data_5JUR # _entry.id 5JUR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JUR pdb_00005jur 10.2210/pdb5jur/pdb WWPDB D_1000221276 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5JUN _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JUR _pdbx_database_status.recvd_initial_deposition_date 2016-05-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Jacobs, M.D.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Med Chem Lett' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 256 _citation.page_last 260 _citation.title 'Discovery of Novel, Orally Bioavailable beta-Amino Acid Azaindole Inhibitors of Influenza PB2.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.6b00486 _citation.pdbx_database_id_PubMed 28197322 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Farmer, L.J.' 1 ? primary 'Clark, M.P.' 2 ? primary 'Boyd, M.J.' 3 ? primary 'Perola, E.' 4 ? primary 'Jones, S.M.' 5 ? primary 'Tsai, A.' 6 ? primary 'Jacobs, M.D.' 7 ? primary 'Bandarage, U.K.' 8 ? primary 'Ledeboer, M.W.' 9 ? primary 'Wang, T.' 10 ? primary 'Deng, H.' 11 ? primary 'Ledford, B.' 12 ? primary 'Gu, W.' 13 ? primary 'Duffy, J.P.' 14 ? primary 'Bethiel, R.S.' 15 ? primary 'Shannon, D.' 16 ? primary 'Byrn, R.A.' 17 ? primary 'Leeman, J.R.' 18 ? primary 'Rijnbrand, R.' 19 ? primary 'Bennett, H.B.' 20 ? primary ;O'Brien, C. ; 21 ? primary 'Memmott, C.' 22 ? primary 'Nti-Addae, K.' 23 ? primary 'Bennani, Y.L.' 24 ? primary 'Charifson, P.S.' 25 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5JUR _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.180 _cell.length_a_esd ? _cell.length_b 81.180 _cell.length_b_esd ? _cell.length_c 54.430 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JUR _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase basic protein 2' 19174.324 1 ? R89K 'UNP residues 318-483' ? 2 non-polymer syn '(3~{R})-3-[[5-fluoranyl-2-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]-4,4-dimethyl-pentanoic acid' 375.373 1 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMRISSSFSFGGFTFKRTSGSSIKREEEVLTGNLQTLKIRVHEGYEEFTMVGKRATAILRKATRRLVQLIVSGKDEQSI AEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMVGVLPDMTPSTEMS MRGIRVSKM ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMRISSSFSFGGFTFKRTSGSSIKREEEVLTGNLQTLKIRVHEGYEEFTMVGKRATAILRKATRRLVQLIVSGKDEQSI AEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMVGVLPDMTPSTEMS MRGIRVSKM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ARG n 1 5 ILE n 1 6 SER n 1 7 SER n 1 8 SER n 1 9 PHE n 1 10 SER n 1 11 PHE n 1 12 GLY n 1 13 GLY n 1 14 PHE n 1 15 THR n 1 16 PHE n 1 17 LYS n 1 18 ARG n 1 19 THR n 1 20 SER n 1 21 GLY n 1 22 SER n 1 23 SER n 1 24 ILE n 1 25 LYS n 1 26 ARG n 1 27 GLU n 1 28 GLU n 1 29 GLU n 1 30 VAL n 1 31 LEU n 1 32 THR n 1 33 GLY n 1 34 ASN n 1 35 LEU n 1 36 GLN n 1 37 THR n 1 38 LEU n 1 39 LYS n 1 40 ILE n 1 41 ARG n 1 42 VAL n 1 43 HIS n 1 44 GLU n 1 45 GLY n 1 46 TYR n 1 47 GLU n 1 48 GLU n 1 49 PHE n 1 50 THR n 1 51 MET n 1 52 VAL n 1 53 GLY n 1 54 LYS n 1 55 ARG n 1 56 ALA n 1 57 THR n 1 58 ALA n 1 59 ILE n 1 60 LEU n 1 61 ARG n 1 62 LYS n 1 63 ALA n 1 64 THR n 1 65 ARG n 1 66 ARG n 1 67 LEU n 1 68 VAL n 1 69 GLN n 1 70 LEU n 1 71 ILE n 1 72 VAL n 1 73 SER n 1 74 GLY n 1 75 LYS n 1 76 ASP n 1 77 GLU n 1 78 GLN n 1 79 SER n 1 80 ILE n 1 81 ALA n 1 82 GLU n 1 83 ALA n 1 84 ILE n 1 85 ILE n 1 86 VAL n 1 87 ALA n 1 88 MET n 1 89 VAL n 1 90 PHE n 1 91 SER n 1 92 GLN n 1 93 GLU n 1 94 ASP n 1 95 CYS n 1 96 MET n 1 97 ILE n 1 98 LYS n 1 99 ALA n 1 100 VAL n 1 101 ARG n 1 102 GLY n 1 103 ASP n 1 104 LEU n 1 105 ASN n 1 106 PHE n 1 107 VAL n 1 108 ASN n 1 109 ARG n 1 110 ALA n 1 111 ASN n 1 112 GLN n 1 113 ARG n 1 114 LEU n 1 115 ASN n 1 116 PRO n 1 117 MET n 1 118 HIS n 1 119 GLN n 1 120 LEU n 1 121 LEU n 1 122 ARG n 1 123 HIS n 1 124 PHE n 1 125 GLN n 1 126 LYS n 1 127 ASP n 1 128 ALA n 1 129 LYS n 1 130 VAL n 1 131 LEU n 1 132 PHE n 1 133 GLN n 1 134 ASN n 1 135 TRP n 1 136 GLY n 1 137 ILE n 1 138 GLU n 1 139 HIS n 1 140 ILE n 1 141 ASP n 1 142 ASN n 1 143 VAL n 1 144 MET n 1 145 GLY n 1 146 MET n 1 147 VAL n 1 148 GLY n 1 149 VAL n 1 150 LEU n 1 151 PRO n 1 152 ASP n 1 153 MET n 1 154 THR n 1 155 PRO n 1 156 SER n 1 157 THR n 1 158 GLU n 1 159 MET n 1 160 SER n 1 161 MET n 1 162 ARG n 1 163 GLY n 1 164 ILE n 1 165 ARG n 1 166 VAL n 1 167 SER n 1 168 LYS n 1 169 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 169 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PB2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'A/Beijing/39/1975 H3N2' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Influenza A virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 383596 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PB2_I75A0 _struct_ref.pdbx_db_accession Q30NP1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RISSSFSFGGFTFKRTSGSSIKREEEVLTGNLQTLKIRVHEGYEEFTMVGKRATAILRKATRRLVQLIVSGRDEQSIAEA IIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMVGVLPDMTPSTEMSMRG IRVSKM ; _struct_ref.pdbx_align_begin 318 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JUR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q30NP1 _struct_ref_seq.db_align_beg 318 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 483 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5JUR GLY A 1 ? UNP Q30NP1 ? ? 'expression tag' 15 1 1 5JUR HIS A 2 ? UNP Q30NP1 ? ? 'expression tag' 16 2 1 5JUR MET A 3 ? UNP Q30NP1 ? ? 'expression tag' 17 3 1 5JUR LYS A 75 ? UNP Q30NP1 ARG 389 'engineered mutation' 89 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6NS non-polymer . '(3~{R})-3-[[5-fluoranyl-2-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]-4,4-dimethyl-pentanoic acid' ? 'C18 H19 F2 N5 O2' 375.373 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JUR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.000 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1 uL protein solution (2.8 mg/mL protein, 50 mM Tris, pH 8, 200 mM sodium chloride, 2 mM dithiothreitol, 1 mM anthraquinone-2,6-disulfonic acid disodium salt, 7.5 mM GTP) + 0.4 uL well solution (1.5 M sodium formate, 100 mM sodium citrate, pH 4.7, 10 mM dithiothreitol) suspended over 1 mL of well solution, crystals transferred to a soaking solution (3.25 M sodium formate, 100 mM sodium citrate, pH 4.7) containing 1 mM inhibitor, incubated approximately 15 hours at room temperature, and then transferred to a cryo-preservative solution (soaking solution with 25% v/v glycerol) prior to freezing in liquid nitrogen ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-07-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979460 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979460 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 78.250 _reflns.entry_id 5JUR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.801 _reflns.d_resolution_low 32.551 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5006 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.900 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.067 _reflns.pdbx_netI_over_av_sigmaI 10.590 _reflns.pdbx_netI_over_sigmaI 18.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.802 2.950 ? 1.300 ? ? ? ? ? 100.000 ? ? ? ? 0.607 ? ? ? ? ? ? ? ? 4.600 ? ? ? ? ? ? ? 1 1 ? ? 2.950 3.130 ? 2.100 ? ? ? ? ? 100.000 ? ? ? ? 0.363 ? ? ? ? ? ? ? ? 5.000 ? ? ? ? ? ? ? 2 1 ? ? 3.130 3.350 ? 3.500 ? ? ? ? ? 100.000 ? ? ? ? 0.216 ? ? ? ? ? ? ? ? 5.000 ? ? ? ? ? ? ? 3 1 ? ? 3.350 3.620 ? 6.700 ? ? ? ? ? 92.200 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 4.900 ? ? ? ? ? ? ? 4 1 ? ? 3.620 3.960 ? 10.600 ? ? ? ? ? 86.100 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 4.800 ? ? ? ? ? ? ? 5 1 ? ? 3.960 4.430 ? 16.500 ? ? ? ? ? 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 5.000 ? ? ? ? ? ? ? 6 1 ? ? 4.430 5.110 ? 21.600 ? ? ? ? ? 100.000 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 5.000 ? ? ? ? ? ? ? 7 1 ? ? 5.110 6.260 ? 21.000 ? ? ? ? ? 100.000 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 4.900 ? ? ? ? ? ? ? 8 1 ? ? 6.260 8.860 ? 26.500 ? ? ? ? ? 99.700 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 4.900 ? ? ? ? ? ? ? 9 1 ? ? 8.860 32.551 ? 25.500 ? ? ? ? ? 97.900 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 4.600 ? ? ? ? ? ? ? 10 1 ? ? # _refine.aniso_B[1][1] -5.4226 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -5.4226 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 10.8452 _refine.B_iso_max 166.920 _refine.B_iso_mean 70.8200 _refine.B_iso_min 36.460 _refine.correlation_coeff_Fo_to_Fc 0.9340 _refine.correlation_coeff_Fo_to_Fc_free 0.9190 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5JUR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.9300 _refine.ls_d_res_low 29.5300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4360 _refine.ls_number_reflns_R_free 206 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.2000 _refine.ls_percent_reflns_R_free 4.7200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1810 _refine.ls_R_factor_R_free 0.1980 _refine.ls_R_factor_R_free_error 0.0000 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1810 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 4NCE _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.2990 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5JUR _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.380 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.9300 _refine_hist.d_res_low 29.5300 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 1203 _refine_hist.pdbx_number_residues_total 150 _refine_hist.pdbx_B_iso_mean_ligand 55.05 _refine_hist.pdbx_B_iso_mean_solvent 54.52 _refine_hist.pdbx_number_atoms_protein 1170 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 447 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 26 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 201 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1219 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 161 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1405 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 1219 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.190 ? 1638 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 3.890 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.020 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.9300 _refine_ls_shell.d_res_low 3.2800 _refine_ls_shell.number_reflns_all 1263 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_R_work 1214 _refine_ls_shell.percent_reflns_obs 99.8400 _refine_ls_shell.percent_reflns_R_free 3.8800 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2250 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2010 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5JUR _struct.title 'PB2 bound to an azaindole inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JUR _struct_keywords.text 'flu, polymerase, nucleotide binding, inhibitor, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 76 ? SER A 91 ? ASP A 90 SER A 105 1 ? 16 HELX_P HELX_P2 AA2 GLU A 93 ? LYS A 98 ? GLU A 107 LYS A 112 1 ? 6 HELX_P HELX_P3 AA3 PRO A 116 ? ASP A 127 ? PRO A 130 ASP A 141 1 ? 12 HELX_P HELX_P4 AA4 ALA A 128 ? TRP A 135 ? ALA A 142 TRP A 149 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 8 ? PHE A 11 ? SER A 22 PHE A 25 AA1 2 PHE A 14 ? GLY A 21 ? PHE A 28 GLY A 35 AA1 3 GLU A 47 ? VAL A 52 ? GLU A 61 VAL A 66 AA1 4 ALA A 56 ? ALA A 63 ? ALA A 70 ALA A 77 AA1 5 ARG A 66 ? GLY A 74 ? ARG A 80 GLY A 88 AA1 6 ILE A 164 ? SER A 167 ? ILE A 178 SER A 181 AA1 7 MET A 146 ? VAL A 149 ? MET A 160 VAL A 163 AA1 8 PRO A 155 ? SER A 156 ? PRO A 169 SER A 170 AA2 1 ILE A 24 ? LEU A 31 ? ILE A 38 LEU A 45 AA2 2 THR A 37 ? GLU A 44 ? THR A 51 GLU A 58 AA3 1 ILE A 137 ? HIS A 139 ? ILE A 151 HIS A 153 AA3 2 MET A 159 ? MET A 161 ? MET A 173 MET A 175 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 9 ? N PHE A 23 O PHE A 16 ? O PHE A 30 AA1 2 3 N THR A 19 ? N THR A 33 O GLU A 48 ? O GLU A 62 AA1 3 4 N PHE A 49 ? N PHE A 63 O LEU A 60 ? O LEU A 74 AA1 4 5 N ALA A 63 ? N ALA A 77 O ARG A 66 ? O ARG A 80 AA1 5 6 N VAL A 72 ? N VAL A 86 O SER A 167 ? O SER A 181 AA1 6 7 O VAL A 166 ? O VAL A 180 N VAL A 147 ? N VAL A 161 AA1 7 8 N GLY A 148 ? N GLY A 162 O SER A 156 ? O SER A 170 AA2 1 2 N ILE A 24 ? N ILE A 38 O GLU A 44 ? O GLU A 58 AA3 1 2 N GLU A 138 ? N GLU A 152 O SER A 160 ? O SER A 174 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 6NS _struct_site.pdbx_auth_seq_id 4000 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue 6NS A 4000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 PHE A 9 ? PHE A 23 . ? 1_555 ? 2 AC1 10 PHE A 11 ? PHE A 25 . ? 1_555 ? 3 AC1 10 HIS A 43 ? HIS A 57 . ? 1_555 ? 4 AC1 10 GLU A 47 ? GLU A 61 . ? 1_555 ? 5 AC1 10 PHE A 49 ? PHE A 63 . ? 1_555 ? 6 AC1 10 LYS A 62 ? LYS A 76 . ? 1_555 ? 7 AC1 10 PHE A 90 ? PHE A 104 . ? 1_555 ? 8 AC1 10 GLN A 92 ? GLN A 106 . ? 1_555 ? 9 AC1 10 MET A 117 ? MET A 131 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 4102 . ? 1_555 ? # _atom_sites.entry_id 5JUR _atom_sites.fract_transf_matrix[1][1] 0.012318 _atom_sites.fract_transf_matrix[1][2] 0.007112 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014224 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018372 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 15 ? ? ? A . n A 1 2 HIS 2 16 ? ? ? A . n A 1 3 MET 3 17 ? ? ? A . n A 1 4 ARG 4 18 ? ? ? A . n A 1 5 ILE 5 19 ? ? ? A . n A 1 6 SER 6 20 ? ? ? A . n A 1 7 SER 7 21 21 SER SER A . n A 1 8 SER 8 22 22 SER SER A . n A 1 9 PHE 9 23 23 PHE PHE A . n A 1 10 SER 10 24 24 SER SER A . n A 1 11 PHE 11 25 25 PHE PHE A . n A 1 12 GLY 12 26 26 GLY GLY A . n A 1 13 GLY 13 27 27 GLY GLY A . n A 1 14 PHE 14 28 28 PHE PHE A . n A 1 15 THR 15 29 29 THR THR A . n A 1 16 PHE 16 30 30 PHE PHE A . n A 1 17 LYS 17 31 31 LYS LYS A . n A 1 18 ARG 18 32 32 ARG ARG A . n A 1 19 THR 19 33 33 THR THR A . n A 1 20 SER 20 34 34 SER SER A . n A 1 21 GLY 21 35 35 GLY GLY A . n A 1 22 SER 22 36 36 SER SER A . n A 1 23 SER 23 37 37 SER SER A . n A 1 24 ILE 24 38 38 ILE ILE A . n A 1 25 LYS 25 39 39 LYS LYS A . n A 1 26 ARG 26 40 40 ARG ARG A . n A 1 27 GLU 27 41 41 GLU GLU A . n A 1 28 GLU 28 42 42 GLU GLU A . n A 1 29 GLU 29 43 43 GLU GLU A . n A 1 30 VAL 30 44 44 VAL VAL A . n A 1 31 LEU 31 45 45 LEU LEU A . n A 1 32 THR 32 46 46 THR THR A . n A 1 33 GLY 33 47 47 GLY GLY A . n A 1 34 ASN 34 48 48 ASN ASN A . n A 1 35 LEU 35 49 49 LEU LEU A . n A 1 36 GLN 36 50 50 GLN GLN A . n A 1 37 THR 37 51 51 THR THR A . n A 1 38 LEU 38 52 52 LEU LEU A . n A 1 39 LYS 39 53 53 LYS LYS A . n A 1 40 ILE 40 54 54 ILE ILE A . n A 1 41 ARG 41 55 55 ARG ARG A . n A 1 42 VAL 42 56 56 VAL VAL A . n A 1 43 HIS 43 57 57 HIS HIS A . n A 1 44 GLU 44 58 58 GLU GLU A . n A 1 45 GLY 45 59 59 GLY GLY A . n A 1 46 TYR 46 60 60 TYR TYR A . n A 1 47 GLU 47 61 61 GLU GLU A . n A 1 48 GLU 48 62 62 GLU GLU A . n A 1 49 PHE 49 63 63 PHE PHE A . n A 1 50 THR 50 64 64 THR THR A . n A 1 51 MET 51 65 65 MET MET A . n A 1 52 VAL 52 66 66 VAL VAL A . n A 1 53 GLY 53 67 67 GLY GLY A . n A 1 54 LYS 54 68 68 LYS LYS A . n A 1 55 ARG 55 69 69 ARG ARG A . n A 1 56 ALA 56 70 70 ALA ALA A . n A 1 57 THR 57 71 71 THR THR A . n A 1 58 ALA 58 72 72 ALA ALA A . n A 1 59 ILE 59 73 73 ILE ILE A . n A 1 60 LEU 60 74 74 LEU LEU A . n A 1 61 ARG 61 75 75 ARG ARG A . n A 1 62 LYS 62 76 76 LYS LYS A . n A 1 63 ALA 63 77 77 ALA ALA A . n A 1 64 THR 64 78 78 THR THR A . n A 1 65 ARG 65 79 79 ARG ARG A . n A 1 66 ARG 66 80 80 ARG ARG A . n A 1 67 LEU 67 81 81 LEU LEU A . n A 1 68 VAL 68 82 82 VAL VAL A . n A 1 69 GLN 69 83 83 GLN GLN A . n A 1 70 LEU 70 84 84 LEU LEU A . n A 1 71 ILE 71 85 85 ILE ILE A . n A 1 72 VAL 72 86 86 VAL VAL A . n A 1 73 SER 73 87 87 SER SER A . n A 1 74 GLY 74 88 88 GLY GLY A . n A 1 75 LYS 75 89 89 LYS LYS A . n A 1 76 ASP 76 90 90 ASP ASP A . n A 1 77 GLU 77 91 91 GLU GLU A . n A 1 78 GLN 78 92 92 GLN GLN A . n A 1 79 SER 79 93 93 SER SER A . n A 1 80 ILE 80 94 94 ILE ILE A . n A 1 81 ALA 81 95 95 ALA ALA A . n A 1 82 GLU 82 96 96 GLU GLU A . n A 1 83 ALA 83 97 97 ALA ALA A . n A 1 84 ILE 84 98 98 ILE ILE A . n A 1 85 ILE 85 99 99 ILE ILE A . n A 1 86 VAL 86 100 100 VAL VAL A . n A 1 87 ALA 87 101 101 ALA ALA A . n A 1 88 MET 88 102 102 MET MET A . n A 1 89 VAL 89 103 103 VAL VAL A . n A 1 90 PHE 90 104 104 PHE PHE A . n A 1 91 SER 91 105 105 SER SER A . n A 1 92 GLN 92 106 106 GLN GLN A . n A 1 93 GLU 93 107 107 GLU GLU A . n A 1 94 ASP 94 108 108 ASP ASP A . n A 1 95 CYS 95 109 109 CYS CYS A . n A 1 96 MET 96 110 110 MET MET A . n A 1 97 ILE 97 111 111 ILE ILE A . n A 1 98 LYS 98 112 112 LYS LYS A . n A 1 99 ALA 99 113 113 ALA ALA A . n A 1 100 VAL 100 114 114 VAL VAL A . n A 1 101 ARG 101 115 115 ARG ARG A . n A 1 102 GLY 102 116 ? ? ? A . n A 1 103 ASP 103 117 ? ? ? A . n A 1 104 LEU 104 118 ? ? ? A . n A 1 105 ASN 105 119 ? ? ? A . n A 1 106 PHE 106 120 ? ? ? A . n A 1 107 VAL 107 121 ? ? ? A . n A 1 108 ASN 108 122 ? ? ? A . n A 1 109 ARG 109 123 ? ? ? A . n A 1 110 ALA 110 124 ? ? ? A . n A 1 111 ASN 111 125 ? ? ? A . n A 1 112 GLN 112 126 ? ? ? A . n A 1 113 ARG 113 127 ? ? ? A . n A 1 114 LEU 114 128 ? ? ? A . n A 1 115 ASN 115 129 129 ASN ASN A . n A 1 116 PRO 116 130 130 PRO PRO A . n A 1 117 MET 117 131 131 MET MET A . n A 1 118 HIS 118 132 132 HIS HIS A . n A 1 119 GLN 119 133 133 GLN GLN A . n A 1 120 LEU 120 134 134 LEU LEU A . n A 1 121 LEU 121 135 135 LEU LEU A . n A 1 122 ARG 122 136 136 ARG ARG A . n A 1 123 HIS 123 137 137 HIS HIS A . n A 1 124 PHE 124 138 138 PHE PHE A . n A 1 125 GLN 125 139 139 GLN GLN A . n A 1 126 LYS 126 140 140 LYS LYS A . n A 1 127 ASP 127 141 141 ASP ASP A . n A 1 128 ALA 128 142 142 ALA ALA A . n A 1 129 LYS 129 143 143 LYS LYS A . n A 1 130 VAL 130 144 144 VAL VAL A . n A 1 131 LEU 131 145 145 LEU LEU A . n A 1 132 PHE 132 146 146 PHE PHE A . n A 1 133 GLN 133 147 147 GLN GLN A . n A 1 134 ASN 134 148 148 ASN ASN A . n A 1 135 TRP 135 149 149 TRP TRP A . n A 1 136 GLY 136 150 150 GLY GLY A . n A 1 137 ILE 137 151 151 ILE ILE A . n A 1 138 GLU 138 152 152 GLU GLU A . n A 1 139 HIS 139 153 153 HIS HIS A . n A 1 140 ILE 140 154 154 ILE ILE A . n A 1 141 ASP 141 155 155 ASP ASP A . n A 1 142 ASN 142 156 156 ASN ASN A . n A 1 143 VAL 143 157 157 VAL VAL A . n A 1 144 MET 144 158 158 MET MET A . n A 1 145 GLY 145 159 159 GLY GLY A . n A 1 146 MET 146 160 160 MET MET A . n A 1 147 VAL 147 161 161 VAL VAL A . n A 1 148 GLY 148 162 162 GLY GLY A . n A 1 149 VAL 149 163 163 VAL VAL A . n A 1 150 LEU 150 164 164 LEU LEU A . n A 1 151 PRO 151 165 165 PRO PRO A . n A 1 152 ASP 152 166 166 ASP ASP A . n A 1 153 MET 153 167 167 MET MET A . n A 1 154 THR 154 168 168 THR THR A . n A 1 155 PRO 155 169 169 PRO PRO A . n A 1 156 SER 156 170 170 SER SER A . n A 1 157 THR 157 171 171 THR THR A . n A 1 158 GLU 158 172 172 GLU GLU A . n A 1 159 MET 159 173 173 MET MET A . n A 1 160 SER 160 174 174 SER SER A . n A 1 161 MET 161 175 175 MET MET A . n A 1 162 ARG 162 176 176 ARG ARG A . n A 1 163 GLY 163 177 177 GLY GLY A . n A 1 164 ILE 164 178 178 ILE ILE A . n A 1 165 ARG 165 179 179 ARG ARG A . n A 1 166 VAL 166 180 180 VAL VAL A . n A 1 167 SER 167 181 181 SER SER A . n A 1 168 LYS 168 182 182 LYS LYS A . n A 1 169 MET 169 183 183 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 6NS 1 4000 4000 6NS 999 A . C 3 HOH 1 4101 1 HOH HOH A . C 3 HOH 2 4102 2 HOH HOH A . C 3 HOH 3 4103 4 HOH HOH A . C 3 HOH 4 4104 3 HOH HOH A . C 3 HOH 5 4105 6 HOH HOH A . C 3 HOH 6 4106 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-01 2 'Structure model' 1 1 2017-11-22 3 'Structure model' 1 2 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' diffrn_radiation_wavelength 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.classification' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -37.9859 _pdbx_refine_tls.origin_y 0.9439 _pdbx_refine_tls.origin_z 2.0811 _pdbx_refine_tls.T[1][1] 0.0882 _pdbx_refine_tls.T[2][2] -0.1751 _pdbx_refine_tls.T[3][3] -0.2412 _pdbx_refine_tls.T[1][2] 0.0648 _pdbx_refine_tls.T[1][3] -0.0005 _pdbx_refine_tls.T[2][3] -0.0041 _pdbx_refine_tls.L[1][1] 2.3311 _pdbx_refine_tls.L[2][2] 8.5954 _pdbx_refine_tls.L[3][3] 4.0417 _pdbx_refine_tls.L[1][2] 0.5706 _pdbx_refine_tls.L[1][3] 1.2743 _pdbx_refine_tls.L[2][3] 2.8975 _pdbx_refine_tls.S[1][1] -0.1693 _pdbx_refine_tls.S[2][2] 0.1526 _pdbx_refine_tls.S[3][3] 0.0167 _pdbx_refine_tls.S[1][2] 0.2437 _pdbx_refine_tls.S[1][3] 0.0554 _pdbx_refine_tls.S[2][3] 0.0731 _pdbx_refine_tls.S[2][1] -0.9822 _pdbx_refine_tls.S[3][1] -0.6556 _pdbx_refine_tls.S[3][2] 0.2099 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 21 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 183 _pdbx_refine_tls_group.selection_details '{ A|* }' _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.15 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 VAL _pdbx_validate_rmsd_angle.auth_seq_id_1 157 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 VAL _pdbx_validate_rmsd_angle.auth_seq_id_2 157 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 VAL _pdbx_validate_rmsd_angle.auth_seq_id_3 157 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 93.58 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -17.42 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 176 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -34.30 _pdbx_validate_torsion.psi 119.45 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 31 ? CG ? A LYS 17 CG 2 1 Y 1 A LYS 31 ? CD ? A LYS 17 CD 3 1 Y 1 A LYS 31 ? CE ? A LYS 17 CE 4 1 Y 1 A LYS 31 ? NZ ? A LYS 17 NZ 5 1 Y 1 A GLU 41 ? CG ? A GLU 27 CG 6 1 Y 1 A GLU 41 ? CD ? A GLU 27 CD 7 1 Y 1 A GLU 41 ? OE1 ? A GLU 27 OE1 8 1 Y 1 A GLU 41 ? OE2 ? A GLU 27 OE2 9 1 Y 1 A ARG 136 ? CG ? A ARG 122 CG 10 1 Y 1 A ARG 136 ? CD ? A ARG 122 CD 11 1 Y 1 A ARG 136 ? NE ? A ARG 122 NE 12 1 Y 1 A ARG 136 ? CZ ? A ARG 122 CZ 13 1 Y 1 A ARG 136 ? NH1 ? A ARG 122 NH1 14 1 Y 1 A ARG 136 ? NH2 ? A ARG 122 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 15 ? A GLY 1 2 1 Y 1 A HIS 16 ? A HIS 2 3 1 Y 1 A MET 17 ? A MET 3 4 1 Y 1 A ARG 18 ? A ARG 4 5 1 Y 1 A ILE 19 ? A ILE 5 6 1 Y 1 A SER 20 ? A SER 6 7 1 Y 1 A GLY 116 ? A GLY 102 8 1 Y 1 A ASP 117 ? A ASP 103 9 1 Y 1 A LEU 118 ? A LEU 104 10 1 Y 1 A ASN 119 ? A ASN 105 11 1 Y 1 A PHE 120 ? A PHE 106 12 1 Y 1 A VAL 121 ? A VAL 107 13 1 Y 1 A ASN 122 ? A ASN 108 14 1 Y 1 A ARG 123 ? A ARG 109 15 1 Y 1 A ALA 124 ? A ALA 110 16 1 Y 1 A ASN 125 ? A ASN 111 17 1 Y 1 A GLN 126 ? A GLN 112 18 1 Y 1 A ARG 127 ? A ARG 113 19 1 Y 1 A LEU 128 ? A LEU 114 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6NS F2 F N N 1 6NS C9 C Y N 2 6NS C10 C Y N 3 6NS N2 N Y N 4 6NS C11 C Y N 5 6NS N3 N Y N 6 6NS C8 C Y N 7 6NS N1 N N N 8 6NS C5 C N R 9 6NS C6 C N N 10 6NS C7 C N N 11 6NS O2 O N N 12 6NS O1 O N N 13 6NS C2 C N N 14 6NS C4 C N N 15 6NS C3 C N N 16 6NS C1 C N N 17 6NS C12 C Y N 18 6NS C15 C Y N 19 6NS C16 C Y N 20 6NS C17 C Y N 21 6NS F1 F N N 22 6NS C18 C Y N 23 6NS N5 N Y N 24 6NS C14 C Y N 25 6NS N4 N Y N 26 6NS C13 C Y N 27 6NS H1 H N N 28 6NS H2 H N N 29 6NS H3 H N N 30 6NS H4 H N N 31 6NS H5 H N N 32 6NS H6 H N N 33 6NS H7 H N N 34 6NS H8 H N N 35 6NS H9 H N N 36 6NS H10 H N N 37 6NS H11 H N N 38 6NS H12 H N N 39 6NS H13 H N N 40 6NS H14 H N N 41 6NS H15 H N N 42 6NS H16 H N N 43 6NS H17 H N N 44 6NS H18 H N N 45 6NS H19 H N N 46 ALA N N N N 47 ALA CA C N S 48 ALA C C N N 49 ALA O O N N 50 ALA CB C N N 51 ALA OXT O N N 52 ALA H H N N 53 ALA H2 H N N 54 ALA HA H N N 55 ALA HB1 H N N 56 ALA HB2 H N N 57 ALA HB3 H N N 58 ALA HXT H N N 59 ARG N N N N 60 ARG CA C N S 61 ARG C C N N 62 ARG O O N N 63 ARG CB C N N 64 ARG CG C N N 65 ARG CD C N N 66 ARG NE N N N 67 ARG CZ C N N 68 ARG NH1 N N N 69 ARG NH2 N N N 70 ARG OXT O N N 71 ARG H H N N 72 ARG H2 H N N 73 ARG HA H N N 74 ARG HB2 H N N 75 ARG HB3 H N N 76 ARG HG2 H N N 77 ARG HG3 H N N 78 ARG HD2 H N N 79 ARG HD3 H N N 80 ARG HE H N N 81 ARG HH11 H N N 82 ARG HH12 H N N 83 ARG HH21 H N N 84 ARG HH22 H N N 85 ARG HXT H N N 86 ASN N N N N 87 ASN CA C N S 88 ASN C C N N 89 ASN O O N N 90 ASN CB C N N 91 ASN CG C N N 92 ASN OD1 O N N 93 ASN ND2 N N N 94 ASN OXT O N N 95 ASN H H N N 96 ASN H2 H N N 97 ASN HA H N N 98 ASN HB2 H N N 99 ASN HB3 H N N 100 ASN HD21 H N N 101 ASN HD22 H N N 102 ASN HXT H N N 103 ASP N N N N 104 ASP CA C N S 105 ASP C C N N 106 ASP O O N N 107 ASP CB C N N 108 ASP CG C N N 109 ASP OD1 O N N 110 ASP OD2 O N N 111 ASP OXT O N N 112 ASP H H N N 113 ASP H2 H N N 114 ASP HA H N N 115 ASP HB2 H N N 116 ASP HB3 H N N 117 ASP HD2 H N N 118 ASP HXT H N N 119 CYS N N N N 120 CYS CA C N R 121 CYS C C N N 122 CYS O O N N 123 CYS CB C N N 124 CYS SG S N N 125 CYS OXT O N N 126 CYS H H N N 127 CYS H2 H N N 128 CYS HA H N N 129 CYS HB2 H N N 130 CYS HB3 H N N 131 CYS HG H N N 132 CYS HXT H N N 133 GLN N N N N 134 GLN CA C N S 135 GLN C C N N 136 GLN O O N N 137 GLN CB C N N 138 GLN CG C N N 139 GLN CD C N N 140 GLN OE1 O N N 141 GLN NE2 N N N 142 GLN OXT O N N 143 GLN H H N N 144 GLN H2 H N N 145 GLN HA H N N 146 GLN HB2 H N N 147 GLN HB3 H N N 148 GLN HG2 H N N 149 GLN HG3 H N N 150 GLN HE21 H N N 151 GLN HE22 H N N 152 GLN HXT H N N 153 GLU N N N N 154 GLU CA C N S 155 GLU C C N N 156 GLU O O N N 157 GLU CB C N N 158 GLU CG C N N 159 GLU CD C N N 160 GLU OE1 O N N 161 GLU OE2 O N N 162 GLU OXT O N N 163 GLU H H N N 164 GLU H2 H N N 165 GLU HA H N N 166 GLU HB2 H N N 167 GLU HB3 H N N 168 GLU HG2 H N N 169 GLU HG3 H N N 170 GLU HE2 H N N 171 GLU HXT H N N 172 GLY N N N N 173 GLY CA C N N 174 GLY C C N N 175 GLY O O N N 176 GLY OXT O N N 177 GLY H H N N 178 GLY H2 H N N 179 GLY HA2 H N N 180 GLY HA3 H N N 181 GLY HXT H N N 182 HIS N N N N 183 HIS CA C N S 184 HIS C C N N 185 HIS O O N N 186 HIS CB C N N 187 HIS CG C Y N 188 HIS ND1 N Y N 189 HIS CD2 C Y N 190 HIS CE1 C Y N 191 HIS NE2 N Y N 192 HIS OXT O N N 193 HIS H H N N 194 HIS H2 H N N 195 HIS HA H N N 196 HIS HB2 H N N 197 HIS HB3 H N N 198 HIS HD1 H N N 199 HIS HD2 H N N 200 HIS HE1 H N N 201 HIS HE2 H N N 202 HIS HXT H N N 203 HOH O O N N 204 HOH H1 H N N 205 HOH H2 H N N 206 ILE N N N N 207 ILE CA C N S 208 ILE C C N N 209 ILE O O N N 210 ILE CB C N S 211 ILE CG1 C N N 212 ILE CG2 C N N 213 ILE CD1 C N N 214 ILE OXT O N N 215 ILE H H N N 216 ILE H2 H N N 217 ILE HA H N N 218 ILE HB H N N 219 ILE HG12 H N N 220 ILE HG13 H N N 221 ILE HG21 H N N 222 ILE HG22 H N N 223 ILE HG23 H N N 224 ILE HD11 H N N 225 ILE HD12 H N N 226 ILE HD13 H N N 227 ILE HXT H N N 228 LEU N N N N 229 LEU CA C N S 230 LEU C C N N 231 LEU O O N N 232 LEU CB C N N 233 LEU CG C N N 234 LEU CD1 C N N 235 LEU CD2 C N N 236 LEU OXT O N N 237 LEU H H N N 238 LEU H2 H N N 239 LEU HA H N N 240 LEU HB2 H N N 241 LEU HB3 H N N 242 LEU HG H N N 243 LEU HD11 H N N 244 LEU HD12 H N N 245 LEU HD13 H N N 246 LEU HD21 H N N 247 LEU HD22 H N N 248 LEU HD23 H N N 249 LEU HXT H N N 250 LYS N N N N 251 LYS CA C N S 252 LYS C C N N 253 LYS O O N N 254 LYS CB C N N 255 LYS CG C N N 256 LYS CD C N N 257 LYS CE C N N 258 LYS NZ N N N 259 LYS OXT O N N 260 LYS H H N N 261 LYS H2 H N N 262 LYS HA H N N 263 LYS HB2 H N N 264 LYS HB3 H N N 265 LYS HG2 H N N 266 LYS HG3 H N N 267 LYS HD2 H N N 268 LYS HD3 H N N 269 LYS HE2 H N N 270 LYS HE3 H N N 271 LYS HZ1 H N N 272 LYS HZ2 H N N 273 LYS HZ3 H N N 274 LYS HXT H N N 275 MET N N N N 276 MET CA C N S 277 MET C C N N 278 MET O O N N 279 MET CB C N N 280 MET CG C N N 281 MET SD S N N 282 MET CE C N N 283 MET OXT O N N 284 MET H H N N 285 MET H2 H N N 286 MET HA H N N 287 MET HB2 H N N 288 MET HB3 H N N 289 MET HG2 H N N 290 MET HG3 H N N 291 MET HE1 H N N 292 MET HE2 H N N 293 MET HE3 H N N 294 MET HXT H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6NS N5 C14 doub Y N 1 6NS N5 C18 sing Y N 2 6NS N4 C14 sing Y N 3 6NS N4 C13 sing Y N 4 6NS C14 C15 sing Y N 5 6NS C18 C17 doub Y N 6 6NS C13 C12 doub Y N 7 6NS C15 C12 sing Y N 8 6NS C15 C16 doub Y N 9 6NS C17 C16 sing Y N 10 6NS C17 F1 sing N N 11 6NS C12 C11 sing N N 12 6NS N2 C11 doub Y N 13 6NS N2 C10 sing Y N 14 6NS C11 N3 sing Y N 15 6NS O1 C7 doub N N 16 6NS N3 C8 doub Y N 17 6NS C10 C9 doub Y N 18 6NS C7 O2 sing N N 19 6NS C7 C6 sing N N 20 6NS C8 C9 sing Y N 21 6NS C8 N1 sing N N 22 6NS C9 F2 sing N N 23 6NS C5 C6 sing N N 24 6NS C5 N1 sing N N 25 6NS C5 C2 sing N N 26 6NS C3 C2 sing N N 27 6NS C4 C2 sing N N 28 6NS C2 C1 sing N N 29 6NS C10 H1 sing N N 30 6NS N1 H2 sing N N 31 6NS C5 H3 sing N N 32 6NS C6 H4 sing N N 33 6NS C6 H5 sing N N 34 6NS O2 H6 sing N N 35 6NS C4 H7 sing N N 36 6NS C4 H8 sing N N 37 6NS C4 H9 sing N N 38 6NS C3 H10 sing N N 39 6NS C3 H11 sing N N 40 6NS C3 H12 sing N N 41 6NS C1 H13 sing N N 42 6NS C1 H14 sing N N 43 6NS C1 H15 sing N N 44 6NS C16 H16 sing N N 45 6NS C18 H17 sing N N 46 6NS N4 H18 sing N N 47 6NS C13 H19 sing N N 48 ALA N CA sing N N 49 ALA N H sing N N 50 ALA N H2 sing N N 51 ALA CA C sing N N 52 ALA CA CB sing N N 53 ALA CA HA sing N N 54 ALA C O doub N N 55 ALA C OXT sing N N 56 ALA CB HB1 sing N N 57 ALA CB HB2 sing N N 58 ALA CB HB3 sing N N 59 ALA OXT HXT sing N N 60 ARG N CA sing N N 61 ARG N H sing N N 62 ARG N H2 sing N N 63 ARG CA C sing N N 64 ARG CA CB sing N N 65 ARG CA HA sing N N 66 ARG C O doub N N 67 ARG C OXT sing N N 68 ARG CB CG sing N N 69 ARG CB HB2 sing N N 70 ARG CB HB3 sing N N 71 ARG CG CD sing N N 72 ARG CG HG2 sing N N 73 ARG CG HG3 sing N N 74 ARG CD NE sing N N 75 ARG CD HD2 sing N N 76 ARG CD HD3 sing N N 77 ARG NE CZ sing N N 78 ARG NE HE sing N N 79 ARG CZ NH1 sing N N 80 ARG CZ NH2 doub N N 81 ARG NH1 HH11 sing N N 82 ARG NH1 HH12 sing N N 83 ARG NH2 HH21 sing N N 84 ARG NH2 HH22 sing N N 85 ARG OXT HXT sing N N 86 ASN N CA sing N N 87 ASN N H sing N N 88 ASN N H2 sing N N 89 ASN CA C sing N N 90 ASN CA CB sing N N 91 ASN CA HA sing N N 92 ASN C O doub N N 93 ASN C OXT sing N N 94 ASN CB CG sing N N 95 ASN CB HB2 sing N N 96 ASN CB HB3 sing N N 97 ASN CG OD1 doub N N 98 ASN CG ND2 sing N N 99 ASN ND2 HD21 sing N N 100 ASN ND2 HD22 sing N N 101 ASN OXT HXT sing N N 102 ASP N CA sing N N 103 ASP N H sing N N 104 ASP N H2 sing N N 105 ASP CA C sing N N 106 ASP CA CB sing N N 107 ASP CA HA sing N N 108 ASP C O doub N N 109 ASP C OXT sing N N 110 ASP CB CG sing N N 111 ASP CB HB2 sing N N 112 ASP CB HB3 sing N N 113 ASP CG OD1 doub N N 114 ASP CG OD2 sing N N 115 ASP OD2 HD2 sing N N 116 ASP OXT HXT sing N N 117 CYS N CA sing N N 118 CYS N H sing N N 119 CYS N H2 sing N N 120 CYS CA C sing N N 121 CYS CA CB sing N N 122 CYS CA HA sing N N 123 CYS C O doub N N 124 CYS C OXT sing N N 125 CYS CB SG sing N N 126 CYS CB HB2 sing N N 127 CYS CB HB3 sing N N 128 CYS SG HG sing N N 129 CYS OXT HXT sing N N 130 GLN N CA sing N N 131 GLN N H sing N N 132 GLN N H2 sing N N 133 GLN CA C sing N N 134 GLN CA CB sing N N 135 GLN CA HA sing N N 136 GLN C O doub N N 137 GLN C OXT sing N N 138 GLN CB CG sing N N 139 GLN CB HB2 sing N N 140 GLN CB HB3 sing N N 141 GLN CG CD sing N N 142 GLN CG HG2 sing N N 143 GLN CG HG3 sing N N 144 GLN CD OE1 doub N N 145 GLN CD NE2 sing N N 146 GLN NE2 HE21 sing N N 147 GLN NE2 HE22 sing N N 148 GLN OXT HXT sing N N 149 GLU N CA sing N N 150 GLU N H sing N N 151 GLU N H2 sing N N 152 GLU CA C sing N N 153 GLU CA CB sing N N 154 GLU CA HA sing N N 155 GLU C O doub N N 156 GLU C OXT sing N N 157 GLU CB CG sing N N 158 GLU CB HB2 sing N N 159 GLU CB HB3 sing N N 160 GLU CG CD sing N N 161 GLU CG HG2 sing N N 162 GLU CG HG3 sing N N 163 GLU CD OE1 doub N N 164 GLU CD OE2 sing N N 165 GLU OE2 HE2 sing N N 166 GLU OXT HXT sing N N 167 GLY N CA sing N N 168 GLY N H sing N N 169 GLY N H2 sing N N 170 GLY CA C sing N N 171 GLY CA HA2 sing N N 172 GLY CA HA3 sing N N 173 GLY C O doub N N 174 GLY C OXT sing N N 175 GLY OXT HXT sing N N 176 HIS N CA sing N N 177 HIS N H sing N N 178 HIS N H2 sing N N 179 HIS CA C sing N N 180 HIS CA CB sing N N 181 HIS CA HA sing N N 182 HIS C O doub N N 183 HIS C OXT sing N N 184 HIS CB CG sing N N 185 HIS CB HB2 sing N N 186 HIS CB HB3 sing N N 187 HIS CG ND1 sing Y N 188 HIS CG CD2 doub Y N 189 HIS ND1 CE1 doub Y N 190 HIS ND1 HD1 sing N N 191 HIS CD2 NE2 sing Y N 192 HIS CD2 HD2 sing N N 193 HIS CE1 NE2 sing Y N 194 HIS CE1 HE1 sing N N 195 HIS NE2 HE2 sing N N 196 HIS OXT HXT sing N N 197 HOH O H1 sing N N 198 HOH O H2 sing N N 199 ILE N CA sing N N 200 ILE N H sing N N 201 ILE N H2 sing N N 202 ILE CA C sing N N 203 ILE CA CB sing N N 204 ILE CA HA sing N N 205 ILE C O doub N N 206 ILE C OXT sing N N 207 ILE CB CG1 sing N N 208 ILE CB CG2 sing N N 209 ILE CB HB sing N N 210 ILE CG1 CD1 sing N N 211 ILE CG1 HG12 sing N N 212 ILE CG1 HG13 sing N N 213 ILE CG2 HG21 sing N N 214 ILE CG2 HG22 sing N N 215 ILE CG2 HG23 sing N N 216 ILE CD1 HD11 sing N N 217 ILE CD1 HD12 sing N N 218 ILE CD1 HD13 sing N N 219 ILE OXT HXT sing N N 220 LEU N CA sing N N 221 LEU N H sing N N 222 LEU N H2 sing N N 223 LEU CA C sing N N 224 LEU CA CB sing N N 225 LEU CA HA sing N N 226 LEU C O doub N N 227 LEU C OXT sing N N 228 LEU CB CG sing N N 229 LEU CB HB2 sing N N 230 LEU CB HB3 sing N N 231 LEU CG CD1 sing N N 232 LEU CG CD2 sing N N 233 LEU CG HG sing N N 234 LEU CD1 HD11 sing N N 235 LEU CD1 HD12 sing N N 236 LEU CD1 HD13 sing N N 237 LEU CD2 HD21 sing N N 238 LEU CD2 HD22 sing N N 239 LEU CD2 HD23 sing N N 240 LEU OXT HXT sing N N 241 LYS N CA sing N N 242 LYS N H sing N N 243 LYS N H2 sing N N 244 LYS CA C sing N N 245 LYS CA CB sing N N 246 LYS CA HA sing N N 247 LYS C O doub N N 248 LYS C OXT sing N N 249 LYS CB CG sing N N 250 LYS CB HB2 sing N N 251 LYS CB HB3 sing N N 252 LYS CG CD sing N N 253 LYS CG HG2 sing N N 254 LYS CG HG3 sing N N 255 LYS CD CE sing N N 256 LYS CD HD2 sing N N 257 LYS CD HD3 sing N N 258 LYS CE NZ sing N N 259 LYS CE HE2 sing N N 260 LYS CE HE3 sing N N 261 LYS NZ HZ1 sing N N 262 LYS NZ HZ2 sing N N 263 LYS NZ HZ3 sing N N 264 LYS OXT HXT sing N N 265 MET N CA sing N N 266 MET N H sing N N 267 MET N H2 sing N N 268 MET CA C sing N N 269 MET CA CB sing N N 270 MET CA HA sing N N 271 MET C O doub N N 272 MET C OXT sing N N 273 MET CB CG sing N N 274 MET CB HB2 sing N N 275 MET CB HB3 sing N N 276 MET CG SD sing N N 277 MET CG HG2 sing N N 278 MET CG HG3 sing N N 279 MET SD CE sing N N 280 MET CE HE1 sing N N 281 MET CE HE2 sing N N 282 MET CE HE3 sing N N 283 MET OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(3~{R})-3-[[5-fluoranyl-2-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]-4,4-dimethyl-pentanoic acid' 6NS 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4NCE _pdbx_initial_refinement_model.details ? #