data_5JPR # _entry.id 5JPR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JPR pdb_00005jpr 10.2210/pdb5jpr/pdb WWPDB D_1000221018 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-12-21 2 'Structure model' 2 0 2017-08-30 3 'Structure model' 3 0 2018-10-03 4 'Structure model' 3 1 2018-11-14 5 'Structure model' 3 2 2019-03-06 6 'Structure model' 3 3 2019-10-16 7 'Structure model' 3 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Refinement description' 6 3 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Data collection' 8 5 'Structure model' 'Data collection' 9 6 'Structure model' 'Data collection' 10 7 'Structure model' 'Data collection' 11 7 'Structure model' 'Database references' 12 7 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' atom_site 4 3 'Structure model' entity_src_gen 5 3 'Structure model' refine 6 4 'Structure model' diffrn_source 7 5 'Structure model' diffrn_source 8 6 'Structure model' reflns_shell 9 7 'Structure model' chem_comp_atom 10 7 'Structure model' chem_comp_bond 11 7 'Structure model' database_2 12 7 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_atom_id' 6 2 'Structure model' '_atom_site.auth_seq_id' 7 2 'Structure model' '_atom_site.label_atom_id' 8 2 'Structure model' '_atom_site.type_symbol' 9 2 'Structure model' '_pdbx_audit_support.funding_organization' 10 3 'Structure model' '_atom_site.occupancy' 11 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 12 3 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 13 4 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 14 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 15 4 'Structure model' '_diffrn_source.type' 16 5 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 17 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 18 5 'Structure model' '_diffrn_source.type' 19 7 'Structure model' '_database_2.pdbx_DOI' 20 7 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JPR _pdbx_database_status.recvd_initial_deposition_date 2016-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kwon, H.' 1 'Blakeley, M.P.' 2 'Raven, E.L.' 3 'Moody, P.C.E.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 13445 _citation.page_last 13445 _citation.title 'Direct visualization of a Fe(IV)-OH intermediate in a heme enzyme.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/ncomms13445 _citation.pdbx_database_id_PubMed 27897163 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kwon, H.' 1 ? primary 'Basran, J.' 2 ? primary 'Casadei, C.M.' 3 ? primary 'Fielding, A.J.' 4 ? primary 'Schrader, T.E.' 5 ? primary 'Ostermann, A.' 6 ? primary 'Devos, J.M.' 7 ? primary 'Aller, P.' 8 ? primary 'Blakeley, M.P.' 9 ? primary 'Moody, P.C.' 10 ? primary 'Raven, E.L.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ascorbate peroxidase' 28361.904 1 1.11.1.11 ? ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 390 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytosolic ascorbate peroxidase 1,Uncharacterized protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGSGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHS ANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAM GLTDQDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLVDKYAADED AFFADYAEAHQKLSELGFADA ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGSGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHS ANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAM GLTDQDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLVDKYAADED AFFADYAEAHQKLSELGFADA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 'POTASSIUM ION' K 4 'SULFATE ION' SO4 5 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 GLY n 1 14 LYS n 1 15 SER n 1 16 TYR n 1 17 PRO n 1 18 THR n 1 19 VAL n 1 20 SER n 1 21 ALA n 1 22 ASP n 1 23 TYR n 1 24 GLN n 1 25 LYS n 1 26 ALA n 1 27 VAL n 1 28 GLU n 1 29 LYS n 1 30 ALA n 1 31 LYS n 1 32 LYS n 1 33 LYS n 1 34 LEU n 1 35 ARG n 1 36 GLY n 1 37 PHE n 1 38 ILE n 1 39 ALA n 1 40 GLU n 1 41 LYS n 1 42 ARG n 1 43 CYS n 1 44 ALA n 1 45 PRO n 1 46 LEU n 1 47 MET n 1 48 LEU n 1 49 ARG n 1 50 LEU n 1 51 ALA n 1 52 TRP n 1 53 HIS n 1 54 SER n 1 55 ALA n 1 56 GLY n 1 57 THR n 1 58 PHE n 1 59 ASP n 1 60 LYS n 1 61 GLY n 1 62 THR n 1 63 LYS n 1 64 THR n 1 65 GLY n 1 66 GLY n 1 67 PRO n 1 68 PHE n 1 69 GLY n 1 70 THR n 1 71 ILE n 1 72 LYS n 1 73 HIS n 1 74 PRO n 1 75 ALA n 1 76 GLU n 1 77 LEU n 1 78 ALA n 1 79 HIS n 1 80 SER n 1 81 ALA n 1 82 ASN n 1 83 ASN n 1 84 GLY n 1 85 LEU n 1 86 ASP n 1 87 ILE n 1 88 ALA n 1 89 VAL n 1 90 ARG n 1 91 LEU n 1 92 LEU n 1 93 GLU n 1 94 PRO n 1 95 LEU n 1 96 LYS n 1 97 ALA n 1 98 GLU n 1 99 PHE n 1 100 PRO n 1 101 ILE n 1 102 LEU n 1 103 SER n 1 104 TYR n 1 105 ALA n 1 106 ASP n 1 107 PHE n 1 108 TYR n 1 109 GLN n 1 110 LEU n 1 111 ALA n 1 112 GLY n 1 113 VAL n 1 114 VAL n 1 115 ALA n 1 116 VAL n 1 117 GLU n 1 118 VAL n 1 119 THR n 1 120 GLY n 1 121 GLY n 1 122 PRO n 1 123 GLU n 1 124 VAL n 1 125 PRO n 1 126 PHE n 1 127 HIS n 1 128 PRO n 1 129 GLY n 1 130 ARG n 1 131 GLU n 1 132 ASP n 1 133 LYS n 1 134 PRO n 1 135 GLU n 1 136 PRO n 1 137 PRO n 1 138 PRO n 1 139 GLU n 1 140 GLY n 1 141 ARG n 1 142 LEU n 1 143 PRO n 1 144 ASP n 1 145 ALA n 1 146 THR n 1 147 LYS n 1 148 GLY n 1 149 SER n 1 150 ASP n 1 151 HIS n 1 152 LEU n 1 153 ARG n 1 154 ASP n 1 155 VAL n 1 156 PHE n 1 157 GLY n 1 158 LYS n 1 159 ALA n 1 160 MET n 1 161 GLY n 1 162 LEU n 1 163 THR n 1 164 ASP n 1 165 GLN n 1 166 ASP n 1 167 ILE n 1 168 VAL n 1 169 ALA n 1 170 LEU n 1 171 SER n 1 172 GLY n 1 173 GLY n 1 174 HIS n 1 175 THR n 1 176 ILE n 1 177 GLY n 1 178 ALA n 1 179 ALA n 1 180 HIS n 1 181 LYS n 1 182 GLU n 1 183 ARG n 1 184 SER n 1 185 GLY n 1 186 PHE n 1 187 GLU n 1 188 GLY n 1 189 PRO n 1 190 TRP n 1 191 THR n 1 192 SER n 1 193 ASN n 1 194 PRO n 1 195 LEU n 1 196 ILE n 1 197 PHE n 1 198 ASP n 1 199 ASN n 1 200 SER n 1 201 TYR n 1 202 PHE n 1 203 THR n 1 204 GLU n 1 205 LEU n 1 206 LEU n 1 207 SER n 1 208 GLY n 1 209 GLU n 1 210 LYS n 1 211 GLU n 1 212 GLY n 1 213 LEU n 1 214 LEU n 1 215 GLN n 1 216 LEU n 1 217 PRO n 1 218 SER n 1 219 ASP n 1 220 LYS n 1 221 ALA n 1 222 LEU n 1 223 LEU n 1 224 SER n 1 225 ASP n 1 226 PRO n 1 227 VAL n 1 228 PHE n 1 229 ARG n 1 230 PRO n 1 231 LEU n 1 232 VAL n 1 233 ASP n 1 234 LYS n 1 235 TYR n 1 236 ALA n 1 237 ALA n 1 238 ASP n 1 239 GLU n 1 240 ASP n 1 241 ALA n 1 242 PHE n 1 243 PHE n 1 244 ALA n 1 245 ASP n 1 246 TYR n 1 247 ALA n 1 248 GLU n 1 249 ALA n 1 250 HIS n 1 251 GLN n 1 252 LYS n 1 253 LEU n 1 254 SER n 1 255 GLU n 1 256 LEU n 1 257 GLY n 1 258 PHE n 1 259 ALA n 1 260 ASP n 1 261 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 261 _entity_src_gen.gene_src_common_name Soybean _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'apx1, GLYMA_U021900' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Glycine max' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3847 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -10 ? ? ? A . n A 1 2 ARG 2 -9 ? ? ? A . n A 1 3 GLY 3 -8 ? ? ? A . n A 1 4 SER 4 -7 ? ? ? A . n A 1 5 HIS 5 -6 ? ? ? A . n A 1 6 HIS 6 -5 ? ? ? A . n A 1 7 HIS 7 -4 ? ? ? A . n A 1 8 HIS 8 -3 ? ? ? A . n A 1 9 HIS 9 -2 ? ? ? A . n A 1 10 HIS 10 -1 ? ? ? A . n A 1 11 GLY 11 0 ? ? ? A . n A 1 12 SER 12 1 ? ? ? A . n A 1 13 GLY 13 2 2 GLY GLY A . n A 1 14 LYS 14 3 3 LYS LYS A . n A 1 15 SER 15 4 4 SER SER A . n A 1 16 TYR 16 5 5 TYR TYR A . n A 1 17 PRO 17 6 6 PRO PRO A . n A 1 18 THR 18 7 7 THR THR A . n A 1 19 VAL 19 8 8 VAL VAL A . n A 1 20 SER 20 9 9 SER SER A . n A 1 21 ALA 21 10 10 ALA ALA A . n A 1 22 ASP 22 11 11 ASP ASP A . n A 1 23 TYR 23 12 12 TYR TYR A . n A 1 24 GLN 24 13 13 GLN GLN A . n A 1 25 LYS 25 14 14 LYS LYS A . n A 1 26 ALA 26 15 15 ALA ALA A . n A 1 27 VAL 27 16 16 VAL VAL A . n A 1 28 GLU 28 17 17 GLU GLU A . n A 1 29 LYS 29 18 18 LYS LYS A . n A 1 30 ALA 30 19 19 ALA ALA A . n A 1 31 LYS 31 20 20 LYS LYS A . n A 1 32 LYS 32 21 21 LYS LYS A . n A 1 33 LYS 33 22 22 LYS LYS A . n A 1 34 LEU 34 23 23 LEU LEU A . n A 1 35 ARG 35 24 24 ARG ARG A . n A 1 36 GLY 36 25 25 GLY GLY A . n A 1 37 PHE 37 26 26 PHE PHE A . n A 1 38 ILE 38 27 27 ILE ILE A . n A 1 39 ALA 39 28 28 ALA ALA A . n A 1 40 GLU 40 29 29 GLU GLU A . n A 1 41 LYS 41 30 30 LYS LYS A . n A 1 42 ARG 42 31 31 ARG ARG A . n A 1 43 CYS 43 32 32 CYS CYS A . n A 1 44 ALA 44 33 33 ALA ALA A . n A 1 45 PRO 45 34 34 PRO PRO A . n A 1 46 LEU 46 35 35 LEU LEU A . n A 1 47 MET 47 36 36 MET MET A . n A 1 48 LEU 48 37 37 LEU LEU A . n A 1 49 ARG 49 38 38 ARG ARG A . n A 1 50 LEU 50 39 39 LEU LEU A . n A 1 51 ALA 51 40 40 ALA ALA A . n A 1 52 TRP 52 41 41 TRP TRP A . n A 1 53 HIS 53 42 42 HIS HIS A . n A 1 54 SER 54 43 43 SER SER A . n A 1 55 ALA 55 44 44 ALA ALA A . n A 1 56 GLY 56 45 45 GLY GLY A . n A 1 57 THR 57 46 46 THR THR A . n A 1 58 PHE 58 47 47 PHE PHE A . n A 1 59 ASP 59 48 48 ASP ASP A . n A 1 60 LYS 60 49 49 LYS LYS A . n A 1 61 GLY 61 50 50 GLY GLY A . n A 1 62 THR 62 51 51 THR THR A . n A 1 63 LYS 63 52 52 LYS LYS A . n A 1 64 THR 64 53 53 THR THR A . n A 1 65 GLY 65 54 54 GLY GLY A . n A 1 66 GLY 66 55 55 GLY GLY A . n A 1 67 PRO 67 56 56 PRO PRO A . n A 1 68 PHE 68 57 57 PHE PHE A . n A 1 69 GLY 69 58 58 GLY GLY A . n A 1 70 THR 70 59 59 THR THR A . n A 1 71 ILE 71 60 60 ILE ILE A . n A 1 72 LYS 72 61 61 LYS LYS A . n A 1 73 HIS 73 62 62 HIS HIS A . n A 1 74 PRO 74 63 63 PRO PRO A . n A 1 75 ALA 75 64 64 ALA ALA A . n A 1 76 GLU 76 65 65 GLU GLU A . n A 1 77 LEU 77 66 66 LEU LEU A . n A 1 78 ALA 78 67 67 ALA ALA A . n A 1 79 HIS 79 68 68 HIS HIS A . n A 1 80 SER 80 69 69 SER SER A . n A 1 81 ALA 81 70 70 ALA ALA A . n A 1 82 ASN 82 71 71 ASN ASN A . n A 1 83 ASN 83 72 72 ASN ASN A . n A 1 84 GLY 84 73 73 GLY GLY A . n A 1 85 LEU 85 74 74 LEU LEU A . n A 1 86 ASP 86 75 75 ASP ASP A . n A 1 87 ILE 87 76 76 ILE ILE A . n A 1 88 ALA 88 77 77 ALA ALA A . n A 1 89 VAL 89 78 78 VAL VAL A . n A 1 90 ARG 90 79 79 ARG ARG A . n A 1 91 LEU 91 80 80 LEU LEU A . n A 1 92 LEU 92 81 81 LEU LEU A . n A 1 93 GLU 93 82 82 GLU GLU A . n A 1 94 PRO 94 83 83 PRO PRO A . n A 1 95 LEU 95 84 84 LEU LEU A . n A 1 96 LYS 96 85 85 LYS LYS A . n A 1 97 ALA 97 86 86 ALA ALA A . n A 1 98 GLU 98 87 87 GLU GLU A . n A 1 99 PHE 99 88 88 PHE PHE A . n A 1 100 PRO 100 89 89 PRO PRO A . n A 1 101 ILE 101 90 90 ILE ILE A . n A 1 102 LEU 102 91 91 LEU LEU A . n A 1 103 SER 103 92 92 SER SER A . n A 1 104 TYR 104 93 93 TYR TYR A . n A 1 105 ALA 105 94 94 ALA ALA A . n A 1 106 ASP 106 95 95 ASP ASP A . n A 1 107 PHE 107 96 96 PHE PHE A . n A 1 108 TYR 108 97 97 TYR TYR A . n A 1 109 GLN 109 98 98 GLN GLN A . n A 1 110 LEU 110 99 99 LEU LEU A . n A 1 111 ALA 111 100 100 ALA ALA A . n A 1 112 GLY 112 101 101 GLY GLY A . n A 1 113 VAL 113 102 102 VAL VAL A . n A 1 114 VAL 114 103 103 VAL VAL A . n A 1 115 ALA 115 104 104 ALA ALA A . n A 1 116 VAL 116 105 105 VAL VAL A . n A 1 117 GLU 117 106 106 GLU GLU A . n A 1 118 VAL 118 107 107 VAL VAL A . n A 1 119 THR 119 108 108 THR THR A . n A 1 120 GLY 120 109 109 GLY GLY A . n A 1 121 GLY 121 110 110 GLY GLY A . n A 1 122 PRO 122 111 111 PRO PRO A . n A 1 123 GLU 123 112 112 GLU GLU A . n A 1 124 VAL 124 113 113 VAL VAL A . n A 1 125 PRO 125 114 114 PRO PRO A . n A 1 126 PHE 126 115 115 PHE PHE A . n A 1 127 HIS 127 116 116 HIS HIS A . n A 1 128 PRO 128 117 117 PRO PRO A . n A 1 129 GLY 129 118 118 GLY GLY A . n A 1 130 ARG 130 119 119 ARG ARG A . n A 1 131 GLU 131 120 120 GLU GLU A . n A 1 132 ASP 132 121 121 ASP ASP A . n A 1 133 LYS 133 122 122 LYS LYS A . n A 1 134 PRO 134 123 123 PRO PRO A . n A 1 135 GLU 135 124 124 GLU GLU A . n A 1 136 PRO 136 125 125 PRO PRO A . n A 1 137 PRO 137 126 126 PRO PRO A . n A 1 138 PRO 138 127 127 PRO PRO A . n A 1 139 GLU 139 128 128 GLU GLU A . n A 1 140 GLY 140 129 129 GLY GLY A . n A 1 141 ARG 141 130 130 ARG ARG A . n A 1 142 LEU 142 131 131 LEU LEU A . n A 1 143 PRO 143 132 132 PRO PRO A . n A 1 144 ASP 144 133 133 ASP ASP A . n A 1 145 ALA 145 134 134 ALA ALA A . n A 1 146 THR 146 135 135 THR THR A . n A 1 147 LYS 147 136 136 LYS LYS A . n A 1 148 GLY 148 137 137 GLY GLY A . n A 1 149 SER 149 138 138 SER SER A . n A 1 150 ASP 150 139 139 ASP ASP A . n A 1 151 HIS 151 140 140 HIS HIS A . n A 1 152 LEU 152 141 141 LEU LEU A . n A 1 153 ARG 153 142 142 ARG ARG A . n A 1 154 ASP 154 143 143 ASP ASP A . n A 1 155 VAL 155 144 144 VAL VAL A . n A 1 156 PHE 156 145 145 PHE PHE A . n A 1 157 GLY 157 146 146 GLY GLY A . n A 1 158 LYS 158 147 147 LYS LYS A . n A 1 159 ALA 159 148 148 ALA ALA A . n A 1 160 MET 160 149 149 MET MET A . n A 1 161 GLY 161 150 150 GLY GLY A . n A 1 162 LEU 162 151 151 LEU LEU A . n A 1 163 THR 163 152 152 THR THR A . n A 1 164 ASP 164 153 153 ASP ASP A . n A 1 165 GLN 165 154 154 GLN GLN A . n A 1 166 ASP 166 155 155 ASP ASP A . n A 1 167 ILE 167 156 156 ILE ILE A . n A 1 168 VAL 168 157 157 VAL VAL A . n A 1 169 ALA 169 158 158 ALA ALA A . n A 1 170 LEU 170 159 159 LEU LEU A . n A 1 171 SER 171 160 160 SER SER A . n A 1 172 GLY 172 161 161 GLY GLY A . n A 1 173 GLY 173 162 162 GLY GLY A . n A 1 174 HIS 174 163 163 HIS HIS A . n A 1 175 THR 175 164 164 THR THR A . n A 1 176 ILE 176 165 165 ILE ILE A . n A 1 177 GLY 177 166 166 GLY GLY A . n A 1 178 ALA 178 167 167 ALA ALA A . n A 1 179 ALA 179 168 168 ALA ALA A . n A 1 180 HIS 180 169 169 HIS HIS A . n A 1 181 LYS 181 170 170 LYS LYS A . n A 1 182 GLU 182 171 171 GLU GLU A . n A 1 183 ARG 183 172 172 ARG ARG A . n A 1 184 SER 184 173 173 SER SER A . n A 1 185 GLY 185 174 174 GLY GLY A . n A 1 186 PHE 186 175 175 PHE PHE A . n A 1 187 GLU 187 176 176 GLU GLU A . n A 1 188 GLY 188 177 177 GLY GLY A . n A 1 189 PRO 189 178 178 PRO PRO A . n A 1 190 TRP 190 179 179 TRP TRP A . n A 1 191 THR 191 180 180 THR THR A . n A 1 192 SER 192 181 181 SER SER A . n A 1 193 ASN 193 182 182 ASN ASN A . n A 1 194 PRO 194 183 183 PRO PRO A . n A 1 195 LEU 195 184 184 LEU LEU A . n A 1 196 ILE 196 185 185 ILE ILE A . n A 1 197 PHE 197 186 186 PHE PHE A . n A 1 198 ASP 198 187 187 ASP ASP A . n A 1 199 ASN 199 188 188 ASN ASN A . n A 1 200 SER 200 189 189 SER SER A . n A 1 201 TYR 201 190 190 TYR TYR A . n A 1 202 PHE 202 191 191 PHE PHE A . n A 1 203 THR 203 192 192 THR THR A . n A 1 204 GLU 204 193 193 GLU GLU A . n A 1 205 LEU 205 194 194 LEU LEU A . n A 1 206 LEU 206 195 195 LEU LEU A . n A 1 207 SER 207 196 196 SER SER A . n A 1 208 GLY 208 197 197 GLY GLY A . n A 1 209 GLU 209 198 198 GLU GLU A . n A 1 210 LYS 210 199 199 LYS LYS A . n A 1 211 GLU 211 200 200 GLU GLU A . n A 1 212 GLY 212 201 201 GLY GLY A . n A 1 213 LEU 213 202 202 LEU LEU A . n A 1 214 LEU 214 203 203 LEU LEU A . n A 1 215 GLN 215 204 204 GLN GLN A . n A 1 216 LEU 216 205 205 LEU LEU A . n A 1 217 PRO 217 206 206 PRO PRO A . n A 1 218 SER 218 207 207 SER SER A . n A 1 219 ASP 219 208 208 ASP ASP A . n A 1 220 LYS 220 209 209 LYS LYS A . n A 1 221 ALA 221 210 210 ALA ALA A . n A 1 222 LEU 222 211 211 LEU LEU A . n A 1 223 LEU 223 212 212 LEU LEU A . n A 1 224 SER 224 213 213 SER SER A . n A 1 225 ASP 225 214 214 ASP ASP A . n A 1 226 PRO 226 215 215 PRO PRO A . n A 1 227 VAL 227 216 216 VAL VAL A . n A 1 228 PHE 228 217 217 PHE PHE A . n A 1 229 ARG 229 218 218 ARG ARG A . n A 1 230 PRO 230 219 219 PRO PRO A . n A 1 231 LEU 231 220 220 LEU LEU A . n A 1 232 VAL 232 221 221 VAL VAL A . n A 1 233 ASP 233 222 222 ASP ASP A . n A 1 234 LYS 234 223 223 LYS LYS A . n A 1 235 TYR 235 224 224 TYR TYR A . n A 1 236 ALA 236 225 225 ALA ALA A . n A 1 237 ALA 237 226 226 ALA ALA A . n A 1 238 ASP 238 227 227 ASP ASP A . n A 1 239 GLU 239 228 228 GLU GLU A . n A 1 240 ASP 240 229 229 ASP ASP A . n A 1 241 ALA 241 230 230 ALA ALA A . n A 1 242 PHE 242 231 231 PHE PHE A . n A 1 243 PHE 243 232 232 PHE PHE A . n A 1 244 ALA 244 233 233 ALA ALA A . n A 1 245 ASP 245 234 234 ASP ASP A . n A 1 246 TYR 246 235 235 TYR TYR A . n A 1 247 ALA 247 236 236 ALA ALA A . n A 1 248 GLU 248 237 237 GLU GLU A . n A 1 249 ALA 249 238 238 ALA ALA A . n A 1 250 HIS 250 239 239 HIS HIS A . n A 1 251 GLN 251 240 240 GLN GLN A . n A 1 252 LYS 252 241 241 LYS LYS A . n A 1 253 LEU 253 242 242 LEU LEU A . n A 1 254 SER 254 243 243 SER SER A . n A 1 255 GLU 255 244 244 GLU GLU A . n A 1 256 LEU 256 245 245 LEU LEU A . n A 1 257 GLY 257 246 246 GLY GLY A . n A 1 258 PHE 258 247 247 PHE PHE A . n A 1 259 ALA 259 248 248 ALA ALA A . n A 1 260 ASP 260 249 249 ASP ASP A . n A 1 261 ALA 261 250 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 301 1 HEM HEM A . C 3 K 1 302 1 K K A . D 4 SO4 1 303 2 SO4 SO4 A . E 4 SO4 1 304 3 SO4 SO4 A . F 5 DOD 1 401 4 DOD DOD A . F 5 DOD 2 402 86 DOD DOD A . F 5 DOD 3 403 17 DOD DOD A . F 5 DOD 4 404 94 DOD DOD A . F 5 DOD 5 405 191 DOD DOD A . F 5 DOD 6 406 19 DOD DOD A . F 5 DOD 7 407 166 DOD DOD A . F 5 DOD 8 408 87 DOD DOD A . F 5 DOD 9 409 25 DOD DOD A . F 5 DOD 10 410 201 DOD DOD A . F 5 DOD 11 411 150 DOD DOD A . F 5 DOD 12 412 3 DOD DOD A . F 5 DOD 13 413 252 DOD DOD A . F 5 DOD 14 414 46 DOD DOD A . F 5 DOD 15 415 3 DOD DOD A . F 5 DOD 16 416 156 DOD DOD A . F 5 DOD 17 417 15 DOD DOD A . F 5 DOD 18 418 260 DOD DOD A . F 5 DOD 19 419 259 DOD DOD A . F 5 DOD 20 420 202 DOD DOD A . F 5 DOD 21 421 47 DOD DOD A . F 5 DOD 22 422 213 DOD DOD A . F 5 DOD 23 423 258 DOD DOD A . F 5 DOD 24 424 46 DOD DOD A . F 5 DOD 25 425 4 DOD DOD A . F 5 DOD 26 426 270 DOD DOD A . F 5 DOD 27 427 251 DOD DOD A . F 5 DOD 28 428 36 DOD DOD A . F 5 DOD 29 429 5 DOD DOD A . F 5 DOD 30 430 63 DOD DOD A . F 5 DOD 31 431 274 DOD DOD A . F 5 DOD 32 432 64 DOD DOD A . F 5 DOD 33 433 216 DOD DOD A . F 5 DOD 34 434 80 DOD DOD A . F 5 DOD 35 435 37 DOD DOD A . F 5 DOD 36 436 42 DOD DOD A . F 5 DOD 37 437 222 DOD DOD A . F 5 DOD 38 438 103 DOD DOD A . F 5 DOD 39 439 109 DOD DOD A . F 5 DOD 40 440 87 DOD DOD A . F 5 DOD 41 441 145 DOD DOD A . F 5 DOD 42 442 7 DOD DOD A . F 5 DOD 43 443 173 DOD DOD A . F 5 DOD 44 444 30 DOD DOD A . F 5 DOD 45 445 42 DOD DOD A . F 5 DOD 46 446 28 DOD DOD A . F 5 DOD 47 447 20 DOD DOD A . F 5 DOD 48 448 212 DOD DOD A . F 5 DOD 49 449 91 DOD DOD A . F 5 DOD 50 450 53 DOD DOD A . F 5 DOD 51 451 250 DOD DOD A . F 5 DOD 52 452 4 DOD DOD A . F 5 DOD 53 453 68 DOD DOD A . F 5 DOD 54 454 105 DOD DOD A . F 5 DOD 55 455 62 DOD DOD A . F 5 DOD 56 456 5 DOD DOD A . F 5 DOD 57 457 29 DOD DOD A . F 5 DOD 58 458 114 DOD DOD A . F 5 DOD 59 459 174 DOD DOD A . F 5 DOD 60 460 65 DOD DOD A . F 5 DOD 61 461 244 DOD DOD A . F 5 DOD 62 462 73 DOD DOD A . F 5 DOD 63 463 35 DOD DOD A . F 5 DOD 64 464 11 DOD DOD A . F 5 DOD 65 465 38 DOD DOD A . F 5 DOD 66 466 13 DOD DOD A . F 5 DOD 67 467 19 DOD DOD A . F 5 DOD 68 468 200 DOD DOD A . F 5 DOD 69 469 10 DOD DOD A . F 5 DOD 70 470 10 DOD DOD A . F 5 DOD 71 471 61 DOD DOD A . F 5 DOD 72 472 68 DOD DOD A . F 5 DOD 73 473 32 DOD DOD A . F 5 DOD 74 474 20 DOD DOD A . F 5 DOD 75 475 126 DOD DOD A . F 5 DOD 76 476 61 DOD DOD A . F 5 DOD 77 477 34 DOD DOD A . F 5 DOD 78 478 64 DOD DOD A . F 5 DOD 79 479 98 DOD DOD A . F 5 DOD 80 480 180 DOD DOD A . F 5 DOD 81 481 48 DOD DOD A . F 5 DOD 82 482 18 DOD DOD A . F 5 DOD 83 483 55 DOD DOD A . F 5 DOD 84 484 195 DOD DOD A . F 5 DOD 85 485 1 DOD DOD A . F 5 DOD 86 486 132 DOD DOD A . F 5 DOD 87 487 203 DOD DOD A . F 5 DOD 88 488 35 DOD DOD A . F 5 DOD 89 489 66 DOD DOD A . F 5 DOD 90 490 67 DOD DOD A . F 5 DOD 91 491 51 DOD DOD A . F 5 DOD 92 492 190 DOD DOD A . F 5 DOD 93 493 15 DOD DOD A . F 5 DOD 94 494 58 DOD DOD A . F 5 DOD 95 495 198 DOD DOD A . F 5 DOD 96 496 164 DOD DOD A . F 5 DOD 97 497 56 DOD DOD A . F 5 DOD 98 498 76 DOD DOD A . F 5 DOD 99 499 70 DOD DOD A . F 5 DOD 100 500 25 DOD DOD A . F 5 DOD 101 501 14 DOD DOD A . F 5 DOD 102 502 206 DOD DOD A . F 5 DOD 103 503 79 DOD DOD A . F 5 DOD 104 504 110 DOD DOD A . F 5 DOD 105 505 21 DOD DOD A . F 5 DOD 106 506 6 DOD DOD A . F 5 DOD 107 507 44 DOD DOD A . F 5 DOD 108 508 24 DOD DOD A . F 5 DOD 109 509 247 DOD DOD A . F 5 DOD 110 510 137 DOD DOD A . F 5 DOD 111 511 162 DOD DOD A . F 5 DOD 112 512 13 DOD DOD A . F 5 DOD 113 513 221 DOD DOD A . F 5 DOD 114 514 2 DOD DOD A . F 5 DOD 115 515 86 DOD DOD A . F 5 DOD 116 516 52 DOD DOD A . F 5 DOD 117 517 207 DOD DOD A . F 5 DOD 118 518 89 DOD DOD A . F 5 DOD 119 519 60 DOD DOD A . F 5 DOD 120 520 108 DOD DOD A . F 5 DOD 121 521 69 DOD DOD A . F 5 DOD 122 522 243 DOD DOD A . F 5 DOD 123 523 112 DOD DOD A . F 5 DOD 124 524 100 DOD DOD A . F 5 DOD 125 525 1 DOD DOD A . F 5 DOD 126 526 36 DOD DOD A . F 5 DOD 127 527 54 DOD DOD A . F 5 DOD 128 528 273 DOD DOD A . F 5 DOD 129 529 193 DOD DOD A . F 5 DOD 130 530 82 DOD DOD A . F 5 DOD 131 531 18 DOD DOD A . F 5 DOD 132 532 80 DOD DOD A . F 5 DOD 133 533 152 DOD DOD A . F 5 DOD 134 534 184 DOD DOD A . F 5 DOD 135 535 240 DOD DOD A . F 5 DOD 136 536 31 DOD DOD A . F 5 DOD 137 537 8 DOD DOD A . F 5 DOD 138 538 23 DOD DOD A . F 5 DOD 139 539 8 DOD DOD A . F 5 DOD 140 540 242 DOD DOD A . F 5 DOD 141 541 275 DOD DOD A . F 5 DOD 142 542 119 DOD DOD A . F 5 DOD 143 543 9 DOD DOD A . F 5 DOD 144 544 241 DOD DOD A . F 5 DOD 145 545 17 DOD DOD A . F 5 DOD 146 546 161 DOD DOD A . F 5 DOD 147 547 20 DOD DOD A . F 5 DOD 148 548 22 DOD DOD A . F 5 DOD 149 549 22 DOD DOD A . F 5 DOD 150 550 78 DOD DOD A . F 5 DOD 151 551 111 DOD DOD A . F 5 DOD 152 552 16 DOD DOD A . F 5 DOD 153 553 50 DOD DOD A . F 5 DOD 154 554 23 DOD DOD A . F 5 DOD 155 555 138 DOD DOD A . F 5 DOD 156 556 143 DOD DOD A . F 5 DOD 157 557 256 DOD DOD A . F 5 DOD 158 558 21 DOD DOD A . F 5 DOD 159 559 51 DOD DOD A . F 5 DOD 160 560 176 DOD DOD A . F 5 DOD 161 561 181 DOD DOD A . F 5 DOD 162 562 264 DOD DOD A . F 5 DOD 163 563 57 DOD DOD A . F 5 DOD 164 564 238 DOD DOD A . F 5 DOD 165 565 255 DOD DOD A . F 5 DOD 166 566 254 DOD DOD A . F 5 DOD 167 567 167 DOD DOD A . F 5 DOD 168 568 38 DOD DOD A . F 5 DOD 169 569 225 DOD DOD A . F 5 DOD 170 570 129 DOD DOD A . F 5 DOD 171 571 56 DOD DOD A . F 5 DOD 172 572 47 DOD DOD A . F 5 DOD 173 573 41 DOD DOD A . F 5 DOD 174 574 267 DOD DOD A . F 5 DOD 175 575 113 DOD DOD A . F 5 DOD 176 576 215 DOD DOD A . F 5 DOD 177 577 99 DOD DOD A . F 5 DOD 178 578 134 DOD DOD A . F 5 DOD 179 579 196 DOD DOD A . F 5 DOD 180 580 92 DOD DOD A . F 5 DOD 181 581 50 DOD DOD A . F 5 DOD 182 582 83 DOD DOD A . F 5 DOD 183 583 125 DOD DOD A . F 5 DOD 184 584 90 DOD DOD A . F 5 DOD 185 585 12 DOD DOD A . F 5 DOD 186 586 71 DOD DOD A . F 5 DOD 187 587 246 DOD DOD A . F 5 DOD 188 588 144 DOD DOD A . F 5 DOD 189 589 14 DOD DOD A . F 5 DOD 190 590 183 DOD DOD A . F 5 DOD 191 591 106 DOD DOD A . F 5 DOD 192 592 187 DOD DOD A . F 5 DOD 193 593 33 DOD DOD A . F 5 DOD 194 594 197 DOD DOD A . F 5 DOD 195 595 67 DOD DOD A . F 5 DOD 196 596 39 DOD DOD A . F 5 DOD 197 597 130 DOD DOD A . F 5 DOD 198 598 149 DOD DOD A . F 5 DOD 199 599 95 DOD DOD A . F 5 DOD 200 600 133 DOD DOD A . F 5 DOD 201 601 142 DOD DOD A . F 5 DOD 202 602 189 DOD DOD A . F 5 DOD 203 603 170 DOD DOD A . F 5 DOD 204 604 40 DOD DOD A . F 5 DOD 205 605 59 DOD DOD A . F 5 DOD 206 606 102 DOD DOD A . F 5 DOD 207 607 7 DOD DOD A . F 5 DOD 208 608 249 DOD DOD A . F 5 DOD 209 609 229 DOD DOD A . F 5 DOD 210 610 179 DOD DOD A . F 5 DOD 211 611 131 DOD DOD A . F 5 DOD 212 612 120 DOD DOD A . F 5 DOD 213 613 71 DOD DOD A . F 5 DOD 214 614 235 DOD DOD A . F 5 DOD 215 615 185 DOD DOD A . F 5 DOD 216 616 141 DOD DOD A . F 5 DOD 217 617 116 DOD DOD A . F 5 DOD 218 618 70 DOD DOD A . F 5 DOD 219 619 205 DOD DOD A . F 5 DOD 220 620 139 DOD DOD A . F 5 DOD 221 621 128 DOD DOD A . F 5 DOD 222 622 159 DOD DOD A . F 5 DOD 223 623 237 DOD DOD A . F 5 DOD 224 624 104 DOD DOD A . F 5 DOD 225 625 63 DOD DOD A . F 5 DOD 226 626 6 DOD DOD A . F 5 DOD 227 627 82 DOD DOD A . F 5 DOD 228 628 118 DOD DOD A . F 5 DOD 229 629 26 DOD DOD A . F 5 DOD 230 630 96 DOD DOD A . F 5 DOD 231 631 43 DOD DOD A . F 5 DOD 232 632 45 DOD DOD A . F 5 DOD 233 633 26 DOD DOD A . F 5 DOD 234 634 66 DOD DOD A . F 5 DOD 235 635 83 DOD DOD A . F 5 DOD 236 636 226 DOD DOD A . F 5 DOD 237 637 169 DOD DOD A . F 5 DOD 238 638 58 DOD DOD A . F 5 DOD 239 639 55 DOD DOD A . F 5 DOD 240 640 65 DOD DOD A . F 5 DOD 241 641 37 DOD DOD A . F 5 DOD 242 642 262 DOD DOD A . F 5 DOD 243 643 210 DOD DOD A . F 5 DOD 244 644 85 DOD DOD A . F 5 DOD 245 645 31 DOD DOD A . F 5 DOD 246 646 107 DOD DOD A . F 5 DOD 247 647 269 DOD DOD A . F 5 DOD 248 648 188 DOD DOD A . F 5 DOD 249 649 72 DOD DOD A . F 5 DOD 250 650 29 DOD DOD A . F 5 DOD 251 651 27 DOD DOD A . F 5 DOD 252 652 231 DOD DOD A . F 5 DOD 253 653 23 DOD DOD A . F 5 DOD 254 654 14 DOD DOD A . F 5 DOD 255 655 266 DOD DOD A . F 5 DOD 256 656 147 DOD DOD A . F 5 DOD 257 657 204 DOD DOD A . F 5 DOD 258 658 19 DOD DOD A . F 5 DOD 259 659 30 DOD DOD A . F 5 DOD 260 660 33 DOD DOD A . F 5 DOD 261 661 199 DOD DOD A . F 5 DOD 262 662 146 DOD DOD A . F 5 DOD 263 663 208 DOD DOD A . F 5 DOD 264 664 245 DOD DOD A . F 5 DOD 265 665 60 DOD DOD A . F 5 DOD 266 666 136 DOD DOD A . F 5 DOD 267 667 160 DOD DOD A . F 5 DOD 268 668 124 DOD DOD A . F 5 DOD 269 669 272 DOD DOD A . F 5 DOD 270 670 239 DOD DOD A . F 5 DOD 271 671 227 DOD DOD A . F 5 DOD 272 672 44 DOD DOD A . F 5 DOD 273 673 182 DOD DOD A . F 5 DOD 274 674 123 DOD DOD A . F 5 DOD 275 675 265 DOD DOD A . F 5 DOD 276 676 122 DOD DOD A . F 5 DOD 277 677 7 DOD DOD A . F 5 DOD 278 678 81 DOD DOD A . F 5 DOD 279 679 17 DOD DOD A . F 5 DOD 280 680 73 DOD DOD A . F 5 DOD 281 681 28 DOD DOD A . F 5 DOD 282 682 22 DOD DOD A . F 5 DOD 283 683 79 DOD DOD A . F 5 DOD 284 684 220 DOD DOD A . F 5 DOD 285 685 271 DOD DOD A . F 5 DOD 286 686 74 DOD DOD A . F 5 DOD 287 687 93 DOD DOD A . F 5 DOD 288 688 85 DOD DOD A . F 5 DOD 289 689 41 DOD DOD A . F 5 DOD 290 690 223 DOD DOD A . F 5 DOD 291 691 257 DOD DOD A . F 5 DOD 292 692 168 DOD DOD A . F 5 DOD 293 693 9 DOD DOD A . F 5 DOD 294 694 178 DOD DOD A . F 5 DOD 295 695 211 DOD DOD A . F 5 DOD 296 696 53 DOD DOD A . F 5 DOD 297 697 28 DOD DOD A . F 5 DOD 298 698 117 DOD DOD A . F 5 DOD 299 699 219 DOD DOD A . F 5 DOD 300 700 157 DOD DOD A . F 5 DOD 301 701 16 DOD DOD A . F 5 DOD 302 702 15 DOD DOD A . F 5 DOD 303 703 12 DOD DOD A . F 5 DOD 304 704 217 DOD DOD A . F 5 DOD 305 705 54 DOD DOD A . F 5 DOD 306 706 253 DOD DOD A . F 5 DOD 307 707 194 DOD DOD A . F 5 DOD 308 708 77 DOD DOD A . F 5 DOD 309 709 9 DOD DOD A . F 5 DOD 310 710 11 DOD DOD A . F 5 DOD 311 711 1 DOD DOD A . F 5 DOD 312 712 165 DOD DOD A . F 5 DOD 313 713 192 DOD DOD A . F 5 DOD 314 714 69 DOD DOD A . F 5 DOD 315 715 248 DOD DOD A . F 5 DOD 316 716 52 DOD DOD A . F 5 DOD 317 717 40 DOD DOD A . F 5 DOD 318 718 263 DOD DOD A . F 5 DOD 319 719 81 DOD DOD A . F 5 DOD 320 720 72 DOD DOD A . F 5 DOD 321 721 186 DOD DOD A . F 5 DOD 322 722 224 DOD DOD A . F 5 DOD 323 723 88 DOD DOD A . F 5 DOD 324 724 84 DOD DOD A . F 5 DOD 325 725 21 DOD DOD A . F 5 DOD 326 726 230 DOD DOD A . F 5 DOD 327 727 228 DOD DOD A . F 5 DOD 328 728 78 DOD DOD A . F 5 DOD 329 729 49 DOD DOD A . F 5 DOD 330 730 88 DOD DOD A . F 5 DOD 331 731 49 DOD DOD A . F 5 DOD 332 732 140 DOD DOD A . F 5 DOD 333 733 154 DOD DOD A . F 5 DOD 334 734 27 DOD DOD A . F 5 DOD 335 735 8 DOD DOD A . F 5 DOD 336 736 24 DOD DOD A . F 5 DOD 337 737 209 DOD DOD A . F 5 DOD 338 738 32 DOD DOD A . F 5 DOD 339 739 45 DOD DOD A . F 5 DOD 340 740 84 DOD DOD A . F 5 DOD 341 741 39 DOD DOD A . F 5 DOD 342 742 43 DOD DOD A . F 5 DOD 343 743 218 DOD DOD A . F 5 DOD 344 744 11 DOD DOD A . F 5 DOD 345 745 2 DOD DOD A . F 5 DOD 346 746 115 DOD DOD A . F 5 DOD 347 747 75 DOD DOD A . F 5 DOD 348 748 13 DOD DOD A . F 5 DOD 349 749 97 DOD DOD A . F 5 DOD 350 750 148 DOD DOD A . F 5 DOD 351 751 48 DOD DOD A . F 5 DOD 352 752 76 DOD DOD A . F 5 DOD 353 753 121 DOD DOD A . F 5 DOD 354 754 75 DOD DOD A . F 5 DOD 355 755 59 DOD DOD A . F 5 DOD 356 756 135 DOD DOD A . F 5 DOD 357 757 24 DOD DOD A . F 5 DOD 358 758 153 DOD DOD A . F 5 DOD 359 759 2 DOD DOD A . F 5 DOD 360 760 6 DOD DOD A . F 5 DOD 361 761 171 DOD DOD A . F 5 DOD 362 762 233 DOD DOD A . F 5 DOD 363 763 101 DOD DOD A . F 5 DOD 364 764 25 DOD DOD A . F 5 DOD 365 765 34 DOD DOD A . F 5 DOD 366 766 3 DOD DOD A . F 5 DOD 367 767 12 DOD DOD A . F 5 DOD 368 768 158 DOD DOD A . F 5 DOD 369 769 232 DOD DOD A . F 5 DOD 370 770 77 DOD DOD A . F 5 DOD 371 771 155 DOD DOD A . F 5 DOD 372 772 234 DOD DOD A . F 5 DOD 373 773 57 DOD DOD A . F 5 DOD 374 774 151 DOD DOD A . F 5 DOD 375 775 62 DOD DOD A . F 5 DOD 376 776 236 DOD DOD A . F 5 DOD 377 777 268 DOD DOD A . F 5 DOD 378 778 177 DOD DOD A . F 5 DOD 379 779 127 DOD DOD A . F 5 DOD 380 780 261 DOD DOD A . F 5 DOD 381 781 163 DOD DOD A . F 5 DOD 382 782 5 DOD DOD A . F 5 DOD 383 783 18 DOD DOD A . F 5 DOD 384 784 214 DOD DOD A . F 5 DOD 385 785 74 DOD DOD A . F 5 DOD 386 786 175 DOD DOD A . F 5 DOD 387 787 26 DOD DOD A . F 5 DOD 388 788 172 DOD DOD A . F 5 DOD 389 789 27 DOD DOD A . F 5 DOD 390 790 16 DOD DOD A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.7.3_928 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5JPR _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.095 _cell.length_a_esd ? _cell.length_b 82.095 _cell.length_b_esd ? _cell.length_c 75.162 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JPR _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 5JPR 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 5JPR ? ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.25 M Lithium sulfate, 0.1 M HEPES pH 8.3 - 8.9' _exptl_crystal_grow.pdbx_pH_range '8.3 - 8.9' # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? ? 100 ? ? 1 ? ? ? 2 ? ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date multilayer 'IMAGE PLATE' 1 'MAATEL IMAGINE' ? ? ? ? 2015-10-14 multilayer CCD 2 'RIGAKU SATURN 944+' ? ? ? ? 2015-10-20 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 L ? ? LAUE ? neutron ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 3.2 1.0 2 4.2 1.0 3 1.5418 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? 'NUCLEAR REACTOR' ? 'ILL BEAMLINE LADI III' ? ? '3.2 - 4.2' ? 'LADI III' ILL ? ? 2 ? ? 'ROTATING ANODE' ? 'RIGAKU MICROMAX-007 HF' ? ? 1.5418 ? ? ? # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split ? 5JPR ? ? 2.2 40.0 ? ? ? ? ? ? ? ? 9220 ? ? ? ? ? ? ? 69.8 ? ? ? ? ? ? 4 0.18 ? ? ? 7.0 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? 5JPR ? ? 1.8 19.91 ? ? ? ? ? ? ? ? 23857 ? ? ? ? ? ? ? 98.72 ? ? ? ? ? ? 6.8 0.16 ? ? ? 9.4 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 ? ? # loop_ _refine.aniso_B[1][1] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][2] _refine.aniso_B[2][3] _refine.aniso_B[3][3] _refine.B_iso_max _refine.B_iso_mean _refine.B_iso_min _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.details _refine.diff_density_max _refine.diff_density_max_esd _refine.diff_density_min _refine.diff_density_min_esd _refine.diff_density_rms _refine.diff_density_rms_esd _refine.entry_id _refine.pdbx_refine_id _refine.ls_abs_structure_details _refine.ls_abs_structure_Flack _refine.ls_abs_structure_Flack_esd _refine.ls_abs_structure_Rogers _refine.ls_abs_structure_Rogers_esd _refine.ls_d_res_high _refine.ls_d_res_low _refine.ls_extinction_coef _refine.ls_extinction_coef_esd _refine.ls_extinction_expression _refine.ls_extinction_method _refine.ls_goodness_of_fit_all _refine.ls_goodness_of_fit_all_esd _refine.ls_goodness_of_fit_obs _refine.ls_goodness_of_fit_obs_esd _refine.ls_hydrogen_treatment _refine.ls_matrix_type _refine.ls_number_constraints _refine.ls_number_parameters _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_free _refine.ls_number_reflns_R_work _refine.ls_number_restraints _refine.ls_percent_reflns_obs _refine.ls_percent_reflns_R_free _refine.ls_R_factor_all _refine.ls_R_factor_obs _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_R_factor_R_work _refine.ls_R_Fsqd_factor_obs _refine.ls_R_I_factor_obs _refine.ls_redundancy_reflns_all _refine.ls_redundancy_reflns_obs _refine.ls_restrained_S_all _refine.ls_restrained_S_obs _refine.ls_shift_over_esd_max _refine.ls_shift_over_esd_mean _refine.ls_structure_factor_coef _refine.ls_weighting_details _refine.ls_weighting_scheme _refine.ls_wR_factor_all _refine.ls_wR_factor_obs _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.occupancy_max _refine.occupancy_min _refine.solvent_model_details _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.ls_R_factor_gt _refine.ls_goodness_of_fit_gt _refine.ls_goodness_of_fit_ref _refine.ls_shift_over_su_max _refine.ls_shift_over_su_max_lt _refine.ls_shift_over_su_mean _refine.ls_shift_over_su_mean_lt _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_ls_sigma_Fsqd _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_isotropic_thermal_model _refine.pdbx_ls_cross_valid_method _refine.pdbx_method_to_determine_struct _refine.pdbx_starting_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_R_Free_selection_details _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_real_space_R _refine.pdbx_density_correlation _refine.pdbx_pd_number_of_powder_patterns _refine.pdbx_pd_number_of_points _refine.pdbx_pd_meas_number_of_points _refine.pdbx_pd_proc_ls_prof_R_factor _refine.pdbx_pd_proc_ls_prof_wR_factor _refine.pdbx_pd_Marquardt_correlation_coeff _refine.pdbx_pd_Fsqrd_R_factor _refine.pdbx_pd_ls_matrix_band_width _refine.pdbx_overall_phase_error _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_diffrn_id _refine.overall_SU_B _refine.overall_SU_ML _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_average_fsc_overall _refine.pdbx_average_fsc_work _refine.pdbx_average_fsc_free 0.4889 -0.0000 -0.0000 0.4889 0.0000 -0.9778 ? ? ? ? ? ? ? ? ? ? ? ? 5JPR 'X-RAY DIFFRACTION' ? ? ? ? ? 1.806 19.91 ? ? ? ? ? ? ? ? ? ? ? ? ? 23857 1194 ? ? 98.72 5.00 ? 0.1578 0.2159 ? ? 0.1547 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 34.834 0.429 ? ? ? ? ? ? ? ? 1.36 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 2XIF ? ? ? ? ? 0.90 ? 0.60 ? ? ? ? ? ? ? ? ? ? 18.40 ? ? ? ? 2 ? 0.18 ? ? ? ? ? ? ? 0.4889 -0.0000 -0.0000 0.4889 0.0000 -0.9778 ? ? ? ? ? ? ? ? ? ? ? ? 5JPR 'NEUTRON DIFFRACTION' ? ? ? ? ? 2.202 36.714 ? ? ? ? ? ? ? ? ? ? ? ? ? 9220 462 ? ? 68.14 5.01 ? 0.2401 0.3104 ? ? 0.2364 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 34.834 0.429 ? ? ? ? ? ? ? ? 2.03 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' 2XIF ? ? ? ? ? 0.90 ? 0.60 ? ? ? ? ? ? ? ? ? ? 18.40 ? ? ? ? 1 ? 0.18 ? ? ? ? ? ? ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1899 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 54 _refine_hist.number_atoms_solvent 390 _refine_hist.number_atoms_total 2343 _refine_hist.d_res_high 1.806 _refine_hist.d_res_low 19.91 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 ? 4845 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.366 ? 8082 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.898 ? 1174 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.115 ? 280 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 850 ? f_plane_restr ? ? 'NEUTRON DIFFRACTION' ? 0.016 ? 4845 ? f_bond_d ? ? 'NEUTRON DIFFRACTION' ? 1.366 ? 8082 ? f_angle_d ? ? 'NEUTRON DIFFRACTION' ? 11.898 ? 1174 ? f_dihedral_angle_d ? ? 'NEUTRON DIFFRACTION' ? 0.115 ? 280 ? f_chiral_restr ? ? 'NEUTRON DIFFRACTION' ? 0.009 ? 850 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.806 1.8779 . . 124 2354 94.00 . . . 0.2599 . 0.1913 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8779 1.9633 . . 130 2470 99.00 . . . 0.2303 . 0.1657 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9633 2.0667 . . 133 2515 100.00 . . . 0.2100 . 0.1471 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0667 2.1960 . . 131 2500 100.00 . . . 0.2111 . 0.1501 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1960 2.3654 . . 131 2514 99.00 . . . 0.2409 . 0.1536 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3654 2.6029 . . 134 2521 99.00 . . . 0.2400 . 0.1521 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6029 2.9785 . . 131 2514 99.00 . . . 0.2102 . 0.1565 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9785 3.7485 . . 137 2575 99.00 . . . 0.1956 . 0.1459 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7485 19.91 . . 143 2700 99.00 . . . 0.2037 . 0.1560 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.2021 2.5207 . . 106 2024 48.00 . . . 0.3918 . 0.3609 . . . . . . . . . . 'NEUTRON DIFFRACTION' 2.5207 3.1756 . . 147 2768 65.00 . . . 0.3360 . 0.2399 . . . . . . . . . . 'NEUTRON DIFFRACTION' 3.1756 36.71 . . 209 3966 89.00 . . . 0.2735 . 0.1987 . . . . . . . . . . # _struct.entry_id 5JPR _struct.title 'Neutron Structure of Compound II of Ascorbate Peroxidase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JPR _struct_keywords.text 'Heme Peroxidase, Intermediate, Ferryle Heme, Compound II, Cryo-trapping, oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q43758_SOYBN _struct_ref.pdbx_db_accession Q43758 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSG GHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLVDKYAADEDAFFADYAEAHQK LSELGFADA ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JPR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 261 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q43758 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 250 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 250 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5JPR MET A 1 ? UNP Q43758 ? ? 'initiating methionine' -10 1 1 5JPR ARG A 2 ? UNP Q43758 ? ? 'expression tag' -9 2 1 5JPR GLY A 3 ? UNP Q43758 ? ? 'expression tag' -8 3 1 5JPR SER A 4 ? UNP Q43758 ? ? 'expression tag' -7 4 1 5JPR HIS A 5 ? UNP Q43758 ? ? 'expression tag' -6 5 1 5JPR HIS A 6 ? UNP Q43758 ? ? 'expression tag' -5 6 1 5JPR HIS A 7 ? UNP Q43758 ? ? 'expression tag' -4 7 1 5JPR HIS A 8 ? UNP Q43758 ? ? 'expression tag' -3 8 1 5JPR HIS A 9 ? UNP Q43758 ? ? 'expression tag' -2 9 1 5JPR HIS A 10 ? UNP Q43758 ? ? 'expression tag' -1 10 1 5JPR GLY A 11 ? UNP Q43758 ? ? 'expression tag' 0 11 1 5JPR SER A 12 ? UNP Q43758 ? ? 'expression tag' 1 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1520 ? 1 MORE -45 ? 1 'SSA (A^2)' 10500 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 20 ? ARG A 42 ? SER A 9 ARG A 31 1 ? 23 HELX_P HELX_P2 AA2 CYS A 43 ? GLY A 56 ? CYS A 32 GLY A 45 1 ? 14 HELX_P HELX_P3 AA3 GLY A 69 ? LYS A 72 ? GLY A 58 LYS A 61 5 ? 4 HELX_P HELX_P4 AA4 HIS A 73 ? ALA A 78 ? HIS A 62 ALA A 67 1 ? 6 HELX_P HELX_P5 AA5 HIS A 79 ? ASN A 83 ? HIS A 68 ASN A 72 5 ? 5 HELX_P HELX_P6 AA6 GLY A 84 ? ALA A 97 ? GLY A 73 ALA A 86 1 ? 14 HELX_P HELX_P7 AA7 SER A 103 ? THR A 119 ? SER A 92 THR A 108 1 ? 17 HELX_P HELX_P8 AA8 GLY A 148 ? GLY A 157 ? GLY A 137 GLY A 146 1 ? 10 HELX_P HELX_P9 AA9 THR A 163 ? GLY A 172 ? THR A 152 GLY A 161 1 ? 10 HELX_P HELX_P10 AB1 GLY A 173 ? ILE A 176 ? GLY A 162 ILE A 165 5 ? 4 HELX_P HELX_P11 AB2 ASN A 199 ? GLY A 208 ? ASN A 188 GLY A 197 1 ? 10 HELX_P HELX_P12 AB3 LEU A 216 ? ASP A 225 ? LEU A 205 ASP A 214 1 ? 10 HELX_P HELX_P13 AB4 VAL A 227 ? ASP A 238 ? VAL A 216 ASP A 227 1 ? 12 HELX_P HELX_P14 AB5 ASP A 238 ? GLU A 255 ? ASP A 227 GLU A 244 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 174 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 163 A HEM 301 1_555 ? ? ? ? ? ? ? 1.970 ? ? metalc2 metalc ? ? A THR 175 O ? ? ? 1_555 C K . K ? ? A THR 164 A K 302 1_555 ? ? ? ? ? ? ? 2.728 ? ? metalc3 metalc ? ? A THR 175 OG1 ? ? ? 1_555 C K . K ? ? A THR 164 A K 302 1_555 ? ? ? ? ? ? ? 3.041 ? ? metalc4 metalc ? ? A THR 191 OG1 ? ? ? 1_555 C K . K ? ? A THR 180 A K 302 1_555 ? ? ? ? ? ? ? 2.886 ? ? metalc5 metalc ? ? A ASN 193 O ? ? ? 1_555 C K . K ? ? A ASN 182 A K 302 1_555 ? ? ? ? ? ? ? 2.798 ? ? metalc6 metalc ? ? A ASN 193 OD1 ? ? ? 1_555 C K . K ? ? A ASN 182 A K 302 1_555 ? ? ? ? ? ? ? 2.778 ? ? metalc7 metalc ? ? A ILE 196 O ? ? ? 1_555 C K . K ? ? A ILE 185 A K 302 1_555 ? ? ? ? ? ? ? 2.654 ? ? metalc8 metalc ? ? A ASP 198 OD1 ? ? ? 1_555 C K . K ? ? A ASP 187 A K 302 1_555 ? ? ? ? ? ? ? 2.952 ? ? metalc9 metalc ? ? B HEM . FE ? ? ? 1_555 F DOD . O ? ? A HEM 301 A DOD 451 1_555 ? ? ? ? ? ? ? 1.879 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 174 ? A HIS 163 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 NA ? B HEM . ? A HEM 301 ? 1_555 95.5 ? 2 NE2 ? A HIS 174 ? A HIS 163 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 NB ? B HEM . ? A HEM 301 ? 1_555 91.6 ? 3 NA ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 NB ? B HEM . ? A HEM 301 ? 1_555 93.6 ? 4 NE2 ? A HIS 174 ? A HIS 163 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 NC ? B HEM . ? A HEM 301 ? 1_555 88.9 ? 5 NA ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 NC ? B HEM . ? A HEM 301 ? 1_555 173.7 ? 6 NB ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 NC ? B HEM . ? A HEM 301 ? 1_555 90.7 ? 7 NE2 ? A HIS 174 ? A HIS 163 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 ND ? B HEM . ? A HEM 301 ? 1_555 93.3 ? 8 NA ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 ND ? B HEM . ? A HEM 301 ? 1_555 85.2 ? 9 NB ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 ND ? B HEM . ? A HEM 301 ? 1_555 175.0 ? 10 NC ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 ND ? B HEM . ? A HEM 301 ? 1_555 90.1 ? 11 NE2 ? A HIS 174 ? A HIS 163 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 O ? F DOD . ? A DOD 451 ? 1_555 178.8 ? 12 NA ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 O ? F DOD . ? A DOD 451 ? 1_555 85.5 ? 13 NB ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 O ? F DOD . ? A DOD 451 ? 1_555 89.0 ? 14 NC ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 O ? F DOD . ? A DOD 451 ? 1_555 90.0 ? 15 ND ? B HEM . ? A HEM 301 ? 1_555 FE ? B HEM . ? A HEM 301 ? 1_555 O ? F DOD . ? A DOD 451 ? 1_555 86.1 ? 16 O ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 OG1 ? A THR 175 ? A THR 164 ? 1_555 65.3 ? 17 O ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 OG1 ? A THR 191 ? A THR 180 ? 1_555 67.7 ? 18 OG1 ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 OG1 ? A THR 191 ? A THR 180 ? 1_555 102.3 ? 19 O ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ASN 193 ? A ASN 182 ? 1_555 95.6 ? 20 OG1 ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ASN 193 ? A ASN 182 ? 1_555 159.1 ? 21 OG1 ? A THR 191 ? A THR 180 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ASN 193 ? A ASN 182 ? 1_555 76.5 ? 22 O ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASN 193 ? A ASN 182 ? 1_555 141.2 ? 23 OG1 ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASN 193 ? A ASN 182 ? 1_555 134.8 ? 24 OG1 ? A THR 191 ? A THR 180 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASN 193 ? A ASN 182 ? 1_555 74.8 ? 25 O ? A ASN 193 ? A ASN 182 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASN 193 ? A ASN 182 ? 1_555 65.6 ? 26 O ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ILE 196 ? A ILE 185 ? 1_555 89.9 ? 27 OG1 ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ILE 196 ? A ILE 185 ? 1_555 94.7 ? 28 OG1 ? A THR 191 ? A THR 180 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ILE 196 ? A ILE 185 ? 1_555 142.1 ? 29 O ? A ASN 193 ? A ASN 182 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ILE 196 ? A ILE 185 ? 1_555 75.7 ? 30 OD1 ? A ASN 193 ? A ASN 182 ? 1_555 K ? C K . ? A K 302 ? 1_555 O ? A ILE 196 ? A ILE 185 ? 1_555 115.3 ? 31 O ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASP 198 ? A ASP 187 ? 1_555 125.0 ? 32 OG1 ? A THR 175 ? A THR 164 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASP 198 ? A ASP 187 ? 1_555 61.0 ? 33 OG1 ? A THR 191 ? A THR 180 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASP 198 ? A ASP 187 ? 1_555 134.5 ? 34 O ? A ASN 193 ? A ASN 182 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASP 198 ? A ASP 187 ? 1_555 134.2 ? 35 OD1 ? A ASN 193 ? A ASN 182 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASP 198 ? A ASP 187 ? 1_555 88.6 ? 36 O ? A ILE 196 ? A ILE 185 ? 1_555 K ? C K . ? A K 302 ? 1_555 OD1 ? A ASP 198 ? A ASP 187 ? 1_555 83.4 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 178 ? ALA A 179 ? ALA A 167 ALA A 168 AA1 2 GLY A 188 ? PRO A 189 ? GLY A 177 PRO A 178 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 179 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 168 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 188 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 177 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEM 301 ? 25 'binding site for residue HEM A 301' AC2 Software A K 302 ? 5 'binding site for residue K A 302' AC3 Software A SO4 303 ? 6 'binding site for residue SO4 A 303' AC4 Software A SO4 304 ? 7 'binding site for residue SO4 A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 25 PRO A 45 ? PRO A 34 . ? 1_555 ? 2 AC1 25 TRP A 52 ? TRP A 41 . ? 1_555 ? 3 AC1 25 PRO A 143 ? PRO A 132 . ? 1_555 ? 4 AC1 25 ALA A 145 ? ALA A 134 . ? 1_555 ? 5 AC1 25 LEU A 152 ? LEU A 141 . ? 1_555 ? 6 AC1 25 PHE A 156 ? PHE A 145 . ? 1_555 ? 7 AC1 25 LEU A 170 ? LEU A 159 . ? 1_555 ? 8 AC1 25 SER A 171 ? SER A 160 . ? 1_555 ? 9 AC1 25 GLY A 173 ? GLY A 162 . ? 1_555 ? 10 AC1 25 HIS A 174 ? HIS A 163 . ? 1_555 ? 11 AC1 25 ILE A 176 ? ILE A 165 . ? 1_555 ? 12 AC1 25 GLY A 177 ? GLY A 166 . ? 1_555 ? 13 AC1 25 ALA A 178 ? ALA A 167 . ? 1_555 ? 14 AC1 25 ALA A 179 ? ALA A 168 . ? 1_555 ? 15 AC1 25 HIS A 180 ? HIS A 169 . ? 1_555 ? 16 AC1 25 ARG A 183 ? ARG A 172 . ? 1_555 ? 17 AC1 25 SER A 184 ? SER A 173 . ? 1_555 ? 18 AC1 25 TRP A 190 ? TRP A 179 . ? 1_555 ? 19 AC1 25 LEU A 216 ? LEU A 205 . ? 1_555 ? 20 AC1 25 SER A 218 ? SER A 207 . ? 1_555 ? 21 AC1 25 TYR A 246 ? TYR A 235 . ? 1_555 ? 22 AC1 25 DOD F . ? DOD A 425 . ? 1_555 ? 23 AC1 25 DOD F . ? DOD A 434 . ? 1_555 ? 24 AC1 25 DOD F . ? DOD A 451 . ? 1_555 ? 25 AC1 25 DOD F . ? DOD A 477 . ? 1_555 ? 26 AC2 5 THR A 175 ? THR A 164 . ? 1_555 ? 27 AC2 5 THR A 191 ? THR A 180 . ? 1_555 ? 28 AC2 5 ASN A 193 ? ASN A 182 . ? 1_555 ? 29 AC2 5 ILE A 196 ? ILE A 185 . ? 1_555 ? 30 AC2 5 ASP A 198 ? ASP A 187 . ? 1_555 ? 31 AC3 6 PRO A 138 ? PRO A 127 . ? 1_555 ? 32 AC3 6 ARG A 141 ? ARG A 130 . ? 1_555 ? 33 AC3 6 DOD F . ? DOD A 402 . ? 1_555 ? 34 AC3 6 DOD F . ? DOD A 404 . ? 1_555 ? 35 AC3 6 DOD F . ? DOD A 471 . ? 1_555 ? 36 AC3 6 DOD F . ? DOD A 570 . ? 1_555 ? 37 AC4 7 LYS A 147 ? LYS A 136 . ? 1_555 ? 38 AC4 7 GLY A 148 ? GLY A 137 . ? 1_555 ? 39 AC4 7 SER A 149 ? SER A 138 . ? 1_555 ? 40 AC4 7 ASP A 150 ? ASP A 139 . ? 1_555 ? 41 AC4 7 HIS A 151 ? HIS A 140 . ? 1_555 ? 42 AC4 7 DOD F . ? DOD A 403 . ? 1_555 ? 43 AC4 7 DOD F . ? DOD A 590 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLY 110 ? ? O A DOD 401 ? ? 1.39 2 1 O A ASP 187 ? ? D2 A DOD 409 ? ? 1.44 3 1 O A DOD 426 ? ? D1 A DOD 707 ? ? 1.51 4 1 O A DOD 401 ? ? O A DOD 501 ? ? 1.51 5 1 O A GLY 110 ? ? D1 A DOD 401 ? ? 1.56 6 1 O A GLY 110 ? ? D2 A DOD 401 ? ? 1.56 7 1 O3 A SO4 303 ? ? O A DOD 402 ? ? 1.97 8 1 O A DOD 659 ? ? O A DOD 707 ? ? 2.01 9 1 O A DOD 706 ? ? O A DOD 750 ? ? 2.07 10 1 O A DOD 426 ? ? O A DOD 707 ? ? 2.09 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A DOD 421 ? ? 1_555 O A DOD 421 ? ? 2_565 1.54 2 1 O A DOD 628 ? ? 1_555 O A DOD 667 ? ? 6_565 2.04 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CZ _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ARG _pdbx_validate_rmsd_bond.auth_seq_id_1 79 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 NH1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ARG _pdbx_validate_rmsd_bond.auth_seq_id_2 79 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.406 _pdbx_validate_rmsd_bond.bond_target_value 1.326 _pdbx_validate_rmsd_bond.bond_deviation 0.080 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.013 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 125.54 120.30 5.24 0.50 N 2 1 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH2 A ARG 79 ? ? 113.79 120.30 -6.51 0.50 N 3 1 CB A ASP 133 ? ? CG A ASP 133 ? ? OD1 A ASP 133 ? ? 125.17 118.30 6.87 0.90 N 4 1 CB A ASP 133 ? ? CG A ASP 133 ? ? OD2 A ASP 133 ? ? 111.63 118.30 -6.67 0.90 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 172 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -102.39 _pdbx_validate_torsion.psi -82.65 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A DOD 435 ? F DOD . 2 1 A DOD 565 ? F DOD . 3 1 A DOD 697 ? F DOD . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A DOD 783 ? 5.85 . 2 1 O ? A DOD 784 ? 6.15 . 3 1 O ? A DOD 785 ? 6.21 . 4 1 O ? A DOD 786 ? 6.33 . 5 1 O ? A DOD 787 ? 7.08 . 6 1 O ? A DOD 788 ? 7.46 . 7 1 O ? A DOD 789 ? 7.54 . 8 1 O ? A DOD 790 ? 8.17 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -10 ? A MET 1 2 1 Y 1 A ARG -9 ? A ARG 2 3 1 Y 1 A GLY -8 ? A GLY 3 4 1 Y 1 A SER -7 ? A SER 4 5 1 Y 1 A HIS -6 ? A HIS 5 6 1 Y 1 A HIS -5 ? A HIS 6 7 1 Y 1 A HIS -4 ? A HIS 7 8 1 Y 1 A HIS -3 ? A HIS 8 9 1 Y 1 A HIS -2 ? A HIS 9 10 1 Y 1 A HIS -1 ? A HIS 10 11 1 Y 1 A GLY 0 ? A GLY 11 12 1 Y 1 A SER 1 ? A SER 12 13 1 Y 1 A ALA 250 ? A ALA 261 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DOD O O N N 88 DOD D1 D N N 89 DOD D2 D N N 90 GLN N N N N 91 GLN CA C N S 92 GLN C C N N 93 GLN O O N N 94 GLN CB C N N 95 GLN CG C N N 96 GLN CD C N N 97 GLN OE1 O N N 98 GLN NE2 N N N 99 GLN OXT O N N 100 GLN H H N N 101 GLN H2 H N N 102 GLN HA H N N 103 GLN HB2 H N N 104 GLN HB3 H N N 105 GLN HG2 H N N 106 GLN HG3 H N N 107 GLN HE21 H N N 108 GLN HE22 H N N 109 GLN HXT H N N 110 GLU N N N N 111 GLU CA C N S 112 GLU C C N N 113 GLU O O N N 114 GLU CB C N N 115 GLU CG C N N 116 GLU CD C N N 117 GLU OE1 O N N 118 GLU OE2 O N N 119 GLU OXT O N N 120 GLU H H N N 121 GLU H2 H N N 122 GLU HA H N N 123 GLU HB2 H N N 124 GLU HB3 H N N 125 GLU HG2 H N N 126 GLU HG3 H N N 127 GLU HE2 H N N 128 GLU HXT H N N 129 GLY N N N N 130 GLY CA C N N 131 GLY C C N N 132 GLY O O N N 133 GLY OXT O N N 134 GLY H H N N 135 GLY H2 H N N 136 GLY HA2 H N N 137 GLY HA3 H N N 138 GLY HXT H N N 139 HEM CHA C N N 140 HEM CHB C N N 141 HEM CHC C N N 142 HEM CHD C N N 143 HEM C1A C Y N 144 HEM C2A C Y N 145 HEM C3A C Y N 146 HEM C4A C Y N 147 HEM CMA C N N 148 HEM CAA C N N 149 HEM CBA C N N 150 HEM CGA C N N 151 HEM O1A O N N 152 HEM O2A O N N 153 HEM C1B C N N 154 HEM C2B C N N 155 HEM C3B C N N 156 HEM C4B C N N 157 HEM CMB C N N 158 HEM CAB C N N 159 HEM CBB C N N 160 HEM C1C C Y N 161 HEM C2C C Y N 162 HEM C3C C Y N 163 HEM C4C C Y N 164 HEM CMC C N N 165 HEM CAC C N N 166 HEM CBC C N N 167 HEM C1D C N N 168 HEM C2D C N N 169 HEM C3D C N N 170 HEM C4D C N N 171 HEM CMD C N N 172 HEM CAD C N N 173 HEM CBD C N N 174 HEM CGD C N N 175 HEM O1D O N N 176 HEM O2D O N N 177 HEM NA N Y N 178 HEM NB N N N 179 HEM NC N Y N 180 HEM ND N N N 181 HEM FE FE N N 182 HEM HHB H N N 183 HEM HHC H N N 184 HEM HHD H N N 185 HEM HMA H N N 186 HEM HMAA H N N 187 HEM HMAB H N N 188 HEM HAA H N N 189 HEM HAAA H N N 190 HEM HBA H N N 191 HEM HBAA H N N 192 HEM HMB H N N 193 HEM HMBA H N N 194 HEM HMBB H N N 195 HEM HAB H N N 196 HEM HBB H N N 197 HEM HBBA H N N 198 HEM HMC H N N 199 HEM HMCA H N N 200 HEM HMCB H N N 201 HEM HAC H N N 202 HEM HBC H N N 203 HEM HBCA H N N 204 HEM HMD H N N 205 HEM HMDA H N N 206 HEM HMDB H N N 207 HEM HAD H N N 208 HEM HADA H N N 209 HEM HBD H N N 210 HEM HBDA H N N 211 HEM H2A H N N 212 HEM H2D H N N 213 HEM HHA H N N 214 HIS N N N N 215 HIS CA C N S 216 HIS C C N N 217 HIS O O N N 218 HIS CB C N N 219 HIS CG C Y N 220 HIS ND1 N Y N 221 HIS CD2 C Y N 222 HIS CE1 C Y N 223 HIS NE2 N Y N 224 HIS OXT O N N 225 HIS H H N N 226 HIS H2 H N N 227 HIS HA H N N 228 HIS HB2 H N N 229 HIS HB3 H N N 230 HIS HD1 H N N 231 HIS HD2 H N N 232 HIS HE1 H N N 233 HIS HE2 H N N 234 HIS HXT H N N 235 ILE N N N N 236 ILE CA C N S 237 ILE C C N N 238 ILE O O N N 239 ILE CB C N S 240 ILE CG1 C N N 241 ILE CG2 C N N 242 ILE CD1 C N N 243 ILE OXT O N N 244 ILE H H N N 245 ILE H2 H N N 246 ILE HA H N N 247 ILE HB H N N 248 ILE HG12 H N N 249 ILE HG13 H N N 250 ILE HG21 H N N 251 ILE HG22 H N N 252 ILE HG23 H N N 253 ILE HD11 H N N 254 ILE HD12 H N N 255 ILE HD13 H N N 256 ILE HXT H N N 257 K K K N N 258 LEU N N N N 259 LEU CA C N S 260 LEU C C N N 261 LEU O O N N 262 LEU CB C N N 263 LEU CG C N N 264 LEU CD1 C N N 265 LEU CD2 C N N 266 LEU OXT O N N 267 LEU H H N N 268 LEU H2 H N N 269 LEU HA H N N 270 LEU HB2 H N N 271 LEU HB3 H N N 272 LEU HG H N N 273 LEU HD11 H N N 274 LEU HD12 H N N 275 LEU HD13 H N N 276 LEU HD21 H N N 277 LEU HD22 H N N 278 LEU HD23 H N N 279 LEU HXT H N N 280 LYS N N N N 281 LYS CA C N S 282 LYS C C N N 283 LYS O O N N 284 LYS CB C N N 285 LYS CG C N N 286 LYS CD C N N 287 LYS CE C N N 288 LYS NZ N N N 289 LYS OXT O N N 290 LYS H H N N 291 LYS H2 H N N 292 LYS HA H N N 293 LYS HB2 H N N 294 LYS HB3 H N N 295 LYS HG2 H N N 296 LYS HG3 H N N 297 LYS HD2 H N N 298 LYS HD3 H N N 299 LYS HE2 H N N 300 LYS HE3 H N N 301 LYS HZ1 H N N 302 LYS HZ2 H N N 303 LYS HZ3 H N N 304 LYS HXT H N N 305 MET N N N N 306 MET CA C N S 307 MET C C N N 308 MET O O N N 309 MET CB C N N 310 MET CG C N N 311 MET SD S N N 312 MET CE C N N 313 MET OXT O N N 314 MET H H N N 315 MET H2 H N N 316 MET HA H N N 317 MET HB2 H N N 318 MET HB3 H N N 319 MET HG2 H N N 320 MET HG3 H N N 321 MET HE1 H N N 322 MET HE2 H N N 323 MET HE3 H N N 324 MET HXT H N N 325 PHE N N N N 326 PHE CA C N S 327 PHE C C N N 328 PHE O O N N 329 PHE CB C N N 330 PHE CG C Y N 331 PHE CD1 C Y N 332 PHE CD2 C Y N 333 PHE CE1 C Y N 334 PHE CE2 C Y N 335 PHE CZ C Y N 336 PHE OXT O N N 337 PHE H H N N 338 PHE H2 H N N 339 PHE HA H N N 340 PHE HB2 H N N 341 PHE HB3 H N N 342 PHE HD1 H N N 343 PHE HD2 H N N 344 PHE HE1 H N N 345 PHE HE2 H N N 346 PHE HZ H N N 347 PHE HXT H N N 348 PRO N N N N 349 PRO CA C N S 350 PRO C C N N 351 PRO O O N N 352 PRO CB C N N 353 PRO CG C N N 354 PRO CD C N N 355 PRO OXT O N N 356 PRO H H N N 357 PRO HA H N N 358 PRO HB2 H N N 359 PRO HB3 H N N 360 PRO HG2 H N N 361 PRO HG3 H N N 362 PRO HD2 H N N 363 PRO HD3 H N N 364 PRO HXT H N N 365 SER N N N N 366 SER CA C N S 367 SER C C N N 368 SER O O N N 369 SER CB C N N 370 SER OG O N N 371 SER OXT O N N 372 SER H H N N 373 SER H2 H N N 374 SER HA H N N 375 SER HB2 H N N 376 SER HB3 H N N 377 SER HG H N N 378 SER HXT H N N 379 SO4 S S N N 380 SO4 O1 O N N 381 SO4 O2 O N N 382 SO4 O3 O N N 383 SO4 O4 O N N 384 THR N N N N 385 THR CA C N S 386 THR C C N N 387 THR O O N N 388 THR CB C N R 389 THR OG1 O N N 390 THR CG2 C N N 391 THR OXT O N N 392 THR H H N N 393 THR H2 H N N 394 THR HA H N N 395 THR HB H N N 396 THR HG1 H N N 397 THR HG21 H N N 398 THR HG22 H N N 399 THR HG23 H N N 400 THR HXT H N N 401 TRP N N N N 402 TRP CA C N S 403 TRP C C N N 404 TRP O O N N 405 TRP CB C N N 406 TRP CG C Y N 407 TRP CD1 C Y N 408 TRP CD2 C Y N 409 TRP NE1 N Y N 410 TRP CE2 C Y N 411 TRP CE3 C Y N 412 TRP CZ2 C Y N 413 TRP CZ3 C Y N 414 TRP CH2 C Y N 415 TRP OXT O N N 416 TRP H H N N 417 TRP H2 H N N 418 TRP HA H N N 419 TRP HB2 H N N 420 TRP HB3 H N N 421 TRP HD1 H N N 422 TRP HE1 H N N 423 TRP HE3 H N N 424 TRP HZ2 H N N 425 TRP HZ3 H N N 426 TRP HH2 H N N 427 TRP HXT H N N 428 TYR N N N N 429 TYR CA C N S 430 TYR C C N N 431 TYR O O N N 432 TYR CB C N N 433 TYR CG C Y N 434 TYR CD1 C Y N 435 TYR CD2 C Y N 436 TYR CE1 C Y N 437 TYR CE2 C Y N 438 TYR CZ C Y N 439 TYR OH O N N 440 TYR OXT O N N 441 TYR H H N N 442 TYR H2 H N N 443 TYR HA H N N 444 TYR HB2 H N N 445 TYR HB3 H N N 446 TYR HD1 H N N 447 TYR HD2 H N N 448 TYR HE1 H N N 449 TYR HE2 H N N 450 TYR HH H N N 451 TYR HXT H N N 452 VAL N N N N 453 VAL CA C N S 454 VAL C C N N 455 VAL O O N N 456 VAL CB C N N 457 VAL CG1 C N N 458 VAL CG2 C N N 459 VAL OXT O N N 460 VAL H H N N 461 VAL H2 H N N 462 VAL HA H N N 463 VAL HB H N N 464 VAL HG11 H N N 465 VAL HG12 H N N 466 VAL HG13 H N N 467 VAL HG21 H N N 468 VAL HG22 H N N 469 VAL HG23 H N N 470 VAL HXT H N N 471 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DOD O D1 sing N N 83 DOD O D2 sing N N 84 GLN N CA sing N N 85 GLN N H sing N N 86 GLN N H2 sing N N 87 GLN CA C sing N N 88 GLN CA CB sing N N 89 GLN CA HA sing N N 90 GLN C O doub N N 91 GLN C OXT sing N N 92 GLN CB CG sing N N 93 GLN CB HB2 sing N N 94 GLN CB HB3 sing N N 95 GLN CG CD sing N N 96 GLN CG HG2 sing N N 97 GLN CG HG3 sing N N 98 GLN CD OE1 doub N N 99 GLN CD NE2 sing N N 100 GLN NE2 HE21 sing N N 101 GLN NE2 HE22 sing N N 102 GLN OXT HXT sing N N 103 GLU N CA sing N N 104 GLU N H sing N N 105 GLU N H2 sing N N 106 GLU CA C sing N N 107 GLU CA CB sing N N 108 GLU CA HA sing N N 109 GLU C O doub N N 110 GLU C OXT sing N N 111 GLU CB CG sing N N 112 GLU CB HB2 sing N N 113 GLU CB HB3 sing N N 114 GLU CG CD sing N N 115 GLU CG HG2 sing N N 116 GLU CG HG3 sing N N 117 GLU CD OE1 doub N N 118 GLU CD OE2 sing N N 119 GLU OE2 HE2 sing N N 120 GLU OXT HXT sing N N 121 GLY N CA sing N N 122 GLY N H sing N N 123 GLY N H2 sing N N 124 GLY CA C sing N N 125 GLY CA HA2 sing N N 126 GLY CA HA3 sing N N 127 GLY C O doub N N 128 GLY C OXT sing N N 129 GLY OXT HXT sing N N 130 HEM CHA C1A sing N N 131 HEM CHA C4D doub N N 132 HEM CHA HHA sing N N 133 HEM CHB C4A sing N N 134 HEM CHB C1B doub N N 135 HEM CHB HHB sing N N 136 HEM CHC C4B sing N N 137 HEM CHC C1C doub N N 138 HEM CHC HHC sing N N 139 HEM CHD C4C doub N N 140 HEM CHD C1D sing N N 141 HEM CHD HHD sing N N 142 HEM C1A C2A doub Y N 143 HEM C1A NA sing Y N 144 HEM C2A C3A sing Y N 145 HEM C2A CAA sing N N 146 HEM C3A C4A doub Y N 147 HEM C3A CMA sing N N 148 HEM C4A NA sing Y N 149 HEM CMA HMA sing N N 150 HEM CMA HMAA sing N N 151 HEM CMA HMAB sing N N 152 HEM CAA CBA sing N N 153 HEM CAA HAA sing N N 154 HEM CAA HAAA sing N N 155 HEM CBA CGA sing N N 156 HEM CBA HBA sing N N 157 HEM CBA HBAA sing N N 158 HEM CGA O1A doub N N 159 HEM CGA O2A sing N N 160 HEM C1B C2B sing N N 161 HEM C1B NB sing N N 162 HEM C2B C3B doub N N 163 HEM C2B CMB sing N N 164 HEM C3B C4B sing N N 165 HEM C3B CAB sing N N 166 HEM C4B NB doub N N 167 HEM CMB HMB sing N N 168 HEM CMB HMBA sing N N 169 HEM CMB HMBB sing N N 170 HEM CAB CBB doub N N 171 HEM CAB HAB sing N N 172 HEM CBB HBB sing N N 173 HEM CBB HBBA sing N N 174 HEM C1C C2C sing Y N 175 HEM C1C NC sing Y N 176 HEM C2C C3C doub Y N 177 HEM C2C CMC sing N N 178 HEM C3C C4C sing Y N 179 HEM C3C CAC sing N N 180 HEM C4C NC sing Y N 181 HEM CMC HMC sing N N 182 HEM CMC HMCA sing N N 183 HEM CMC HMCB sing N N 184 HEM CAC CBC doub N N 185 HEM CAC HAC sing N N 186 HEM CBC HBC sing N N 187 HEM CBC HBCA sing N N 188 HEM C1D C2D sing N N 189 HEM C1D ND doub N N 190 HEM C2D C3D doub N N 191 HEM C2D CMD sing N N 192 HEM C3D C4D sing N N 193 HEM C3D CAD sing N N 194 HEM C4D ND sing N N 195 HEM CMD HMD sing N N 196 HEM CMD HMDA sing N N 197 HEM CMD HMDB sing N N 198 HEM CAD CBD sing N N 199 HEM CAD HAD sing N N 200 HEM CAD HADA sing N N 201 HEM CBD CGD sing N N 202 HEM CBD HBD sing N N 203 HEM CBD HBDA sing N N 204 HEM CGD O1D doub N N 205 HEM CGD O2D sing N N 206 HEM O2A H2A sing N N 207 HEM O2D H2D sing N N 208 HEM FE NA sing N N 209 HEM FE NB sing N N 210 HEM FE NC sing N N 211 HEM FE ND sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 ILE N CA sing N N 234 ILE N H sing N N 235 ILE N H2 sing N N 236 ILE CA C sing N N 237 ILE CA CB sing N N 238 ILE CA HA sing N N 239 ILE C O doub N N 240 ILE C OXT sing N N 241 ILE CB CG1 sing N N 242 ILE CB CG2 sing N N 243 ILE CB HB sing N N 244 ILE CG1 CD1 sing N N 245 ILE CG1 HG12 sing N N 246 ILE CG1 HG13 sing N N 247 ILE CG2 HG21 sing N N 248 ILE CG2 HG22 sing N N 249 ILE CG2 HG23 sing N N 250 ILE CD1 HD11 sing N N 251 ILE CD1 HD12 sing N N 252 ILE CD1 HD13 sing N N 253 ILE OXT HXT sing N N 254 LEU N CA sing N N 255 LEU N H sing N N 256 LEU N H2 sing N N 257 LEU CA C sing N N 258 LEU CA CB sing N N 259 LEU CA HA sing N N 260 LEU C O doub N N 261 LEU C OXT sing N N 262 LEU CB CG sing N N 263 LEU CB HB2 sing N N 264 LEU CB HB3 sing N N 265 LEU CG CD1 sing N N 266 LEU CG CD2 sing N N 267 LEU CG HG sing N N 268 LEU CD1 HD11 sing N N 269 LEU CD1 HD12 sing N N 270 LEU CD1 HD13 sing N N 271 LEU CD2 HD21 sing N N 272 LEU CD2 HD22 sing N N 273 LEU CD2 HD23 sing N N 274 LEU OXT HXT sing N N 275 LYS N CA sing N N 276 LYS N H sing N N 277 LYS N H2 sing N N 278 LYS CA C sing N N 279 LYS CA CB sing N N 280 LYS CA HA sing N N 281 LYS C O doub N N 282 LYS C OXT sing N N 283 LYS CB CG sing N N 284 LYS CB HB2 sing N N 285 LYS CB HB3 sing N N 286 LYS CG CD sing N N 287 LYS CG HG2 sing N N 288 LYS CG HG3 sing N N 289 LYS CD CE sing N N 290 LYS CD HD2 sing N N 291 LYS CD HD3 sing N N 292 LYS CE NZ sing N N 293 LYS CE HE2 sing N N 294 LYS CE HE3 sing N N 295 LYS NZ HZ1 sing N N 296 LYS NZ HZ2 sing N N 297 LYS NZ HZ3 sing N N 298 LYS OXT HXT sing N N 299 MET N CA sing N N 300 MET N H sing N N 301 MET N H2 sing N N 302 MET CA C sing N N 303 MET CA CB sing N N 304 MET CA HA sing N N 305 MET C O doub N N 306 MET C OXT sing N N 307 MET CB CG sing N N 308 MET CB HB2 sing N N 309 MET CB HB3 sing N N 310 MET CG SD sing N N 311 MET CG HG2 sing N N 312 MET CG HG3 sing N N 313 MET SD CE sing N N 314 MET CE HE1 sing N N 315 MET CE HE2 sing N N 316 MET CE HE3 sing N N 317 MET OXT HXT sing N N 318 PHE N CA sing N N 319 PHE N H sing N N 320 PHE N H2 sing N N 321 PHE CA C sing N N 322 PHE CA CB sing N N 323 PHE CA HA sing N N 324 PHE C O doub N N 325 PHE C OXT sing N N 326 PHE CB CG sing N N 327 PHE CB HB2 sing N N 328 PHE CB HB3 sing N N 329 PHE CG CD1 doub Y N 330 PHE CG CD2 sing Y N 331 PHE CD1 CE1 sing Y N 332 PHE CD1 HD1 sing N N 333 PHE CD2 CE2 doub Y N 334 PHE CD2 HD2 sing N N 335 PHE CE1 CZ doub Y N 336 PHE CE1 HE1 sing N N 337 PHE CE2 CZ sing Y N 338 PHE CE2 HE2 sing N N 339 PHE CZ HZ sing N N 340 PHE OXT HXT sing N N 341 PRO N CA sing N N 342 PRO N CD sing N N 343 PRO N H sing N N 344 PRO CA C sing N N 345 PRO CA CB sing N N 346 PRO CA HA sing N N 347 PRO C O doub N N 348 PRO C OXT sing N N 349 PRO CB CG sing N N 350 PRO CB HB2 sing N N 351 PRO CB HB3 sing N N 352 PRO CG CD sing N N 353 PRO CG HG2 sing N N 354 PRO CG HG3 sing N N 355 PRO CD HD2 sing N N 356 PRO CD HD3 sing N N 357 PRO OXT HXT sing N N 358 SER N CA sing N N 359 SER N H sing N N 360 SER N H2 sing N N 361 SER CA C sing N N 362 SER CA CB sing N N 363 SER CA HA sing N N 364 SER C O doub N N 365 SER C OXT sing N N 366 SER CB OG sing N N 367 SER CB HB2 sing N N 368 SER CB HB3 sing N N 369 SER OG HG sing N N 370 SER OXT HXT sing N N 371 SO4 S O1 doub N N 372 SO4 S O2 doub N N 373 SO4 S O3 sing N N 374 SO4 S O4 sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TRP N CA sing N N 392 TRP N H sing N N 393 TRP N H2 sing N N 394 TRP CA C sing N N 395 TRP CA CB sing N N 396 TRP CA HA sing N N 397 TRP C O doub N N 398 TRP C OXT sing N N 399 TRP CB CG sing N N 400 TRP CB HB2 sing N N 401 TRP CB HB3 sing N N 402 TRP CG CD1 doub Y N 403 TRP CG CD2 sing Y N 404 TRP CD1 NE1 sing Y N 405 TRP CD1 HD1 sing N N 406 TRP CD2 CE2 doub Y N 407 TRP CD2 CE3 sing Y N 408 TRP NE1 CE2 sing Y N 409 TRP NE1 HE1 sing N N 410 TRP CE2 CZ2 sing Y N 411 TRP CE3 CZ3 doub Y N 412 TRP CE3 HE3 sing N N 413 TRP CZ2 CH2 doub Y N 414 TRP CZ2 HZ2 sing N N 415 TRP CZ3 CH2 sing Y N 416 TRP CZ3 HZ3 sing N N 417 TRP CH2 HH2 sing N N 418 TRP OXT HXT sing N N 419 TYR N CA sing N N 420 TYR N H sing N N 421 TYR N H2 sing N N 422 TYR CA C sing N N 423 TYR CA CB sing N N 424 TYR CA HA sing N N 425 TYR C O doub N N 426 TYR C OXT sing N N 427 TYR CB CG sing N N 428 TYR CB HB2 sing N N 429 TYR CB HB3 sing N N 430 TYR CG CD1 doub Y N 431 TYR CG CD2 sing Y N 432 TYR CD1 CE1 sing Y N 433 TYR CD1 HD1 sing N N 434 TYR CD2 CE2 doub Y N 435 TYR CD2 HD2 sing N N 436 TYR CE1 CZ doub Y N 437 TYR CE1 HE1 sing N N 438 TYR CE2 CZ sing Y N 439 TYR CE2 HE2 sing N N 440 TYR CZ OH sing N N 441 TYR OH HH sing N N 442 TYR OXT HXT sing N N 443 VAL N CA sing N N 444 VAL N H sing N N 445 VAL N H2 sing N N 446 VAL CA C sing N N 447 VAL CA CB sing N N 448 VAL CA HA sing N N 449 VAL C O doub N N 450 VAL C OXT sing N N 451 VAL CB CG1 sing N N 452 VAL CB CG2 sing N N 453 VAL CB HB sing N N 454 VAL CG1 HG11 sing N N 455 VAL CG1 HG12 sing N N 456 VAL CG1 HG13 sing N N 457 VAL CG2 HG21 sing N N 458 VAL CG2 HG22 sing N N 459 VAL CG2 HG23 sing N N 460 VAL OXT HXT sing N N 461 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/K015656/1 1 'Wellcome Trust' 'United Kingdom' WT094104MA 2 # _pdbx_initial_refinement_model.accession_code 2XIF _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5JPR _atom_sites.fract_transf_matrix[1][1] 0.012181 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012181 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013305 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C D FE H K N O S # loop_