O91 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.87 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2283 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2328 _refine_hist.d_res_high 2.7515 _refine_hist.d_res_low 49.072 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2385 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.547 ? 3235 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.115 ? 1415 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 338 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 410 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7515 2.9639 . . 127 2348 84.00 . . . 0.3153 . 0.2856 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9639 3.2621 . . 143 2716 96.00 . . . 0.2790 . 0.2416 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2621 3.7340 . . 143 2711 96.00 . . . 0.3014 . 0.2212 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7340 4.7039 . . 144 2728 95.00 . . . 0.1975 . 0.1929 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7039 . . . 146 2774 93.00 . . . 0.2275 . . . . . . . . . . . . # _struct.entry_id 5J9L _struct.title 'Crystal structure of CPT1691 bound to TAK1-TAB1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5J9L _struct_keywords.text ;Mitogen-activated protein kinase kinase kinase 7/TGF-beta-activated kinase 1 and MAP3K7-binding protein 1, TRANSFERASE-TRANSFERASE inhibitor complex ; _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 6 ? ILE A 10 ? ASP A 32 ILE A 36 5 ? 5 HELX_P HELX_P2 AA2 SER A 41 ? SER A 43 ? SER A 67 SER A 69 5 ? 3 HELX_P HELX_P3 AA3 GLU A 44 ? VAL A 58 ? GLU A 70 VAL A 84 1 ? 15 HELX_P HELX_P4 AA4 SER A 85 ? GLY A 92 ? SER A 111 GLY A 118 1 ? 8 HELX_P HELX_P5 AA5 THR A 100 ? MET A 121 ? THR A 126 MET A 147 1 ? 22 HELX_P HELX_P6 AA6 LYS A 132 ? PRO A 134 ? LYS A 158 PRO A 160 5 ? 3 HELX_P HELX_P7 AA7 SER A 166 ? MET A 170 ? SER A 192 MET A 196 5 ? 5 HELX_P HELX_P8 AA8 GLU A 182 ? ARG A 199 ? GLU A 208 ARG A 225 1 ? 18 HELX_P HELX_P9 AA9 PRO A 209 ? ASN A 219 ? PRO A 235 ASN A 245 1 ? 11 HELX_P HELX_P10 AB1 PRO A 230 ? SER A 242 ? PRO A 256 SER A 268 1 ? 13 HELX_P HELX_P11 AB2 ASP A 244 ? ARG A 248 ? ASP A 270 ARG A 274 5 ? 5 HELX_P HELX_P12 AB3 SER A 250 ? MET A 262 ? SER A 276 MET A 288 1 ? 13 HELX_P HELX_P13 AB4 ARG A 263 ? PHE A 265 ? ARG A 289 PHE A 291 5 ? 3 HELX_P HELX_P14 AB5 PHE A 294 ? HIS A 305 ? PHE A 484 HIS A 495 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 72 A . ? ASN 98 A PRO 73 A ? PRO 99 A 1 -3.32 2 GLU 94 A . ? GLU 120 A PRO 95 A ? PRO 121 A 1 -1.39 3 GLN 122 A . ? GLN 148 A PRO 123 A ? PRO 149 A 1 1.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 15 ? GLY A 17 ? VAL A 41 GLY A 43 AA1 2 VAL A 23 ? LYS A 26 ? VAL A 49 LYS A 52 AA1 3 VAL A 34 ? GLN A 38 ? VAL A 60 GLN A 64 AA1 4 CYS A 75 ? GLU A 79 ? CYS A 101 GLU A 105 AA2 1 LEU A 136 ? VAL A 139 ? LEU A 162 VAL A 165 AA2 2 VAL A 144 ? ILE A 147 ? VAL A 170 ILE A 173 AA3 1 LEU A 225 ? ILE A 226 ? LEU A 251 ILE A 252 AA3 2 ARG A 287 ? VAL A 288 ? ARG A 477 VAL A 478 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY A 43 O VAL A 24 ? O VAL A 50 AA1 2 3 N CYS A 25 ? N CYS A 51 O ILE A 36 ? O ILE A 62 AA1 3 4 N ALA A 35 ? N ALA A 61 O MET A 78 ? O MET A 104 AA2 1 2 N LEU A 137 ? N LEU A 163 O LYS A 146 ? O LYS A 172 AA3 1 2 N LEU A 225 ? N LEU A 251 O VAL A 288 ? O VAL A 478 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 6HF _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'binding site for residue 6HF A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 VAL A 16 ? VAL A 42 . ? 1_555 ? 2 AC1 13 VAL A 24 ? VAL A 50 . ? 1_555 ? 3 AC1 13 MET A 78 ? MET A 104 . ? 1_555 ? 4 AC1 13 GLU A 79 ? GLU A 105 . ? 1_555 ? 5 AC1 13 TYR A 80 ? TYR A 106 . ? 1_555 ? 6 AC1 13 ALA A 81 ? ALA A 107 . ? 1_555 ? 7 AC1 13 GLY A 84 ? GLY A 110 . ? 1_555 ? 8 AC1 13 TYR A 87 ? TYR A 113 . ? 1_555 ? 9 AC1 13 ASN A 88 ? ASN A 114 . ? 1_555 ? 10 AC1 13 PRO A 134 ? PRO A 160 . ? 1_555 ? 11 AC1 13 LEU A 137 ? LEU A 163 . ? 1_555 ? 12 AC1 13 PHE A 150 ? PHE A 176 . ? 1_555 ? 13 AC1 13 HOH C . ? HOH A 607 . ? 1_555 ? # _atom_sites.entry_id 5J9L _atom_sites.fract_transf_matrix[1][1] 0.017180 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007496 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006901 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 27 27 SER SER A . n A 1 2 LEU 2 28 28 LEU LEU A . n A 1 3 HIS 3 29 29 HIS HIS A . n A 1 4 MET 4 30 30 MET MET A . n A 1 5 ILE 5 31 31 ILE ILE A . n A 1 6 ASP 6 32 32 ASP ASP A . n A 1 7 TYR 7 33 33 TYR TYR A . n A 1 8 LYS 8 34 34 LYS LYS A . n A 1 9 GLU 9 35 35 GLU GLU A . n A 1 10 ILE 10 36 36 ILE ILE A . n A 1 11 GLU 11 37 37 GLU GLU A . n A 1 12 VAL 12 38 38 VAL VAL A . n A 1 13 GLU 13 39 39 GLU GLU A . n A 1 14 GLU 14 40 40 GLU GLU A . n A 1 15 VAL 15 41 41 VAL VAL A . n A 1 16 VAL 16 42 42 VAL VAL A . n A 1 17 GLY 17 43 43 GLY GLY A . n A 1 18 ARG 18 44 44 ARG ARG A . n A 1 19 GLY 19 45 45 GLY GLY A . n A 1 20 ALA 20 46 ? ? ? A . n A 1 21 PHE 21 47 ? ? ? A . n A 1 22 GLY 22 48 48 GLY GLY A . n A 1 23 VAL 23 49 49 VAL VAL A . n A 1 24 VAL 24 50 50 VAL VAL A . n A 1 25 CYS 25 51 51 CYS CYS A . n A 1 26 LYS 26 52 52 LYS LYS A . n A 1 27 ALA 27 53 53 ALA ALA A . n A 1 28 LYS 28 54 ? ? ? A . n A 1 29 TRP 29 55 55 TRP TRP A . n A 1 30 ARG 30 56 56 ARG ARG A . n A 1 31 ALA 31 57 57 ALA ALA A . n A 1 32 LYS 32 58 ? ? ? A . n A 1 33 ASP 33 59 59 ASP ASP A . n A 1 34 VAL 34 60 60 VAL VAL A . n A 1 35 ALA 35 61 61 ALA ALA A . n A 1 36 ILE 36 62 62 ILE ILE A . n A 1 37 LYS 37 63 63 LYS LYS A . n A 1 38 GLN 38 64 64 GLN GLN A . n A 1 39 ILE 39 65 65 ILE ILE A . n A 1 40 GLU 40 66 66 GLU GLU A . n A 1 41 SER 41 67 67 SER SER A . n A 1 42 GLU 42 68 68 GLU GLU A . n A 1 43 SER 43 69 69 SER SER A . n A 1 44 GLU 44 70 70 GLU GLU A . n A 1 45 ARG 45 71 71 ARG ARG A . n A 1 46 LYS 46 72 72 LYS LYS A . n A 1 47 ALA 47 73 73 ALA ALA A . n A 1 48 PHE 48 74 74 PHE PHE A . n A 1 49 ILE 49 75 75 ILE ILE A . n A 1 50 VAL 50 76 76 VAL VAL A . n A 1 51 GLU 51 77 77 GLU GLU A . n A 1 52 LEU 52 78 78 LEU LEU A . n A 1 53 ARG 53 79 79 ARG ARG A . n A 1 54 GLN 54 80 80 GLN GLN A . n A 1 55 LEU 55 81 81 LEU LEU A . n A 1 56 SER 56 82 82 SER SER A . n A 1 57 ARG 57 83 83 ARG ARG A . n A 1 58 VAL 58 84 84 VAL VAL A . n A 1 59 ASN 59 85 85 ASN ASN A . n A 1 60 HIS 60 86 86 HIS HIS A . n A 1 61 PRO 61 87 87 PRO PRO A . n A 1 62 ASN 62 88 88 ASN ASN A . n A 1 63 ILE 63 89 89 ILE ILE A . n A 1 64 VAL 64 90 90 VAL VAL A . n A 1 65 LYS 65 91 91 LYS LYS A . n A 1 66 LEU 66 92 92 LEU LEU A . n A 1 67 TYR 67 93 93 TYR TYR A . n A 1 68 GLY 68 94 ? ? ? A . n A 1 69 ALA 69 95 ? ? ? A . n A 1 70 CYS 70 96 96 CYS CYS A . n A 1 71 LEU 71 97 97 LEU LEU A . n A 1 72 ASN 72 98 98 ASN ASN A . n A 1 73 PRO 73 99 99 PRO PRO A . n A 1 74 VAL 74 100 100 VAL VAL A . n A 1 75 CYS 75 101 101 CYS CYS A . n A 1 76 LEU 76 102 102 LEU LEU A . n A 1 77 VAL 77 103 103 VAL VAL A . n A 1 78 MET 78 104 104 MET MET A . n A 1 79 GLU 79 105 105 GLU GLU A . n A 1 80 TYR 80 106 106 TYR TYR A . n A 1 81 ALA 81 107 107 ALA ALA A . n A 1 82 GLU 82 108 108 GLU GLU A . n A 1 83 GLY 83 109 109 GLY GLY A . n A 1 84 GLY 84 110 110 GLY GLY A . n A 1 85 SER 85 111 111 SER SER A . n A 1 86 LEU 86 112 112 LEU LEU A . n A 1 87 TYR 87 113 113 TYR TYR A . n A 1 88 ASN 88 114 114 ASN ASN A . n A 1 89 VAL 89 115 115 VAL VAL A . n A 1 90 LEU 90 116 116 LEU LEU A . n A 1 91 HIS 91 117 117 HIS HIS A . n A 1 92 GLY 92 118 118 GLY GLY A . n A 1 93 ALA 93 119 119 ALA ALA A . n A 1 94 GLU 94 120 120 GLU GLU A . n A 1 95 PRO 95 121 121 PRO PRO A . n A 1 96 LEU 96 122 122 LEU LEU A . n A 1 97 PRO 97 123 123 PRO PRO A . n A 1 98 TYR 98 124 124 TYR TYR A . n A 1 99 TYR 99 125 125 TYR TYR A . n A 1 100 THR 100 126 126 THR THR A . n A 1 101 ALA 101 127 127 ALA ALA A . n A 1 102 ALA 102 128 128 ALA ALA A . n A 1 103 HIS 103 129 129 HIS HIS A . n A 1 104 ALA 104 130 130 ALA ALA A . n A 1 105 MET 105 131 131 MET MET A . n A 1 106 SER 106 132 132 SER SER A . n A 1 107 TRP 107 133 133 TRP TRP A . n A 1 108 CYS 108 134 134 CYS CYS A . n A 1 109 LEU 109 135 135 LEU LEU A . n A 1 110 GLN 110 136 136 GLN GLN A . n A 1 111 CYS 111 137 137 CYS CYS A . n A 1 112 SER 112 138 138 SER SER A . n A 1 113 GLN 113 139 139 GLN GLN A . n A 1 114 GLY 114 140 140 GLY GLY A . n A 1 115 VAL 115 141 141 VAL VAL A . n A 1 116 ALA 116 142 142 ALA ALA A . n A 1 117 TYR 117 143 143 TYR TYR A . n A 1 118 LEU 118 144 144 LEU LEU A . n A 1 119 HIS 119 145 145 HIS HIS A . n A 1 120 SER 120 146 146 SER SER A . n A 1 121 MET 121 147 147 MET MET A . n A 1 122 GLN 122 148 148 GLN GLN A . n A 1 123 PRO 123 149 149 PRO PRO A . n A 1 124 LYS 124 150 150 LYS LYS A . n A 1 125 ALA 125 151 151 ALA ALA A . n A 1 126 LEU 126 152 152 LEU LEU A . n A 1 127 ILE 127 153 153 ILE ILE A . n A 1 128 HIS 128 154 154 HIS HIS A . n A 1 129 ARG 129 155 155 ARG ARG A . n A 1 130 ASP 130 156 156 ASP ASP A . n A 1 131 LEU 131 157 157 LEU LEU A . n A 1 132 LYS 132 158 158 LYS LYS A . n A 1 133 PRO 133 159 159 PRO PRO A . n A 1 134 PRO 134 160 160 PRO PRO A . n A 1 135 ASN 135 161 161 ASN ASN A . n A 1 136 LEU 136 162 162 LEU LEU A . n A 1 137 LEU 137 163 163 LEU LEU A . n A 1 138 LEU 138 164 164 LEU LEU A . n A 1 139 VAL 139 165 165 VAL VAL A . n A 1 140 ALA 140 166 166 ALA ALA A . n A 1 141 GLY 141 167 167 GLY GLY A . n A 1 142 GLY 142 168 168 GLY GLY A . n A 1 143 THR 143 169 169 THR THR A . n A 1 144 VAL 144 170 170 VAL VAL A . n A 1 145 LEU 145 171 171 LEU LEU A . n A 1 146 LYS 146 172 172 LYS LYS A . n A 1 147 ILE 147 173 173 ILE ILE A . n A 1 148 CYS 148 174 174 CYS CYS A . n A 1 149 ASP 149 175 175 ASP ASP A . n A 1 150 PHE 150 176 176 PHE PHE A . n A 1 151 GLY 151 177 ? ? ? A . n A 1 152 THR 152 178 ? ? ? A . n A 1 153 ALA 153 179 ? ? ? A . n A 1 154 CYS 154 180 ? ? ? A . n A 1 155 ASP 155 181 ? ? ? A . n A 1 156 ILE 156 182 ? ? ? A . n A 1 157 GLN 157 183 ? ? ? A . n A 1 158 THR 158 184 ? ? ? A . n A 1 159 HIS 159 185 ? ? ? A . n A 1 160 MET 160 186 ? ? ? A . n A 1 161 THR 161 187 ? ? ? A . n A 1 162 ASN 162 188 ? ? ? A . n A 1 163 ASN 163 189 ? ? ? A . n A 1 164 LYS 164 190 ? ? ? A . n A 1 165 GLY 165 191 191 GLY GLY A . n A 1 166 SER 166 192 192 SER SER A . n A 1 167 ALA 167 193 193 ALA ALA A . n A 1 168 ALA 168 194 194 ALA ALA A . n A 1 169 TRP 169 195 195 TRP TRP A . n A 1 170 MET 170 196 196 MET MET A . n A 1 171 ALA 171 197 197 ALA ALA A . n A 1 172 PRO 172 198 198 PRO PRO A . n A 1 173 GLU 173 199 199 GLU GLU A . n A 1 174 VAL 174 200 200 VAL VAL A . n A 1 175 PHE 175 201 201 PHE PHE A . n A 1 176 GLU 176 202 202 GLU GLU A . n A 1 177 GLY 177 203 203 GLY GLY A . n A 1 178 SER 178 204 204 SER SER A . n A 1 179 ASN 179 205 205 ASN ASN A . n A 1 180 TYR 180 206 206 TYR TYR A . n A 1 181 SER 181 207 207 SER SER A . n A 1 182 GLU 182 208 208 GLU GLU A . n A 1 183 LYS 183 209 209 LYS LYS A . n A 1 184 CYS 184 210 210 CYS CYS A . n A 1 185 ASP 185 211 211 ASP ASP A . n A 1 186 VAL 186 212 212 VAL VAL A . n A 1 187 PHE 187 213 213 PHE PHE A . n A 1 188 SER 188 214 214 SER SER A . n A 1 189 TRP 189 215 215 TRP TRP A . n A 1 190 GLY 190 216 216 GLY GLY A . n A 1 191 ILE 191 217 217 ILE ILE A . n A 1 192 ILE 192 218 218 ILE ILE A . n A 1 193 LEU 193 219 219 LEU LEU A . n A 1 194 TRP 194 220 220 TRP TRP A . n A 1 195 GLU 195 221 221 GLU GLU A . n A 1 196 VAL 196 222 222 VAL VAL A . n A 1 197 ILE 197 223 223 ILE ILE A . n A 1 198 THR 198 224 224 THR THR A . n A 1 199 ARG 199 225 225 ARG ARG A . n A 1 200 ARG 200 226 226 ARG ARG A . n A 1 201 LYS 201 227 227 LYS LYS A . n A 1 202 PRO 202 228 228 PRO PRO A . n A 1 203 PHE 203 229 229 PHE PHE A . n A 1 204 ASP 204 230 230 ASP ASP A . n A 1 205 GLU 205 231 231 GLU GLU A . n A 1 206 ILE 206 232 232 ILE ILE A . n A 1 207 GLY 207 233 233 GLY GLY A . n A 1 208 GLY 208 234 234 GLY GLY A . n A 1 209 PRO 209 235 235 PRO PRO A . n A 1 210 ALA 210 236 236 ALA ALA A . n A 1 211 PHE 211 237 237 PHE PHE A . n A 1 212 ARG 212 238 238 ARG ARG A . n A 1 213 ILE 213 239 239 ILE ILE A . n A 1 214 MET 214 240 240 MET MET A . n A 1 215 TRP 215 241 241 TRP TRP A . n A 1 216 ALA 216 242 242 ALA ALA A . n A 1 217 VAL 217 243 243 VAL VAL A . n A 1 218 HIS 218 244 244 HIS HIS A . n A 1 219 ASN 219 245 245 ASN ASN A . n A 1 220 GLY 220 246 246 GLY GLY A . n A 1 221 THR 221 247 247 THR THR A . n A 1 222 ARG 222 248 248 ARG ARG A . n A 1 223 PRO 223 249 249 PRO PRO A . n A 1 224 PRO 224 250 250 PRO PRO A . n A 1 225 LEU 225 251 251 LEU LEU A . n A 1 226 ILE 226 252 252 ILE ILE A . n A 1 227 LYS 227 253 253 LYS LYS A . n A 1 228 ASN 228 254 254 ASN ASN A . n A 1 229 LEU 229 255 255 LEU LEU A . n A 1 230 PRO 230 256 256 PRO PRO A . n A 1 231 LYS 231 257 257 LYS LYS A . n A 1 232 PRO 232 258 258 PRO PRO A . n A 1 233 ILE 233 259 259 ILE ILE A . n A 1 234 GLU 234 260 260 GLU GLU A . n A 1 235 SER 235 261 261 SER SER A . n A 1 236 LEU 236 262 262 LEU LEU A . n A 1 237 MET 237 263 263 MET MET A . n A 1 238 THR 238 264 264 THR THR A . n A 1 239 ARG 239 265 265 ARG ARG A . n A 1 240 CYS 240 266 266 CYS CYS A . n A 1 241 TRP 241 267 267 TRP TRP A . n A 1 242 SER 242 268 268 SER SER A . n A 1 243 LYS 243 269 269 LYS LYS A . n A 1 244 ASP 244 270 270 ASP ASP A . n A 1 245 PRO 245 271 271 PRO PRO A . n A 1 246 SER 246 272 272 SER SER A . n A 1 247 GLN 247 273 273 GLN GLN A . n A 1 248 ARG 248 274 274 ARG ARG A . n A 1 249 PRO 249 275 275 PRO PRO A . n A 1 250 SER 250 276 276 SER SER A . n A 1 251 MET 251 277 277 MET MET A . n A 1 252 GLU 252 278 278 GLU GLU A . n A 1 253 GLU 253 279 279 GLU GLU A . n A 1 254 ILE 254 280 280 ILE ILE A . n A 1 255 VAL 255 281 281 VAL VAL A . n A 1 256 LYS 256 282 282 LYS LYS A . n A 1 257 ILE 257 283 283 ILE ILE A . n A 1 258 MET 258 284 284 MET MET A . n A 1 259 THR 259 285 285 THR THR A . n A 1 260 HIS 260 286 286 HIS HIS A . n A 1 261 LEU 261 287 287 LEU LEU A . n A 1 262 MET 262 288 288 MET MET A . n A 1 263 ARG 263 289 289 ARG ARG A . n A 1 264 TYR 264 290 290 TYR TYR A . n A 1 265 PHE 265 291 291 PHE PHE A . n A 1 266 PRO 266 292 292 PRO PRO A . n A 1 267 GLY 267 293 293 GLY GLY A . n A 1 268 ALA 268 294 294 ALA ALA A . n A 1 269 ASP 269 295 295 ASP ASP A . n A 1 270 GLU 270 296 296 GLU GLU A . n A 1 271 PRO 271 297 297 PRO PRO A . n A 1 272 LEU 272 298 298 LEU LEU A . n A 1 273 GLN 273 299 299 GLN GLN A . n A 1 274 TYR 274 300 300 TYR TYR A . n A 1 275 PRO 275 301 301 PRO PRO A . n A 1 276 CYS 276 302 302 CYS CYS A . n A 1 277 GLN 277 303 303 GLN GLN A . n A 1 278 HIS 278 468 468 HIS HIS A . n A 1 279 SER 279 469 469 SER SER A . n A 1 280 LEU 280 470 470 LEU LEU A . n A 1 281 PRO 281 471 471 PRO PRO A . n A 1 282 PRO 282 472 472 PRO PRO A . n A 1 283 GLY 283 473 473 GLY GLY A . n A 1 284 GLU 284 474 474 GLU GLU A . n A 1 285 ASP 285 475 475 ASP ASP A . n A 1 286 GLY 286 476 476 GLY GLY A . n A 1 287 ARG 287 477 477 ARG ARG A . n A 1 288 VAL 288 478 478 VAL VAL A . n A 1 289 GLU 289 479 479 GLU GLU A . n A 1 290 PRO 290 480 480 PRO PRO A . n A 1 291 TYR 291 481 481 TYR TYR A . n A 1 292 VAL 292 482 482 VAL VAL A . n A 1 293 ASP 293 483 483 ASP ASP A . n A 1 294 PHE 294 484 484 PHE PHE A . n A 1 295 ALA 295 485 485 ALA ALA A . n A 1 296 GLU 296 486 486 GLU GLU A . n A 1 297 PHE 297 487 487 PHE PHE A . n A 1 298 TYR 298 488 488 TYR TYR A . n A 1 299 ARG 299 489 489 ARG ARG A . n A 1 300 LEU 300 490 490 LEU LEU A . n A 1 301 TRP 301 491 491 TRP TRP A . n A 1 302 SER 302 492 492 SER SER A . n A 1 303 VAL 303 493 493 VAL VAL A . n A 1 304 ASP 304 494 494 ASP ASP A . n A 1 305 HIS 305 495 495 HIS HIS A . n A 1 306 GLY 306 496 496 GLY GLY A . n A 1 307 GLU 307 497 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 6HF 1 501 1 6HF CPT A . C 3 HOH 1 601 3 HOH HOH A . C 3 HOH 2 602 9 HOH HOH A . C 3 HOH 3 603 1 HOH HOH A . C 3 HOH 4 604 4 HOH HOH A . C 3 HOH 5 605 2 HOH HOH A . C 3 HOH 6 606 7 HOH HOH A . C 3 HOH 7 607 5 HOH HOH A . C 3 HOH 8 608 6 HOH HOH A . C 3 HOH 9 609 8 HOH HOH A . C 3 HOH 10 610 10 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 14340 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-15 2 'Structure model' 1 1 2017-09-06 3 'Structure model' 1 2 2020-01-08 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_chem_comp.pdbx_synonyms' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH22 A ARG 226 ? ? O A PRO 471 ? ? 1.50 2 1 HH A TYR 300 ? ? O A HOH 603 ? ? 1.58 3 1 OH A TYR 33 ? ? HE21 A GLN 64 ? ? 1.59 4 1 O A PHE 291 ? ? O A HOH 601 ? ? 2.12 5 1 OH A TYR 33 ? ? NE2 A GLN 64 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 39 ? ? -127.30 -64.62 2 1 ARG A 56 ? ? 37.56 47.96 3 1 SER A 67 ? ? 69.02 153.78 4 1 ARG A 155 ? ? 74.12 -2.79 5 1 ASN A 205 ? ? -56.31 103.04 6 1 GLN A 299 ? ? -152.13 -16.89 7 1 CYS A 302 ? ? -162.45 99.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 46 ? A ALA 20 2 1 Y 1 A PHE 47 ? A PHE 21 3 1 Y 1 A LYS 54 ? A LYS 28 4 1 Y 1 A LYS 58 ? A LYS 32 5 1 Y 1 A GLY 94 ? A GLY 68 6 1 Y 1 A ALA 95 ? A ALA 69 7 1 Y 1 A GLY 177 ? A GLY 151 8 1 Y 1 A THR 178 ? A THR 152 9 1 Y 1 A ALA 179 ? A ALA 153 10 1 Y 1 A CYS 180 ? A CYS 154 11 1 Y 1 A ASP 181 ? A ASP 155 12 1 Y 1 A ILE 182 ? A ILE 156 13 1 Y 1 A GLN 183 ? A GLN 157 14 1 Y 1 A THR 184 ? A THR 158 15 1 Y 1 A HIS 185 ? A HIS 159 16 1 Y 1 A MET 186 ? A MET 160 17 1 Y 1 A THR 187 ? A THR 161 18 1 Y 1 A ASN 188 ? A ASN 162 19 1 Y 1 A ASN 189 ? A ASN 163 20 1 Y 1 A LYS 190 ? A LYS 164 21 1 Y 1 A GLU 497 ? A GLU 307 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6HF C01 C N N 1 6HF N02 N N N 2 6HF C03 C N N 3 6HF C04 C N N 4 6HF C05 C N N 5 6HF C06 C N N 6 6HF N07 N N N 7 6HF C08 C Y N 8 6HF C09 C Y N 9 6HF C10 C Y N 10 6HF C11 C Y N 11 6HF C12 C Y N 12 6HF C13 C Y N 13 6HF N14 N N N 14 6HF C15 C Y N 15 6HF N16 N Y N 16 6HF C17 C Y N 17 6HF C18 C Y N 18 6HF C19 C Y N 19 6HF C20 C Y N 20 6HF N21 N Y N 21 6HF C22 C Y N 22 6HF O23 O N N 23 6HF C24 C Y N 24 6HF C25 C Y N 25 6HF C26 C Y N 26 6HF C27 C Y N 27 6HF N28 N N N 28 6HF C29 C N N 29 6HF C30 C N N 30 6HF C31 C N N 31 6HF O32 O N N 32 6HF C33 C Y N 33 6HF C34 C Y N 34 6HF N35 N Y N 35 6HF H012 H N N 36 6HF H011 H N N 37 6HF H013 H N N 38 6HF H032 H N N 39 6HF H031 H N N 40 6HF H042 H N N 41 6HF H041 H N N 42 6HF H051 H N N 43 6HF H052 H N N 44 6HF H062 H N N 45 6HF H061 H N N 46 6HF H091 H N N 47 6HF H101 H N N 48 6HF H111 H N N 49 6HF H121 H N N 50 6HF H141 H N N 51 6HF H191 H N N 52 6HF H201 H N N 53 6HF H211 H N N 54 6HF H251 H N N 55 6HF H261 H N N 56 6HF H281 H N N 57 6HF H301 H N N 58 6HF H312 H N N 59 6HF H311 H N N 60 6HF H331 H N N 61 6HF H341 H N N 62 ALA N N N N 63 ALA CA C N S 64 ALA C C N N 65 ALA O O N N 66 ALA CB C N N 67 ALA OXT O N N 68 ALA H H N N 69 ALA H2 H N N 70 ALA HA H N N 71 ALA HB1 H N N 72 ALA HB2 H N N 73 ALA HB3 H N N 74 ALA HXT H N N 75 ARG N N N N 76 ARG CA C N S 77 ARG C C N N 78 ARG O O N N 79 ARG CB C N N 80 ARG CG C N N 81 ARG CD C N N 82 ARG NE N N N 83 ARG CZ C N N 84 ARG NH1 N N N 85 ARG NH2 N N N 86 ARG OXT O N N 87 ARG H H N N 88 ARG H2 H N N 89 ARG HA H N N 90 ARG HB2 H N N 91 ARG HB3 H N N 92 ARG HG2 H N N 93 ARG HG3 H N N 94 ARG HD2 H N N 95 ARG HD3 H N N 96 ARG HE H N N 97 ARG HH11 H N N 98 ARG HH12 H N N 99 ARG HH21 H N N 100 ARG HH22 H N N 101 ARG HXT H N N 102 ASN N N N N 103 ASN CA C N S 104 ASN C C N N 105 ASN O O N N 106 ASN CB C N N 107 ASN CG C N N 108 ASN OD1 O N N 109 ASN ND2 N N N 110 ASN OXT O N N 111 ASN H H N N 112 ASN H2 H N N 113 ASN HA H N N 114 ASN HB2 H N N 115 ASN HB3 H N N 116 ASN HD21 H N N 117 ASN HD22 H N N 118 ASN HXT H N N 119 ASP N N N N 120 ASP CA C N S 121 ASP C C N N 122 ASP O O N N 123 ASP CB C N N 124 ASP CG C N N 125 ASP OD1 O N N 126 ASP OD2 O N N 127 ASP OXT O N N 128 ASP H H N N 129 ASP H2 H N N 130 ASP HA H N N 131 ASP HB2 H N N 132 ASP HB3 H N N 133 ASP HD2 H N N 134 ASP HXT H N N 135 CYS N N N N 136 CYS CA C N R 137 CYS C C N N 138 CYS O O N N 139 CYS CB C N N 140 CYS SG S N N 141 CYS OXT O N N 142 CYS H H N N 143 CYS H2 H N N 144 CYS HA H N N 145 CYS HB2 H N N 146 CYS HB3 H N N 147 CYS HG H N N 148 CYS HXT H N N 149 GLN N N N N 150 GLN CA C N S 151 GLN C C N N 152 GLN O O N N 153 GLN CB C N N 154 GLN CG C N N 155 GLN CD C N N 156 GLN OE1 O N N 157 GLN NE2 N N N 158 GLN OXT O N N 159 GLN H H N N 160 GLN H2 H N N 161 GLN HA H N N 162 GLN HB2 H N N 163 GLN HB3 H N N 164 GLN HG2 H N N 165 GLN HG3 H N N 166 GLN HE21 H N N 167 GLN HE22 H N N 168 GLN HXT H N N 169 GLU N N N N 170 GLU CA C N S 171 GLU C C N N 172 GLU O O N N 173 GLU CB C N N 174 GLU CG C N N 175 GLU CD C N N 176 GLU OE1 O N N 177 GLU OE2 O N N 178 GLU OXT O N N 179 GLU H H N N 180 GLU H2 H N N 181 GLU HA H N N 182 GLU HB2 H N N 183 GLU HB3 H N N 184 GLU HG2 H N N 185 GLU HG3 H N N 186 GLU HE2 H N N 187 GLU HXT H N N 188 GLY N N N N 189 GLY CA C N N 190 GLY C C N N 191 GLY O O N N 192 GLY OXT O N N 193 GLY H H N N 194 GLY H2 H N N 195 GLY HA2 H N N 196 GLY HA3 H N N 197 GLY HXT H N N 198 HIS N N N N 199 HIS CA C N S 200 HIS C C N N 201 HIS O O N N 202 HIS CB C N N 203 HIS CG C Y N 204 HIS ND1 N Y N 205 HIS CD2 C Y N 206 HIS CE1 C Y N 207 HIS NE2 N Y N 208 HIS OXT O N N 209 HIS H H N N 210 HIS H2 H N N 211 HIS HA H N N 212 HIS HB2 H N N 213 HIS HB3 H N N 214 HIS HD1 H N N 215 HIS HD2 H N N 216 HIS HE1 H N N 217 HIS HE2 H N N 218 HIS HXT H N N 219 HOH O O N N 220 HOH H1 H N N 221 HOH H2 H N N 222 ILE N N N N 223 ILE CA C N S 224 ILE C C N N 225 ILE O O N N 226 ILE CB C N S 227 ILE CG1 C N N 228 ILE CG2 C N N 229 ILE CD1 C N N 230 ILE OXT O N N 231 ILE H H N N 232 ILE H2 H N N 233 ILE HA H N N 234 ILE HB H N N 235 ILE HG12 H N N 236 ILE HG13 H N N 237 ILE HG21 H N N 238 ILE HG22 H N N 239 ILE HG23 H N N 240 ILE HD11 H N N 241 ILE HD12 H N N 242 ILE HD13 H N N 243 ILE HXT H N N 244 LEU N N N N 245 LEU CA C N S 246 LEU C C N N 247 LEU O O N N 248 LEU CB C N N 249 LEU CG C N N 250 LEU CD1 C N N 251 LEU CD2 C N N 252 LEU OXT O N N 253 LEU H H N N 254 LEU H2 H N N 255 LEU HA H N N 256 LEU HB2 H N N 257 LEU HB3 H N N 258 LEU HG H N N 259 LEU HD11 H N N 260 LEU HD12 H N N 261 LEU HD13 H N N 262 LEU HD21 H N N 263 LEU HD22 H N N 264 LEU HD23 H N N 265 LEU HXT H N N 266 LYS N N N N 267 LYS CA C N S 268 LYS C C N N 269 LYS O O N N 270 LYS CB C N N 271 LYS CG C N N 272 LYS CD C N N 273 LYS CE C N N 274 LYS NZ N N N 275 LYS OXT O N N 276 LYS H H N N 277 LYS H2 H N N 278 LYS HA H N N 279 LYS HB2 H N N 280 LYS HB3 H N N 281 LYS HG2 H N N 282 LYS HG3 H N N 283 LYS HD2 H N N 284 LYS HD3 H N N 285 LYS HE2 H N N 286 LYS HE3 H N N 287 LYS HZ1 H N N 288 LYS HZ2 H N N 289 LYS HZ3 H N N 290 LYS HXT H N N 291 MET N N N N 292 MET CA C N S 293 MET C C N N 294 MET O O N N 295 MET CB C N N 296 MET CG C N N 297 MET SD S N N 298 MET CE C N N 299 MET OXT O N N 300 MET H H N N 301 MET H2 H N N 302 MET HA H N N 303 MET HB2 H N N 304 MET HB3 H N N 305 MET HG2 H N N 306 MET HG3 H N N 307 MET HE1 H N N 308 MET HE2 H N N 309 MET HE3 H N N 310 MET HXT H N N 311 PHE N N N N 312 PHE CA C N S 313 PHE C C N N 314 PHE O O N N 315 PHE CB C N N 316 PHE CG C Y N 317 PHE CD1 C Y N 318 PHE CD2 C Y N 319 PHE CE1 C Y N 320 PHE CE2 C Y N 321 PHE CZ C Y N 322 PHE OXT O N N 323 PHE H H N N 324 PHE H2 H N N 325 PHE HA H N N 326 PHE HB2 H N N 327 PHE HB3 H N N 328 PHE HD1 H N N 329 PHE HD2 H N N 330 PHE HE1 H N N 331 PHE HE2 H N N 332 PHE HZ H N N 333 PHE HXT H N N 334 PRO N N N N 335 PRO CA C N S 336 PRO C C N N 337 PRO O O N N 338 PRO CB C N N 339 PRO CG C N N 340 PRO CD C N N 341 PRO OXT O N N 342 PRO H H N N 343 PRO HA H N N 344 PRO HB2 H N N 345 PRO HB3 H N N 346 PRO HG2 H N N 347 PRO HG3 H N N 348 PRO HD2 H N N 349 PRO HD3 H N N 350 PRO HXT H N N 351 SER N N N N 352 SER CA C N S 353 SER C C N N 354 SER O O N N 355 SER CB C N N 356 SER OG O N N 357 SER OXT O N N 358 SER H H N N 359 SER H2 H N N 360 SER HA H N N 361 SER HB2 H N N 362 SER HB3 H N N 363 SER HG H N N 364 SER HXT H N N 365 THR N N N N 366 THR CA C N S 367 THR C C N N 368 THR O O N N 369 THR CB C N R 370 THR OG1 O N N 371 THR CG2 C N N 372 THR OXT O N N 373 THR H H N N 374 THR H2 H N N 375 THR HA H N N 376 THR HB H N N 377 THR HG1 H N N 378 THR HG21 H N N 379 THR HG22 H N N 380 THR HG23 H N N 381 THR HXT H N N 382 TRP N N N N 383 TRP CA C N S 384 TRP C C N N 385 TRP O O N N 386 TRP CB C N N 387 TRP CG C Y N 388 TRP CD1 C Y N 389 TRP CD2 C Y N 390 TRP NE1 N Y N 391 TRP CE2 C Y N 392 TRP CE3 C Y N 393 TRP CZ2 C Y N 394 TRP CZ3 C Y N 395 TRP CH2 C Y N 396 TRP OXT O N N 397 TRP H H N N 398 TRP H2 H N N 399 TRP HA H N N 400 TRP HB2 H N N 401 TRP HB3 H N N 402 TRP HD1 H N N 403 TRP HE1 H N N 404 TRP HE3 H N N 405 TRP HZ2 H N N 406 TRP HZ3 H N N 407 TRP HH2 H N N 408 TRP HXT H N N 409 TYR N N N N 410 TYR CA C N S 411 TYR C C N N 412 TYR O O N N 413 TYR CB C N N 414 TYR CG C Y N 415 TYR CD1 C Y N 416 TYR CD2 C Y N 417 TYR CE1 C Y N 418 TYR CE2 C Y N 419 TYR CZ C Y N 420 TYR OH O N N 421 TYR OXT O N N 422 TYR H H N N 423 TYR H2 H N N 424 TYR HA H N N 425 TYR HB2 H N N 426 TYR HB3 H N N 427 TYR HD1 H N N 428 TYR HD2 H N N 429 TYR HE1 H N N 430 TYR HE2 H N N 431 TYR HH H N N 432 TYR HXT H N N 433 VAL N N N N 434 VAL CA C N S 435 VAL C C N N 436 VAL O O N N 437 VAL CB C N N 438 VAL CG1 C N N 439 VAL CG2 C N N 440 VAL OXT O N N 441 VAL H H N N 442 VAL H2 H N N 443 VAL HA H N N 444 VAL HB H N N 445 VAL HG11 H N N 446 VAL HG12 H N N 447 VAL HG13 H N N 448 VAL HG21 H N N 449 VAL HG22 H N N 450 VAL HG23 H N N 451 VAL HXT H N N 452 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6HF C31 C30 doub N N 1 6HF C30 C29 sing N N 2 6HF C01 N02 sing N N 3 6HF C29 O32 doub N N 4 6HF C29 N28 sing N N 5 6HF N28 C27 sing N N 6 6HF N02 C05 sing N N 7 6HF N02 C03 sing N N 8 6HF C05 C06 sing N N 9 6HF C06 N07 sing N N 10 6HF C03 C04 sing N N 11 6HF C27 C33 doub Y N 12 6HF C27 C26 sing Y N 13 6HF C04 N07 sing N N 14 6HF C33 C34 sing Y N 15 6HF N07 C08 sing N N 16 6HF C26 C25 doub Y N 17 6HF C11 C08 doub Y N 18 6HF C11 C12 sing Y N 19 6HF C08 C09 sing Y N 20 6HF C12 C13 doub Y N 21 6HF C34 C24 doub Y N 22 6HF C09 C10 doub Y N 23 6HF C25 C24 sing Y N 24 6HF C13 C10 sing Y N 25 6HF C13 N14 sing N N 26 6HF C24 O23 sing N N 27 6HF N14 C15 sing N N 28 6HF N35 C15 doub Y N 29 6HF N35 C22 sing Y N 30 6HF C15 N16 sing Y N 31 6HF O23 C22 sing N N 32 6HF C22 C18 doub Y N 33 6HF N16 C17 doub Y N 34 6HF C18 C17 sing Y N 35 6HF C18 C19 sing Y N 36 6HF C17 N21 sing Y N 37 6HF C19 C20 doub Y N 38 6HF N21 C20 sing Y N 39 6HF C01 H012 sing N N 40 6HF C01 H011 sing N N 41 6HF C01 H013 sing N N 42 6HF C03 H032 sing N N 43 6HF C03 H031 sing N N 44 6HF C04 H042 sing N N 45 6HF C04 H041 sing N N 46 6HF C05 H051 sing N N 47 6HF C05 H052 sing N N 48 6HF C06 H062 sing N N 49 6HF C06 H061 sing N N 50 6HF C09 H091 sing N N 51 6HF C10 H101 sing N N 52 6HF C11 H111 sing N N 53 6HF C12 H121 sing N N 54 6HF N14 H141 sing N N 55 6HF C19 H191 sing N N 56 6HF C20 H201 sing N N 57 6HF N21 H211 sing N N 58 6HF C25 H251 sing N N 59 6HF C26 H261 sing N N 60 6HF N28 H281 sing N N 61 6HF C30 H301 sing N N 62 6HF C31 H312 sing N N 63 6HF C31 H311 sing N N 64 6HF C33 H331 sing N N 65 6HF C34 H341 sing N N 66 ALA N CA sing N N 67 ALA N H sing N N 68 ALA N H2 sing N N 69 ALA CA C sing N N 70 ALA CA CB sing N N 71 ALA CA HA sing N N 72 ALA C O doub N N 73 ALA C OXT sing N N 74 ALA CB HB1 sing N N 75 ALA CB HB2 sing N N 76 ALA CB HB3 sing N N 77 ALA OXT HXT sing N N 78 ARG N CA sing N N 79 ARG N H sing N N 80 ARG N H2 sing N N 81 ARG CA C sing N N 82 ARG CA CB sing N N 83 ARG CA HA sing N N 84 ARG C O doub N N 85 ARG C OXT sing N N 86 ARG CB CG sing N N 87 ARG CB HB2 sing N N 88 ARG CB HB3 sing N N 89 ARG CG CD sing N N 90 ARG CG HG2 sing N N 91 ARG CG HG3 sing N N 92 ARG CD NE sing N N 93 ARG CD HD2 sing N N 94 ARG CD HD3 sing N N 95 ARG NE CZ sing N N 96 ARG NE HE sing N N 97 ARG CZ NH1 sing N N 98 ARG CZ NH2 doub N N 99 ARG NH1 HH11 sing N N 100 ARG NH1 HH12 sing N N 101 ARG NH2 HH21 sing N N 102 ARG NH2 HH22 sing N N 103 ARG OXT HXT sing N N 104 ASN N CA sing N N 105 ASN N H sing N N 106 ASN N H2 sing N N 107 ASN CA C sing N N 108 ASN CA CB sing N N 109 ASN CA HA sing N N 110 ASN C O doub N N 111 ASN C OXT sing N N 112 ASN CB CG sing N N 113 ASN CB HB2 sing N N 114 ASN CB HB3 sing N N 115 ASN CG OD1 doub N N 116 ASN CG ND2 sing N N 117 ASN ND2 HD21 sing N N 118 ASN ND2 HD22 sing N N 119 ASN OXT HXT sing N N 120 ASP N CA sing N N 121 ASP N H sing N N 122 ASP N H2 sing N N 123 ASP CA C sing N N 124 ASP CA CB sing N N 125 ASP CA HA sing N N 126 ASP C O doub N N 127 ASP C OXT sing N N 128 ASP CB CG sing N N 129 ASP CB HB2 sing N N 130 ASP CB HB3 sing N N 131 ASP CG OD1 doub N N 132 ASP CG OD2 sing N N 133 ASP OD2 HD2 sing N N 134 ASP OXT HXT sing N N 135 CYS N CA sing N N 136 CYS N H sing N N 137 CYS N H2 sing N N 138 CYS CA C sing N N 139 CYS CA CB sing N N 140 CYS CA HA sing N N 141 CYS C O doub N N 142 CYS C OXT sing N N 143 CYS CB SG sing N N 144 CYS CB HB2 sing N N 145 CYS CB HB3 sing N N 146 CYS SG HG sing N N 147 CYS OXT HXT sing N N 148 GLN N CA sing N N 149 GLN N H sing N N 150 GLN N H2 sing N N 151 GLN CA C sing N N 152 GLN CA CB sing N N 153 GLN CA HA sing N N 154 GLN C O doub N N 155 GLN C OXT sing N N 156 GLN CB CG sing N N 157 GLN CB HB2 sing N N 158 GLN CB HB3 sing N N 159 GLN CG CD sing N N 160 GLN CG HG2 sing N N 161 GLN CG HG3 sing N N 162 GLN CD OE1 doub N N 163 GLN CD NE2 sing N N 164 GLN NE2 HE21 sing N N 165 GLN NE2 HE22 sing N N 166 GLN OXT HXT sing N N 167 GLU N CA sing N N 168 GLU N H sing N N 169 GLU N H2 sing N N 170 GLU CA C sing N N 171 GLU CA CB sing N N 172 GLU CA HA sing N N 173 GLU C O doub N N 174 GLU C OXT sing N N 175 GLU CB CG sing N N 176 GLU CB HB2 sing N N 177 GLU CB HB3 sing N N 178 GLU CG CD sing N N 179 GLU CG HG2 sing N N 180 GLU CG HG3 sing N N 181 GLU CD OE1 doub N N 182 GLU CD OE2 sing N N 183 GLU OE2 HE2 sing N N 184 GLU OXT HXT sing N N 185 GLY N CA sing N N 186 GLY N H sing N N 187 GLY N H2 sing N N 188 GLY CA C sing N N 189 GLY CA HA2 sing N N 190 GLY CA HA3 sing N N 191 GLY C O doub N N 192 GLY C OXT sing N N 193 GLY OXT HXT sing N N 194 HIS N CA sing N N 195 HIS N H sing N N 196 HIS N H2 sing N N 197 HIS CA C sing N N 198 HIS CA CB sing N N 199 HIS CA HA sing N N 200 HIS C O doub N N 201 HIS C OXT sing N N 202 HIS CB CG sing N N 203 HIS CB HB2 sing N N 204 HIS CB HB3 sing N N 205 HIS CG ND1 sing Y N 206 HIS CG CD2 doub Y N 207 HIS ND1 CE1 doub Y N 208 HIS ND1 HD1 sing N N 209 HIS CD2 NE2 sing Y N 210 HIS CD2 HD2 sing N N 211 HIS CE1 NE2 sing Y N 212 HIS CE1 HE1 sing N N 213 HIS NE2 HE2 sing N N 214 HIS OXT HXT sing N N 215 HOH O H1 sing N N 216 HOH O H2 sing N N 217 ILE N CA sing N N 218 ILE N H sing N N 219 ILE N H2 sing N N 220 ILE CA C sing N N 221 ILE CA CB sing N N 222 ILE CA HA sing N N 223 ILE C O doub N N 224 ILE C OXT sing N N 225 ILE CB CG1 sing N N 226 ILE CB CG2 sing N N 227 ILE CB HB sing N N 228 ILE CG1 CD1 sing N N 229 ILE CG1 HG12 sing N N 230 ILE CG1 HG13 sing N N 231 ILE CG2 HG21 sing N N 232 ILE CG2 HG22 sing N N 233 ILE CG2 HG23 sing N N 234 ILE CD1 HD11 sing N N 235 ILE CD1 HD12 sing N N 236 ILE CD1 HD13 sing N N 237 ILE OXT HXT sing N N 238 LEU N CA sing N N 239 LEU N H sing N N 240 LEU N H2 sing N N 241 LEU CA C sing N N 242 LEU CA CB sing N N 243 LEU CA HA sing N N 244 LEU C O doub N N 245 LEU C OXT sing N N 246 LEU CB CG sing N N 247 LEU CB HB2 sing N N 248 LEU CB HB3 sing N N 249 LEU CG CD1 sing N N 250 LEU CG CD2 sing N N 251 LEU CG HG sing N N 252 LEU CD1 HD11 sing N N 253 LEU CD1 HD12 sing N N 254 LEU CD1 HD13 sing N N 255 LEU CD2 HD21 sing N N 256 LEU CD2 HD22 sing N N 257 LEU CD2 HD23 sing N N 258 LEU OXT HXT sing N N 259 LYS N CA sing N N 260 LYS N H sing N N 261 LYS N H2 sing N N 262 LYS CA C sing N N 263 LYS CA CB sing N N 264 LYS CA HA sing N N 265 LYS C O doub N N 266 LYS C OXT sing N N 267 LYS CB CG sing N N 268 LYS CB HB2 sing N N 269 LYS CB HB3 sing N N 270 LYS CG CD sing N N 271 LYS CG HG2 sing N N 272 LYS CG HG3 sing N N 273 LYS CD CE sing N N 274 LYS CD HD2 sing N N 275 LYS CD HD3 sing N N 276 LYS CE NZ sing N N 277 LYS CE HE2 sing N N 278 LYS CE HE3 sing N N 279 LYS NZ HZ1 sing N N 280 LYS NZ HZ2 sing N N 281 LYS NZ HZ3 sing N N 282 LYS OXT HXT sing N N 283 MET N CA sing N N 284 MET N H sing N N 285 MET N H2 sing N N 286 MET CA C sing N N 287 MET CA CB sing N N 288 MET CA HA sing N N 289 MET C O doub N N 290 MET C OXT sing N N 291 MET CB CG sing N N 292 MET CB HB2 sing N N 293 MET CB HB3 sing N N 294 MET CG SD sing N N 295 MET CG HG2 sing N N 296 MET CG HG3 sing N N 297 MET SD CE sing N N 298 MET CE HE1 sing N N 299 MET CE HE2 sing N N 300 MET CE HE3 sing N N 301 MET OXT HXT sing N N 302 PHE N CA sing N N 303 PHE N H sing N N 304 PHE N H2 sing N N 305 PHE CA C sing N N 306 PHE CA CB sing N N 307 PHE CA HA sing N N 308 PHE C O doub N N 309 PHE C OXT sing N N 310 PHE CB CG sing N N 311 PHE CB HB2 sing N N 312 PHE CB HB3 sing N N 313 PHE CG CD1 doub Y N 314 PHE CG CD2 sing Y N 315 PHE CD1 CE1 sing Y N 316 PHE CD1 HD1 sing N N 317 PHE CD2 CE2 doub Y N 318 PHE CD2 HD2 sing N N 319 PHE CE1 CZ doub Y N 320 PHE CE1 HE1 sing N N 321 PHE CE2 CZ sing Y N 322 PHE CE2 HE2 sing N N 323 PHE CZ HZ sing N N 324 PHE OXT HXT sing N N 325 PRO N CA sing N N 326 PRO N CD sing N N 327 PRO N H sing N N 328 PRO CA C sing N N 329 PRO CA CB sing N N 330 PRO CA HA sing N N 331 PRO C O doub N N 332 PRO C OXT sing N N 333 PRO CB CG sing N N 334 PRO CB HB2 sing N N 335 PRO CB HB3 sing N N 336 PRO CG CD sing N N 337 PRO CG HG2 sing N N 338 PRO CG HG3 sing N N 339 PRO CD HD2 sing N N 340 PRO CD HD3 sing N N 341 PRO OXT HXT sing N N 342 SER N CA sing N N 343 SER N H sing N N 344 SER N H2 sing N N 345 SER CA C sing N N 346 SER CA CB sing N N 347 SER CA HA sing N N 348 SER C O doub N N 349 SER C OXT sing N N 350 SER CB OG sing N N 351 SER CB HB2 sing N N 352 SER CB HB3 sing N N 353 SER OG HG sing N N 354 SER OXT HXT sing N N 355 THR N CA sing N N 356 THR N H sing N N 357 THR N H2 sing N N 358 THR CA C sing N N 359 THR CA CB sing N N 360 THR CA HA sing N N 361 THR C O doub N N 362 THR C OXT sing N N 363 THR CB OG1 sing N N 364 THR CB CG2 sing N N 365 THR CB HB sing N N 366 THR OG1 HG1 sing N N 367 THR CG2 HG21 sing N N 368 THR CG2 HG22 sing N N 369 THR CG2 HG23 sing N N 370 THR OXT HXT sing N N 371 TRP N CA sing N N 372 TRP N H sing N N 373 TRP N H2 sing N N 374 TRP CA C sing N N 375 TRP CA CB sing N N 376 TRP CA HA sing N N 377 TRP C O doub N N 378 TRP C OXT sing N N 379 TRP CB CG sing N N 380 TRP CB HB2 sing N N 381 TRP CB HB3 sing N N 382 TRP CG CD1 doub Y N 383 TRP CG CD2 sing Y N 384 TRP CD1 NE1 sing Y N 385 TRP CD1 HD1 sing N N 386 TRP CD2 CE2 doub Y N 387 TRP CD2 CE3 sing Y N 388 TRP NE1 CE2 sing Y N 389 TRP NE1 HE1 sing N N 390 TRP CE2 CZ2 sing Y N 391 TRP CE3 CZ3 doub Y N 392 TRP CE3 HE3 sing N N 393 TRP CZ2 CH2 doub Y N 394 TRP CZ2 HZ2 sing N N 395 TRP CZ3 CH2 sing Y N 396 TRP CZ3 HZ3 sing N N 397 TRP CH2 HH2 sing N N 398 TRP OXT HXT sing N N 399 TYR N CA sing N N 400 TYR N H sing N N 401 TYR N H2 sing N N 402 TYR CA C sing N N 403 TYR CA CB sing N N 404 TYR CA HA sing N N 405 TYR C O doub N N 406 TYR C OXT sing N N 407 TYR CB CG sing N N 408 TYR CB HB2 sing N N 409 TYR CB HB3 sing N N 410 TYR CG CD1 doub Y N 411 TYR CG CD2 sing Y N 412 TYR CD1 CE1 sing Y N 413 TYR CD1 HD1 sing N N 414 TYR CD2 CE2 doub Y N 415 TYR CD2 HD2 sing N N 416 TYR CE1 CZ doub Y N 417 TYR CE1 HE1 sing N N 418 TYR CE2 CZ sing Y N 419 TYR CE2 HE2 sing N N 420 TYR CZ OH sing N N 421 TYR OH HH sing N N 422 TYR OXT HXT sing N N 423 VAL N CA sing N N 424 VAL N H sing N N 425 VAL N H2 sing N N 426 VAL CA C sing N N 427 VAL CA CB sing N N 428 VAL CA HA sing N N 429 VAL C O doub N N 430 VAL C OXT sing N N 431 VAL CB CG1 sing N N 432 VAL CB CG2 sing N N 433 VAL CB HB sing N N 434 VAL CG1 HG11 sing N N 435 VAL CG1 HG12 sing N N 436 VAL CG1 HG13 sing N N 437 VAL CG2 HG21 sing N N 438 VAL CG2 HG22 sing N N 439 VAL CG2 HG23 sing N N 440 VAL OXT HXT sing N N 441 # _pdbx_audit_support.funding_organization 'Cancer Prevention and Research Institute of Texas (CPRIT)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'CPRIT R1207 and CPRIT RP140233' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(4-((2-((4-(4-methylpiperazin-1-yl)phenyl)amino)-7H-pyrrolo[2,3-d]pyrimidin-4-yl)oxy)phenyl)acrylamide' 6HF 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4O91 _pdbx_initial_refinement_model.details ? #