data_5JPX # _entry.id 5JPX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JPX pdb_00005jpx 10.2210/pdb5jpx/pdb WWPDB D_1000220298 ? ? BMRB 30075 ? 10.13018/BMR30075 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-09 2 'Structure model' 1 1 2017-09-13 3 'Structure model' 1 2 2018-02-07 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 2 0 2019-10-30 6 'Structure model' 2 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Experimental preparation' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Atomic model' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_nmr_exptl_sample_conditions 3 4 'Structure model' pdbx_nmr_software 4 5 'Structure model' atom_site 5 5 'Structure model' pdbx_database_related 6 5 'Structure model' pdbx_nmr_spectrometer 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_nmr_exptl_sample_conditions.temperature' 3 3 'Structure model' '_pdbx_nmr_exptl_sample_conditions.temperature_units' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_atom_site.auth_atom_id' 6 5 'Structure model' '_atom_site.label_atom_id' 7 5 'Structure model' '_pdbx_nmr_spectrometer.model' 8 6 'Structure model' '_database_2.pdbx_DOI' 9 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5JPX _pdbx_database_status.recvd_initial_deposition_date 2016-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 30075 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wallenhammar, A.' 1 ? 'Anandapadamanaban, M.' 2 ? 'Sunnerhagen, M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS ONE' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1932-6203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first e0181551 _citation.page_last e0181551 _citation.title 'Solution NMR structure of the TRIM21 B-box2 and identification of residues involved in its interaction with the RING domain.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pone.0181551 _citation.pdbx_database_id_PubMed 28753623 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wallenhammar, A.' 1 ? primary 'Anandapadamanaban, M.' 2 ? primary 'Lemak, A.' 3 ? primary 'Mirabello, C.' 4 ? primary 'Lundstrom, P.' 5 ? primary 'Wallner, B.' 6 ? primary 'Sunnerhagen, M.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase TRIM21' 5143.907 1 6.3.2.- ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;52 kDa Ro protein,52 kDa ribonucleoprotein autoantigen Ro/SS-A,RING finger protein 81,Ro(SS-A),Sjoegren syndrome type A antigen,SS-A,Tripartite motif-containing protein 21 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEE _entity_poly.pdbx_seq_one_letter_code_can GTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 GLN n 1 4 GLY n 1 5 GLU n 1 6 ARG n 1 7 CYS n 1 8 ALA n 1 9 VAL n 1 10 HIS n 1 11 GLY n 1 12 GLU n 1 13 ARG n 1 14 LEU n 1 15 HIS n 1 16 LEU n 1 17 PHE n 1 18 CYS n 1 19 GLU n 1 20 LYS n 1 21 ASP n 1 22 GLY n 1 23 LYS n 1 24 ALA n 1 25 LEU n 1 26 CYS n 1 27 TRP n 1 28 VAL n 1 29 CYS n 1 30 ALA n 1 31 GLN n 1 32 SER n 1 33 ARG n 1 34 LYS n 1 35 HIS n 1 36 ARG n 1 37 ASP n 1 38 HIS n 1 39 ALA n 1 40 MET n 1 41 VAL n 1 42 PRO n 1 43 LEU n 1 44 GLU n 1 45 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 45 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TRIM21, RNF81, RO52, SSA1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 86 86 GLY GLY A . n A 1 2 THR 2 87 87 THR THR A . n A 1 3 GLN 3 88 88 GLN GLN A . n A 1 4 GLY 4 89 89 GLY GLY A . n A 1 5 GLU 5 90 90 GLU GLU A . n A 1 6 ARG 6 91 91 ARG ARG A . n A 1 7 CYS 7 92 92 CYS CYS A . n A 1 8 ALA 8 93 93 ALA ALA A . n A 1 9 VAL 9 94 94 VAL VAL A . n A 1 10 HIS 10 95 95 HIS HIS A . n A 1 11 GLY 11 96 96 GLY GLY A . n A 1 12 GLU 12 97 97 GLU GLU A . n A 1 13 ARG 13 98 98 ARG ARG A . n A 1 14 LEU 14 99 99 LEU LEU A . n A 1 15 HIS 15 100 100 HIS HIS A . n A 1 16 LEU 16 101 101 LEU LEU A . n A 1 17 PHE 17 102 102 PHE PHE A . n A 1 18 CYS 18 103 103 CYS CYS A . n A 1 19 GLU 19 104 104 GLU GLU A . n A 1 20 LYS 20 105 105 LYS LYS A . n A 1 21 ASP 21 106 106 ASP ASP A . n A 1 22 GLY 22 107 107 GLY GLY A . n A 1 23 LYS 23 108 108 LYS LYS A . n A 1 24 ALA 24 109 109 ALA ALA A . n A 1 25 LEU 25 110 110 LEU LEU A . n A 1 26 CYS 26 111 111 CYS CYS A . n A 1 27 TRP 27 112 112 TRP TRP A . n A 1 28 VAL 28 113 113 VAL VAL A . n A 1 29 CYS 29 114 114 CYS CYS A . n A 1 30 ALA 30 115 115 ALA ALA A . n A 1 31 GLN 31 116 116 GLN GLN A . n A 1 32 SER 32 117 117 SER SER A . n A 1 33 ARG 33 118 118 ARG ARG A . n A 1 34 LYS 34 119 119 LYS LYS A . n A 1 35 HIS 35 120 120 HIS HIS A . n A 1 36 ARG 36 121 121 ARG ARG A . n A 1 37 ASP 37 122 122 ASP ASP A . n A 1 38 HIS 38 123 123 HIS HIS A . n A 1 39 ALA 39 124 124 ALA ALA A . n A 1 40 MET 40 125 125 MET MET A . n A 1 41 VAL 41 126 126 VAL VAL A . n A 1 42 PRO 42 127 127 PRO PRO A . n A 1 43 LEU 43 128 128 LEU LEU A . n A 1 44 GLU 44 129 129 GLU GLU A . n A 1 45 GLU 45 130 130 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 130 ? O ? A GLU 45 O 2 2 Y 1 A GLU 130 ? O ? A GLU 45 O 3 3 Y 1 A GLU 130 ? O ? A GLU 45 O 4 4 Y 1 A GLU 130 ? O ? A GLU 45 O 5 5 Y 1 A GLU 130 ? O ? A GLU 45 O 6 6 Y 1 A GLU 130 ? O ? A GLU 45 O 7 7 Y 1 A GLU 130 ? O ? A GLU 45 O 8 8 Y 1 A GLU 130 ? O ? A GLU 45 O 9 9 Y 1 A GLU 130 ? O ? A GLU 45 O 10 10 Y 1 A GLU 130 ? O ? A GLU 45 O 11 11 Y 1 A GLU 130 ? O ? A GLU 45 O 12 12 Y 1 A GLU 130 ? O ? A GLU 45 O 13 13 Y 1 A GLU 130 ? O ? A GLU 45 O 14 14 Y 1 A GLU 130 ? O ? A GLU 45 O 15 15 Y 1 A GLU 130 ? O ? A GLU 45 O 16 16 Y 1 A GLU 130 ? O ? A GLU 45 O 17 17 Y 1 A GLU 130 ? O ? A GLU 45 O 18 18 Y 1 A GLU 130 ? O ? A GLU 45 O 19 19 Y 1 A GLU 130 ? O ? A GLU 45 O 20 20 Y 1 A GLU 130 ? O ? A GLU 45 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JPX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5JPX _struct.title 'Solution structure of the TRIM21 B-box2 (B2)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JPX _struct_keywords.text 'B-box, Metal binding protein, RING-like fold, E3 ligase, TRIM protein, Zinc-binding motif, Ubiquitination' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RO52_HUMAN _struct_ref.pdbx_db_accession P19474 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEE _struct_ref.pdbx_align_begin 86 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JPX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19474 _struct_ref_seq.db_align_beg 86 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 86 _struct_ref_seq.pdbx_auth_seq_align_end 130 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4090 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 111 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 116 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 7 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 92 A ZN 201 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc2 metalc ? ? A HIS 10 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 95 A ZN 201 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc3 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 111 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc4 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 114 A ZN 201 1_555 ? ? ? ? ? ? ? 2.340 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 7 ? A CYS 92 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 10 ? A HIS 95 ? 1_555 108.0 ? 2 SG ? A CYS 7 ? A CYS 92 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 26 ? A CYS 111 ? 1_555 109.6 ? 3 NE2 ? A HIS 10 ? A HIS 95 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 26 ? A CYS 111 ? 1_555 105.0 ? 4 SG ? A CYS 7 ? A CYS 92 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 29 ? A CYS 114 ? 1_555 113.6 ? 5 NE2 ? A HIS 10 ? A HIS 95 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 29 ? A CYS 114 ? 1_555 109.9 ? 6 SG ? A CYS 26 ? A CYS 111 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 29 ? A CYS 114 ? 1_555 110.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 6 ? CYS A 7 ? ARG A 91 CYS A 92 AA1 2 GLU A 12 ? ARG A 13 ? GLU A 97 ARG A 98 AA2 1 LYS A 23 ? ALA A 24 ? LYS A 108 ALA A 109 AA2 2 PHE A 17 ? CYS A 18 ? PHE A 102 CYS A 103 AA2 3 MET A 40 ? VAL A 41 ? MET A 125 VAL A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 7 ? N CYS A 92 O GLU A 12 ? O GLU A 97 AA2 1 2 O LYS A 23 ? O LYS A 108 N CYS A 18 ? N CYS A 103 AA2 2 3 N PHE A 17 ? N PHE A 102 O VAL A 41 ? O VAL A 126 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 7 ? CYS A 92 . ? 1_555 ? 2 AC1 4 HIS A 10 ? HIS A 95 . ? 1_555 ? 3 AC1 4 CYS A 26 ? CYS A 111 . ? 1_555 ? 4 AC1 4 CYS A 29 ? CYS A 114 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 101 ? ? -170.28 141.39 2 1 HIS A 123 ? ? -159.15 -81.20 3 2 GLN A 88 ? ? -142.13 12.66 4 2 GLU A 90 ? ? -69.68 93.51 5 2 LEU A 101 ? ? -171.42 138.84 6 2 HIS A 123 ? ? -152.71 -81.41 7 2 GLU A 129 ? ? -105.88 79.31 8 3 THR A 87 ? ? -99.60 -154.45 9 3 LEU A 101 ? ? -170.43 143.67 10 3 HIS A 120 ? ? -138.37 -80.20 11 3 ARG A 121 ? ? 177.69 121.23 12 3 ALA A 124 ? ? -168.57 99.17 13 4 ARG A 98 ? ? -69.54 -178.98 14 4 LEU A 101 ? ? -170.45 146.76 15 4 GLU A 129 ? ? -164.88 105.87 16 5 GLN A 88 ? ? -79.10 -75.02 17 5 LYS A 119 ? ? -122.94 -158.59 18 5 ARG A 121 ? ? -144.90 -36.73 19 5 HIS A 123 ? ? -146.28 -65.91 20 5 MET A 125 ? ? -163.29 117.62 21 6 LYS A 119 ? ? -152.08 -55.40 22 6 HIS A 123 ? ? -99.08 -60.32 23 7 LEU A 101 ? ? -172.24 143.38 24 8 HIS A 120 ? ? -165.84 110.54 25 8 ARG A 121 ? ? -157.27 -55.72 26 8 ASP A 122 ? ? 73.82 107.57 27 8 HIS A 123 ? ? 84.54 -70.64 28 9 SER A 117 ? ? -68.25 95.75 29 9 LYS A 119 ? ? -121.96 -82.29 30 10 GLU A 90 ? ? -96.27 32.74 31 10 LEU A 101 ? ? -170.35 146.69 32 10 ARG A 118 ? ? -68.89 79.16 33 10 HIS A 120 ? ? -65.98 78.96 34 11 GLN A 88 ? ? -64.41 96.15 35 11 GLU A 90 ? ? -65.97 94.08 36 11 HIS A 120 ? ? -132.92 -158.66 37 11 HIS A 123 ? ? -160.55 -51.42 38 12 THR A 87 ? ? 49.75 71.62 39 12 GLU A 90 ? ? -142.94 42.80 40 12 GLU A 129 ? ? -104.35 40.64 41 13 GLN A 88 ? ? 58.75 76.81 42 13 LEU A 101 ? ? -171.14 121.32 43 13 SER A 117 ? ? -68.42 -175.09 44 13 LYS A 119 ? ? -54.66 -70.68 45 13 HIS A 120 ? ? -172.90 -177.99 46 13 HIS A 123 ? ? -95.38 -62.89 47 13 ALA A 124 ? ? -115.59 58.92 48 13 GLU A 129 ? ? -141.35 56.62 49 14 GLU A 90 ? ? -90.43 40.91 50 14 ARG A 121 ? ? -146.46 -79.28 51 14 ALA A 124 ? ? -67.26 89.81 52 15 ARG A 118 ? ? -90.64 38.69 53 15 HIS A 120 ? ? -115.87 -74.01 54 15 ASP A 122 ? ? -94.81 -145.12 55 15 HIS A 123 ? ? 77.95 140.93 56 16 THR A 87 ? ? -63.03 93.52 57 16 LEU A 101 ? ? -170.43 115.40 58 16 ARG A 121 ? ? -139.61 -75.28 59 16 ASP A 122 ? ? -170.95 101.06 60 16 HIS A 123 ? ? -127.75 -61.85 61 16 ALA A 124 ? ? -175.08 86.27 62 16 MET A 125 ? ? -167.11 110.94 63 17 GLN A 88 ? ? -87.95 44.73 64 17 GLU A 90 ? ? -68.23 78.44 65 17 LYS A 119 ? ? 80.26 -41.01 66 17 HIS A 123 ? ? -123.63 -158.17 67 17 ALA A 124 ? ? -66.64 89.36 68 18 GLN A 88 ? ? -67.27 -179.90 69 18 ASP A 122 ? ? -63.84 98.94 70 18 LEU A 128 ? ? -69.37 97.24 71 19 GLN A 88 ? ? 56.40 71.23 72 19 LEU A 101 ? ? -172.16 149.30 73 19 ARG A 121 ? ? -165.94 91.44 74 19 HIS A 123 ? ? -166.92 -46.88 75 20 HIS A 120 ? ? -104.53 -88.37 76 20 HIS A 123 ? ? -125.26 -67.16 77 20 GLU A 129 ? ? -95.84 52.83 # _pdbx_nmr_ensemble.entry_id 5JPX _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5JPX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;450 uM [U-13C; U-15N] TRIM21 Bbox2, 50 mM TRIS, 150 mM sodium chloride, 10 mM beta-mercaptoethanol, 10 uM ZINC ION, 10 % glycerol, 90% H2O/10% D2O ; '90% H2O/10% D2O' Backbone_assignment solution '13C, 15N-Bbox2 for backbone assignment' 2 ;450 uM [U-13C; U-15N] TRIM21 Bbox2, 50 mM deuterated TRIS, 150 mM sodium chloride, 10 mM beta-mercaptoethanol, 10 uM ZINC ION, 10 % glycerol, 90% H2O/10% D2O ; '90% H2O/10% D2O' Sidechain_assignment solution '13C, 15N-Bbox2 for sidechain assignment' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'TRIM21 Bbox2' 450 ? uM '[U-13C; U-15N]' 1 TRIS 50 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 beta-mercaptoethanol 10 ? mM 'natural abundance' 1 'ZINC ION' 10 ? uM 'natural abundance' 1 glycerol 10 ? % 'natural abundance' 2 'TRIM21 Bbox2' 450 ? uM '[U-13C; U-15N]' 2 TRIS 50 ? mM deuterated 2 'sodium chloride' 150 ? mM 'natural abundance' 2 beta-mercaptoethanol 10 ? mM 'natural abundance' 2 'ZINC ION' 10 ? uM 'natural abundance' 2 glycerol 10 ? % 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 bar Ambient 7.5 '50mM TRIS, 150mM NaCl' '50mM TRIS, 150mM NaCl, 10mM Betamercaptoethanol, 10uM ZnCl2' ? mM Backbone_assignment ? pH ? ? K 2 298 bar Ambient 7.5 '50mM TRIS, 150mM NaCl' '50mM TRIS, 150mM NaCl, 10mM Betamercaptoethanol, 10uM ZnCl2' ? mM Sidechain_assignment ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D HN(CO)CA' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 7 1 1 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D 1H-15N TOCSY' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 10 2 2 '2D 1H-13C HSQC aliphatic' 2 isotropic 11 2 2 '2D 1H-13C HSQC aromatic' 2 isotropic 12 2 2 '3D HCCH-TOCSY' 2 isotropic 13 2 2 '3D 1H-13C NOESY aliphatic' 2 isotropic 14 2 2 '3D 1H-13C NOESY aromatic' 2 isotropic # _pdbx_nmr_refine.entry_id 5JPX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 'structure calculation' TALOS ? 'Cornilescu, Delaglio and Bax' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 LEU N N N N 141 LEU CA C N S 142 LEU C C N N 143 LEU O O N N 144 LEU CB C N N 145 LEU CG C N N 146 LEU CD1 C N N 147 LEU CD2 C N N 148 LEU OXT O N N 149 LEU H H N N 150 LEU H2 H N N 151 LEU HA H N N 152 LEU HB2 H N N 153 LEU HB3 H N N 154 LEU HG H N N 155 LEU HD11 H N N 156 LEU HD12 H N N 157 LEU HD13 H N N 158 LEU HD21 H N N 159 LEU HD22 H N N 160 LEU HD23 H N N 161 LEU HXT H N N 162 LYS N N N N 163 LYS CA C N S 164 LYS C C N N 165 LYS O O N N 166 LYS CB C N N 167 LYS CG C N N 168 LYS CD C N N 169 LYS CE C N N 170 LYS NZ N N N 171 LYS OXT O N N 172 LYS H H N N 173 LYS H2 H N N 174 LYS HA H N N 175 LYS HB2 H N N 176 LYS HB3 H N N 177 LYS HG2 H N N 178 LYS HG3 H N N 179 LYS HD2 H N N 180 LYS HD3 H N N 181 LYS HE2 H N N 182 LYS HE3 H N N 183 LYS HZ1 H N N 184 LYS HZ2 H N N 185 LYS HZ3 H N N 186 LYS HXT H N N 187 MET N N N N 188 MET CA C N S 189 MET C C N N 190 MET O O N N 191 MET CB C N N 192 MET CG C N N 193 MET SD S N N 194 MET CE C N N 195 MET OXT O N N 196 MET H H N N 197 MET H2 H N N 198 MET HA H N N 199 MET HB2 H N N 200 MET HB3 H N N 201 MET HG2 H N N 202 MET HG3 H N N 203 MET HE1 H N N 204 MET HE2 H N N 205 MET HE3 H N N 206 MET HXT H N N 207 PHE N N N N 208 PHE CA C N S 209 PHE C C N N 210 PHE O O N N 211 PHE CB C N N 212 PHE CG C Y N 213 PHE CD1 C Y N 214 PHE CD2 C Y N 215 PHE CE1 C Y N 216 PHE CE2 C Y N 217 PHE CZ C Y N 218 PHE OXT O N N 219 PHE H H N N 220 PHE H2 H N N 221 PHE HA H N N 222 PHE HB2 H N N 223 PHE HB3 H N N 224 PHE HD1 H N N 225 PHE HD2 H N N 226 PHE HE1 H N N 227 PHE HE2 H N N 228 PHE HZ H N N 229 PHE HXT H N N 230 PRO N N N N 231 PRO CA C N S 232 PRO C C N N 233 PRO O O N N 234 PRO CB C N N 235 PRO CG C N N 236 PRO CD C N N 237 PRO OXT O N N 238 PRO H H N N 239 PRO HA H N N 240 PRO HB2 H N N 241 PRO HB3 H N N 242 PRO HG2 H N N 243 PRO HG3 H N N 244 PRO HD2 H N N 245 PRO HD3 H N N 246 PRO HXT H N N 247 SER N N N N 248 SER CA C N S 249 SER C C N N 250 SER O O N N 251 SER CB C N N 252 SER OG O N N 253 SER OXT O N N 254 SER H H N N 255 SER H2 H N N 256 SER HA H N N 257 SER HB2 H N N 258 SER HB3 H N N 259 SER HG H N N 260 SER HXT H N N 261 THR N N N N 262 THR CA C N S 263 THR C C N N 264 THR O O N N 265 THR CB C N R 266 THR OG1 O N N 267 THR CG2 C N N 268 THR OXT O N N 269 THR H H N N 270 THR H2 H N N 271 THR HA H N N 272 THR HB H N N 273 THR HG1 H N N 274 THR HG21 H N N 275 THR HG22 H N N 276 THR HG23 H N N 277 THR HXT H N N 278 TRP N N N N 279 TRP CA C N S 280 TRP C C N N 281 TRP O O N N 282 TRP CB C N N 283 TRP CG C Y N 284 TRP CD1 C Y N 285 TRP CD2 C Y N 286 TRP NE1 N Y N 287 TRP CE2 C Y N 288 TRP CE3 C Y N 289 TRP CZ2 C Y N 290 TRP CZ3 C Y N 291 TRP CH2 C Y N 292 TRP OXT O N N 293 TRP H H N N 294 TRP H2 H N N 295 TRP HA H N N 296 TRP HB2 H N N 297 TRP HB3 H N N 298 TRP HD1 H N N 299 TRP HE1 H N N 300 TRP HE3 H N N 301 TRP HZ2 H N N 302 TRP HZ3 H N N 303 TRP HH2 H N N 304 TRP HXT H N N 305 VAL N N N N 306 VAL CA C N S 307 VAL C C N N 308 VAL O O N N 309 VAL CB C N N 310 VAL CG1 C N N 311 VAL CG2 C N N 312 VAL OXT O N N 313 VAL H H N N 314 VAL H2 H N N 315 VAL HA H N N 316 VAL HB H N N 317 VAL HG11 H N N 318 VAL HG12 H N N 319 VAL HG13 H N N 320 VAL HG21 H N N 321 VAL HG22 H N N 322 VAL HG23 H N N 323 VAL HXT H N N 324 ZN ZN ZN N N 325 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 LEU N CA sing N N 134 LEU N H sing N N 135 LEU N H2 sing N N 136 LEU CA C sing N N 137 LEU CA CB sing N N 138 LEU CA HA sing N N 139 LEU C O doub N N 140 LEU C OXT sing N N 141 LEU CB CG sing N N 142 LEU CB HB2 sing N N 143 LEU CB HB3 sing N N 144 LEU CG CD1 sing N N 145 LEU CG CD2 sing N N 146 LEU CG HG sing N N 147 LEU CD1 HD11 sing N N 148 LEU CD1 HD12 sing N N 149 LEU CD1 HD13 sing N N 150 LEU CD2 HD21 sing N N 151 LEU CD2 HD22 sing N N 152 LEU CD2 HD23 sing N N 153 LEU OXT HXT sing N N 154 LYS N CA sing N N 155 LYS N H sing N N 156 LYS N H2 sing N N 157 LYS CA C sing N N 158 LYS CA CB sing N N 159 LYS CA HA sing N N 160 LYS C O doub N N 161 LYS C OXT sing N N 162 LYS CB CG sing N N 163 LYS CB HB2 sing N N 164 LYS CB HB3 sing N N 165 LYS CG CD sing N N 166 LYS CG HG2 sing N N 167 LYS CG HG3 sing N N 168 LYS CD CE sing N N 169 LYS CD HD2 sing N N 170 LYS CD HD3 sing N N 171 LYS CE NZ sing N N 172 LYS CE HE2 sing N N 173 LYS CE HE3 sing N N 174 LYS NZ HZ1 sing N N 175 LYS NZ HZ2 sing N N 176 LYS NZ HZ3 sing N N 177 LYS OXT HXT sing N N 178 MET N CA sing N N 179 MET N H sing N N 180 MET N H2 sing N N 181 MET CA C sing N N 182 MET CA CB sing N N 183 MET CA HA sing N N 184 MET C O doub N N 185 MET C OXT sing N N 186 MET CB CG sing N N 187 MET CB HB2 sing N N 188 MET CB HB3 sing N N 189 MET CG SD sing N N 190 MET CG HG2 sing N N 191 MET CG HG3 sing N N 192 MET SD CE sing N N 193 MET CE HE1 sing N N 194 MET CE HE2 sing N N 195 MET CE HE3 sing N N 196 MET OXT HXT sing N N 197 PHE N CA sing N N 198 PHE N H sing N N 199 PHE N H2 sing N N 200 PHE CA C sing N N 201 PHE CA CB sing N N 202 PHE CA HA sing N N 203 PHE C O doub N N 204 PHE C OXT sing N N 205 PHE CB CG sing N N 206 PHE CB HB2 sing N N 207 PHE CB HB3 sing N N 208 PHE CG CD1 doub Y N 209 PHE CG CD2 sing Y N 210 PHE CD1 CE1 sing Y N 211 PHE CD1 HD1 sing N N 212 PHE CD2 CE2 doub Y N 213 PHE CD2 HD2 sing N N 214 PHE CE1 CZ doub Y N 215 PHE CE1 HE1 sing N N 216 PHE CE2 CZ sing Y N 217 PHE CE2 HE2 sing N N 218 PHE CZ HZ sing N N 219 PHE OXT HXT sing N N 220 PRO N CA sing N N 221 PRO N CD sing N N 222 PRO N H sing N N 223 PRO CA C sing N N 224 PRO CA CB sing N N 225 PRO CA HA sing N N 226 PRO C O doub N N 227 PRO C OXT sing N N 228 PRO CB CG sing N N 229 PRO CB HB2 sing N N 230 PRO CB HB3 sing N N 231 PRO CG CD sing N N 232 PRO CG HG2 sing N N 233 PRO CG HG3 sing N N 234 PRO CD HD2 sing N N 235 PRO CD HD3 sing N N 236 PRO OXT HXT sing N N 237 SER N CA sing N N 238 SER N H sing N N 239 SER N H2 sing N N 240 SER CA C sing N N 241 SER CA CB sing N N 242 SER CA HA sing N N 243 SER C O doub N N 244 SER C OXT sing N N 245 SER CB OG sing N N 246 SER CB HB2 sing N N 247 SER CB HB3 sing N N 248 SER OG HG sing N N 249 SER OXT HXT sing N N 250 THR N CA sing N N 251 THR N H sing N N 252 THR N H2 sing N N 253 THR CA C sing N N 254 THR CA CB sing N N 255 THR CA HA sing N N 256 THR C O doub N N 257 THR C OXT sing N N 258 THR CB OG1 sing N N 259 THR CB CG2 sing N N 260 THR CB HB sing N N 261 THR OG1 HG1 sing N N 262 THR CG2 HG21 sing N N 263 THR CG2 HG22 sing N N 264 THR CG2 HG23 sing N N 265 THR OXT HXT sing N N 266 TRP N CA sing N N 267 TRP N H sing N N 268 TRP N H2 sing N N 269 TRP CA C sing N N 270 TRP CA CB sing N N 271 TRP CA HA sing N N 272 TRP C O doub N N 273 TRP C OXT sing N N 274 TRP CB CG sing N N 275 TRP CB HB2 sing N N 276 TRP CB HB3 sing N N 277 TRP CG CD1 doub Y N 278 TRP CG CD2 sing Y N 279 TRP CD1 NE1 sing Y N 280 TRP CD1 HD1 sing N N 281 TRP CD2 CE2 doub Y N 282 TRP CD2 CE3 sing Y N 283 TRP NE1 CE2 sing Y N 284 TRP NE1 HE1 sing N N 285 TRP CE2 CZ2 sing Y N 286 TRP CE3 CZ3 doub Y N 287 TRP CE3 HE3 sing N N 288 TRP CZ2 CH2 doub Y N 289 TRP CZ2 HZ2 sing N N 290 TRP CZ3 CH2 sing Y N 291 TRP CZ3 HZ3 sing N N 292 TRP CH2 HH2 sing N N 293 TRP OXT HXT sing N N 294 VAL N CA sing N N 295 VAL N H sing N N 296 VAL N H2 sing N N 297 VAL CA C sing N N 298 VAL CA CB sing N N 299 VAL CA HA sing N N 300 VAL C O doub N N 301 VAL C OXT sing N N 302 VAL CB CG1 sing N N 303 VAL CB CG2 sing N N 304 VAL CB HB sing N N 305 VAL CG1 HG11 sing N N 306 VAL CG1 HG12 sing N N 307 VAL CG1 HG13 sing N N 308 VAL CG2 HG21 sing N N 309 VAL CG2 HG22 sing N N 310 VAL CG2 HG23 sing N N 311 VAL OXT HXT sing N N 312 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Swedish Research Council' Sweden ? 1 Cancerfonden Sweden ? 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 INOVA ? Varian 600 Backbone 2 'AVANCE III' ? Bruker 800 Sidechain # _atom_sites.entry_id 5JPX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_