data_5JLU # _entry.id 5JLU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JLU pdb_00005jlu 10.2210/pdb5jlu/pdb WWPDB D_1000220853 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Crystal Structure of Adhesin competence repressor (AdcR) from Streptococcus pyogenes (C-terminally His tagged)' _pdbx_database_related.db_id 5JLS _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JLU _pdbx_database_status.recvd_initial_deposition_date 2016-04-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Do, H.' 1 'Kumaraswami, M.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Adhesin competence repressor (AdcR) from Streptococcus pyogenes' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Do, H.' 1 ? primary 'Kumaraswami, M.' 2 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5JLU _cell.details ? _cell.formula_units_Z ? _cell.length_a 105.460 _cell.length_a_esd ? _cell.length_b 105.460 _cell.length_b_esd ? _cell.length_c 36.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JLU _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Adhesin competence repressor' 16836.217 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 37 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name AdcR # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILMLLSQQRLTNTDLAKALNISQAAVTKAIKSLVK QDMLAGTKDTVDARVTYFELTELAKPIASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILMLLSQQRLTNTDLAKALNISQAAVTKAIKSLVK QDMLAGTKDTVDARVTYFELTELAKPIASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 THR n 1 7 LEU n 1 8 GLU n 1 9 LYS n 1 10 LYS n 1 11 LEU n 1 12 ASP n 1 13 ASN n 1 14 LEU n 1 15 VAL n 1 16 ASN n 1 17 THR n 1 18 ILE n 1 19 LEU n 1 20 LEU n 1 21 LYS n 1 22 ALA n 1 23 GLU n 1 24 ASN n 1 25 GLN n 1 26 HIS n 1 27 GLU n 1 28 LEU n 1 29 LEU n 1 30 PHE n 1 31 GLY n 1 32 ALA n 1 33 CYS n 1 34 GLN n 1 35 SER n 1 36 ASP n 1 37 VAL n 1 38 LYS n 1 39 LEU n 1 40 THR n 1 41 ASN n 1 42 THR n 1 43 GLN n 1 44 GLU n 1 45 HIS n 1 46 ILE n 1 47 LEU n 1 48 MET n 1 49 LEU n 1 50 LEU n 1 51 SER n 1 52 GLN n 1 53 GLN n 1 54 ARG n 1 55 LEU n 1 56 THR n 1 57 ASN n 1 58 THR n 1 59 ASP n 1 60 LEU n 1 61 ALA n 1 62 LYS n 1 63 ALA n 1 64 LEU n 1 65 ASN n 1 66 ILE n 1 67 SER n 1 68 GLN n 1 69 ALA n 1 70 ALA n 1 71 VAL n 1 72 THR n 1 73 LYS n 1 74 ALA n 1 75 ILE n 1 76 LYS n 1 77 SER n 1 78 LEU n 1 79 VAL n 1 80 LYS n 1 81 GLN n 1 82 ASP n 1 83 MET n 1 84 LEU n 1 85 ALA n 1 86 GLY n 1 87 THR n 1 88 LYS n 1 89 ASP n 1 90 THR n 1 91 VAL n 1 92 ASP n 1 93 ALA n 1 94 ARG n 1 95 VAL n 1 96 THR n 1 97 TYR n 1 98 PHE n 1 99 GLU n 1 100 LEU n 1 101 THR n 1 102 GLU n 1 103 LEU n 1 104 ALA n 1 105 LYS n 1 106 PRO n 1 107 ILE n 1 108 ALA n 1 109 SER n 1 110 GLU n 1 111 HIS n 1 112 THR n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 ASP n 1 117 GLU n 1 118 THR n 1 119 LEU n 1 120 ASN n 1 121 VAL n 1 122 TYR n 1 123 ASN n 1 124 ARG n 1 125 LEU n 1 126 LEU n 1 127 GLN n 1 128 LYS n 1 129 PHE n 1 130 SER n 1 131 ALA n 1 132 LYS n 1 133 GLU n 1 134 LEU n 1 135 GLU n 1 136 ILE n 1 137 VAL n 1 138 ASP n 1 139 LYS n 1 140 PHE n 1 141 VAL n 1 142 THR n 1 143 VAL n 1 144 PHE n 1 145 ALA n 1 146 GLU n 1 147 GLU n 1 148 LEU n 1 149 GLU n 1 150 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'adcR, SpyM3_0069' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pyogenes serotype M3' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 301448 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0H2USX5_STRP3 _struct_ref.pdbx_db_accession A0A0H2USX5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILMLLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDM LAGTKDTVDARVTYFELTELAKPIASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JLU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0H2USX5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5JLU GLY A 1 ? UNP A0A0H2USX5 ? ? 'expression tag' -2 1 1 5JLU SER A 2 ? UNP A0A0H2USX5 ? ? 'expression tag' -1 2 1 5JLU HIS A 3 ? UNP A0A0H2USX5 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JLU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium/phosphate phosphate, pH 7.2, 30% PEG200' _exptl_crystal_grow.pdbx_pH_range 6.8-7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-01-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.115 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.115 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5JLU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 29.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10996 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.07 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.668 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.44 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.44 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.89 _refine.B_iso_max ? _refine.B_iso_mean 53.757 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.957 _refine.correlation_coeff_Fo_to_Fc_free 0.937 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5JLU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 26.36 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10356 _refine.ls_number_reflns_R_free 598 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.38 _refine.ls_percent_reflns_R_free 5.5 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20358 _refine.ls_R_factor_R_free 0.24241 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20146 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 5JLS' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.042 _refine.pdbx_overall_ESU_R_Free 0.038 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.067 _refine.overall_SU_ML 0.107 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1086 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1124 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 26.36 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.019 1097 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1103 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.983 1.967 1481 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.074 3.000 2538 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.828 5.000 135 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 42.393 26.400 50 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.020 15.000 216 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.944 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.114 0.200 185 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1211 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 228 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.368 4.922 546 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.371 4.914 545 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.058 7.307 679 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.052 7.318 680 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.671 5.681 550 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.665 5.689 551 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 9.910 8.207 803 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 11.420 38.824 1238 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 11.432 38.773 1227 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.200 _refine_ls_shell.d_res_low 2.257 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.number_reflns_R_work 740 _refine_ls_shell.percent_reflns_obs 99.62 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.223 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.181 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5JLU _struct.title 'Crystal Structure of Adhesin competence repressor (AdcR) from Streptococcus pyogenes' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JLU _struct_keywords.text 'Metal-sensing transcription regulator, DNA binding protein, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ASN A 24 ? THR A 3 ASN A 21 1 ? 19 HELX_P HELX_P2 AA2 THR A 40 ? GLN A 53 ? THR A 37 GLN A 50 1 ? 14 HELX_P HELX_P3 AA3 ASN A 57 ? ASN A 65 ? ASN A 54 ASN A 62 1 ? 9 HELX_P HELX_P4 AA4 SER A 67 ? GLN A 81 ? SER A 64 GLN A 78 1 ? 15 HELX_P HELX_P5 AA5 ALA A 104 ? LYS A 128 ? ALA A 101 LYS A 125 1 ? 25 HELX_P HELX_P6 AA6 SER A 130 ? GLY A 150 ? SER A 127 GLY A 147 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 45 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.120 ? ? metalc2 metalc ? ? A HIS 111 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 108 A ZN 201 1_555 ? ? ? ? ? ? ? 2.121 ? ? metalc3 metalc ? ? A HIS 115 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 112 A ZN 201 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C HOH . O ? ? A ZN 201 A HOH 303 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C HOH . O ? ? A ZN 201 A HOH 310 8_555 ? ? ? ? ? ? ? 2.175 ? ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 C HOH . O ? ? A ZN 201 A HOH 311 1_555 ? ? ? ? ? ? ? 2.026 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 55 ? THR A 56 ? LEU A 52 THR A 53 AA1 2 THR A 96 ? LEU A 100 ? THR A 93 LEU A 97 AA1 3 LEU A 84 ? LYS A 88 ? LEU A 81 LYS A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 55 ? N LEU A 52 O PHE A 98 ? O PHE A 95 AA1 2 3 O GLU A 99 ? O GLU A 96 N ALA A 85 ? N ALA A 82 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 45 ? HIS A 42 . ? 1_555 ? 2 AC1 6 HIS A 111 ? HIS A 108 . ? 1_555 ? 3 AC1 6 HIS A 115 ? HIS A 112 . ? 1_555 ? 4 AC1 6 HOH C . ? HOH A 303 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 310 . ? 8_555 ? 6 AC1 6 HOH C . ? HOH A 311 . ? 1_555 ? # _atom_sites.entry_id 5JLU _atom_sites.fract_transf_matrix[1][1] 0.009482 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009482 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027248 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 GLY 5 2 2 GLY GLY A . n A 1 6 THR 6 3 3 THR THR A . n A 1 7 LEU 7 4 4 LEU LEU A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 LYS 9 6 6 LYS LYS A . n A 1 10 LYS 10 7 7 LYS LYS A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 ASP 12 9 9 ASP ASP A . n A 1 13 ASN 13 10 10 ASN ASN A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 VAL 15 12 12 VAL VAL A . n A 1 16 ASN 16 13 13 ASN ASN A . n A 1 17 THR 17 14 14 THR THR A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 ALA 22 19 19 ALA ALA A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 ASN 24 21 21 ASN ASN A . n A 1 25 GLN 25 22 22 GLN GLN A . n A 1 26 HIS 26 23 23 HIS HIS A . n A 1 27 GLU 27 24 ? ? ? A . n A 1 28 LEU 28 25 ? ? ? A . n A 1 29 LEU 29 26 ? ? ? A . n A 1 30 PHE 30 27 ? ? ? A . n A 1 31 GLY 31 28 ? ? ? A . n A 1 32 ALA 32 29 ? ? ? A . n A 1 33 CYS 33 30 ? ? ? A . n A 1 34 GLN 34 31 ? ? ? A . n A 1 35 SER 35 32 ? ? ? A . n A 1 36 ASP 36 33 33 ASP ASP A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 LYS 38 35 35 LYS LYS A . n A 1 39 LEU 39 36 36 LEU LEU A . n A 1 40 THR 40 37 37 THR THR A . n A 1 41 ASN 41 38 38 ASN ASN A . n A 1 42 THR 42 39 39 THR THR A . n A 1 43 GLN 43 40 40 GLN GLN A . n A 1 44 GLU 44 41 41 GLU GLU A . n A 1 45 HIS 45 42 42 HIS HIS A . n A 1 46 ILE 46 43 43 ILE ILE A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 MET 48 45 45 MET MET A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 LEU 50 47 47 LEU LEU A . n A 1 51 SER 51 48 48 SER SER A . n A 1 52 GLN 52 49 49 GLN GLN A . n A 1 53 GLN 53 50 50 GLN GLN A . n A 1 54 ARG 54 51 51 ARG ARG A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 THR 56 53 53 THR THR A . n A 1 57 ASN 57 54 54 ASN ASN A . n A 1 58 THR 58 55 55 THR THR A . n A 1 59 ASP 59 56 56 ASP ASP A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 ALA 61 58 58 ALA ALA A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 ALA 63 60 60 ALA ALA A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 ASN 65 62 62 ASN ASN A . n A 1 66 ILE 66 63 63 ILE ILE A . n A 1 67 SER 67 64 64 SER SER A . n A 1 68 GLN 68 65 65 GLN GLN A . n A 1 69 ALA 69 66 66 ALA ALA A . n A 1 70 ALA 70 67 67 ALA ALA A . n A 1 71 VAL 71 68 68 VAL VAL A . n A 1 72 THR 72 69 69 THR THR A . n A 1 73 LYS 73 70 70 LYS LYS A . n A 1 74 ALA 74 71 71 ALA ALA A . n A 1 75 ILE 75 72 72 ILE ILE A . n A 1 76 LYS 76 73 73 LYS LYS A . n A 1 77 SER 77 74 74 SER SER A . n A 1 78 LEU 78 75 75 LEU LEU A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 LYS 80 77 77 LYS LYS A . n A 1 81 GLN 81 78 78 GLN GLN A . n A 1 82 ASP 82 79 79 ASP ASP A . n A 1 83 MET 83 80 80 MET MET A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 ALA 85 82 82 ALA ALA A . n A 1 86 GLY 86 83 83 GLY GLY A . n A 1 87 THR 87 84 84 THR THR A . n A 1 88 LYS 88 85 85 LYS LYS A . n A 1 89 ASP 89 86 86 ASP ASP A . n A 1 90 THR 90 87 87 THR THR A . n A 1 91 VAL 91 88 88 VAL VAL A . n A 1 92 ASP 92 89 89 ASP ASP A . n A 1 93 ALA 93 90 90 ALA ALA A . n A 1 94 ARG 94 91 91 ARG ARG A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 THR 96 93 93 THR THR A . n A 1 97 TYR 97 94 94 TYR TYR A . n A 1 98 PHE 98 95 95 PHE PHE A . n A 1 99 GLU 99 96 96 GLU GLU A . n A 1 100 LEU 100 97 97 LEU LEU A . n A 1 101 THR 101 98 98 THR THR A . n A 1 102 GLU 102 99 99 GLU GLU A . n A 1 103 LEU 103 100 100 LEU LEU A . n A 1 104 ALA 104 101 101 ALA ALA A . n A 1 105 LYS 105 102 102 LYS LYS A . n A 1 106 PRO 106 103 103 PRO PRO A . n A 1 107 ILE 107 104 104 ILE ILE A . n A 1 108 ALA 108 105 105 ALA ALA A . n A 1 109 SER 109 106 106 SER SER A . n A 1 110 GLU 110 107 107 GLU GLU A . n A 1 111 HIS 111 108 108 HIS HIS A . n A 1 112 THR 112 109 109 THR THR A . n A 1 113 HIS 113 110 110 HIS HIS A . n A 1 114 HIS 114 111 111 HIS HIS A . n A 1 115 HIS 115 112 112 HIS HIS A . n A 1 116 ASP 116 113 113 ASP ASP A . n A 1 117 GLU 117 114 114 GLU GLU A . n A 1 118 THR 118 115 115 THR THR A . n A 1 119 LEU 119 116 116 LEU LEU A . n A 1 120 ASN 120 117 117 ASN ASN A . n A 1 121 VAL 121 118 118 VAL VAL A . n A 1 122 TYR 122 119 119 TYR TYR A . n A 1 123 ASN 123 120 120 ASN ASN A . n A 1 124 ARG 124 121 121 ARG ARG A . n A 1 125 LEU 125 122 122 LEU LEU A . n A 1 126 LEU 126 123 123 LEU LEU A . n A 1 127 GLN 127 124 124 GLN GLN A . n A 1 128 LYS 128 125 125 LYS LYS A . n A 1 129 PHE 129 126 126 PHE PHE A . n A 1 130 SER 130 127 127 SER SER A . n A 1 131 ALA 131 128 128 ALA ALA A . n A 1 132 LYS 132 129 129 LYS LYS A . n A 1 133 GLU 133 130 130 GLU GLU A . n A 1 134 LEU 134 131 131 LEU LEU A . n A 1 135 GLU 135 132 132 GLU GLU A . n A 1 136 ILE 136 133 133 ILE ILE A . n A 1 137 VAL 137 134 134 VAL VAL A . n A 1 138 ASP 138 135 135 ASP ASP A . n A 1 139 LYS 139 136 136 LYS LYS A . n A 1 140 PHE 140 137 137 PHE PHE A . n A 1 141 VAL 141 138 138 VAL VAL A . n A 1 142 THR 142 139 139 THR THR A . n A 1 143 VAL 143 140 140 VAL VAL A . n A 1 144 PHE 144 141 141 PHE PHE A . n A 1 145 ALA 145 142 142 ALA ALA A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 GLU 147 144 144 GLU GLU A . n A 1 148 LEU 148 145 145 LEU LEU A . n A 1 149 GLU 149 146 146 GLU GLU A . n A 1 150 GLY 150 147 147 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 3 HOH 1 301 29 HOH HOH A . C 3 HOH 2 302 8 HOH HOH A . C 3 HOH 3 303 12 HOH HOH A . C 3 HOH 4 304 7 HOH HOH A . C 3 HOH 5 305 13 HOH HOH A . C 3 HOH 6 306 9 HOH HOH A . C 3 HOH 7 307 23 HOH HOH A . C 3 HOH 8 308 14 HOH HOH A . C 3 HOH 9 309 22 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 28 HOH HOH A . C 3 HOH 13 313 18 HOH HOH A . C 3 HOH 14 314 31 HOH HOH A . C 3 HOH 15 315 6 HOH HOH A . C 3 HOH 16 316 26 HOH HOH A . C 3 HOH 17 317 36 HOH HOH A . C 3 HOH 18 318 35 HOH HOH A . C 3 HOH 19 319 32 HOH HOH A . C 3 HOH 20 320 15 HOH HOH A . C 3 HOH 21 321 5 HOH HOH A . C 3 HOH 22 322 2 HOH HOH A . C 3 HOH 23 323 40 HOH HOH A . C 3 HOH 24 324 16 HOH HOH A . C 3 HOH 25 325 24 HOH HOH A . C 3 HOH 26 326 37 HOH HOH A . C 3 HOH 27 327 33 HOH HOH A . C 3 HOH 28 328 27 HOH HOH A . C 3 HOH 29 329 34 HOH HOH A . C 3 HOH 30 330 41 HOH HOH A . C 3 HOH 31 331 17 HOH HOH A . C 3 HOH 32 332 1 HOH HOH A . C 3 HOH 33 333 39 HOH HOH A . C 3 HOH 34 334 4 HOH HOH A . C 3 HOH 35 335 30 HOH HOH A . C 3 HOH 36 336 3 HOH HOH A . C 3 HOH 37 337 38 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5610 ? 1 MORE -117 ? 1 'SSA (A^2)' 15910 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 45 ? A HIS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 111 ? A HIS 108 ? 1_555 96.0 ? 2 NE2 ? A HIS 45 ? A HIS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 115 ? A HIS 112 ? 1_555 96.5 ? 3 NE2 ? A HIS 111 ? A HIS 108 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 115 ? A HIS 112 ? 1_555 91.0 ? 4 NE2 ? A HIS 45 ? A HIS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 303 ? 1_555 94.5 ? 5 NE2 ? A HIS 111 ? A HIS 108 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 303 ? 1_555 89.0 ? 6 NE2 ? A HIS 115 ? A HIS 112 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 303 ? 1_555 169.0 ? 7 NE2 ? A HIS 45 ? A HIS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 310 ? 8_555 88.0 ? 8 NE2 ? A HIS 111 ? A HIS 108 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 310 ? 8_555 174.6 ? 9 NE2 ? A HIS 115 ? A HIS 112 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 310 ? 8_555 92.3 ? 10 O ? C HOH . ? A HOH 303 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 310 ? 8_555 87.0 ? 11 NE2 ? A HIS 45 ? A HIS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 311 ? 1_555 173.2 ? 12 NE2 ? A HIS 111 ? A HIS 108 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 311 ? 1_555 90.8 ? 13 NE2 ? A HIS 115 ? A HIS 112 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 311 ? 1_555 83.2 ? 14 O ? C HOH . ? A HOH 303 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 311 ? 1_555 85.8 ? 15 O ? C HOH . ? A HOH 310 ? 8_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 311 ? 1_555 85.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-03 2 'Structure model' 1 1 2017-09-13 3 'Structure model' 1 2 2019-12-11 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 9 4 'Structure model' '_pdbx_struct_conn_angle.value' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASN 21 ? ? CA A ASN 21 ? ? C A ASN 21 ? ? 125.13 110.40 14.73 2.00 N 2 1 CA A LEU 122 ? ? CB A LEU 122 ? ? CG A LEU 122 ? ? 134.83 115.30 19.53 2.30 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 21 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -98.83 _pdbx_validate_torsion.psi -115.56 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 337 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.72 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A GLU 24 ? A GLU 27 6 1 Y 1 A LEU 25 ? A LEU 28 7 1 Y 1 A LEU 26 ? A LEU 29 8 1 Y 1 A PHE 27 ? A PHE 30 9 1 Y 1 A GLY 28 ? A GLY 31 10 1 Y 1 A ALA 29 ? A ALA 32 11 1 Y 1 A CYS 30 ? A CYS 33 12 1 Y 1 A GLN 31 ? A GLN 34 13 1 Y 1 A SER 32 ? A SER 35 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 ZN ZN ZN N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1R01AI109096-01A1 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5JLS _pdbx_initial_refinement_model.details 'PDB entry 5JLS' #