data_5JWY # _entry.id 5JWY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5JWY WWPDB D_1000221350 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JWY _pdbx_database_status.recvd_initial_deposition_date 2016-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tong, S.' 1 ? 'Wang, M.' 2 ? 'Zheng, L.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 291 _citation.language ? _citation.page_first 18342 _citation.page_last 18352 _citation.title 'Structural Insight into Substrate Selection and Catalysis of Lipid Phosphate Phosphatase PgpB in the Cell Membrane.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M116.737874 _citation.pdbx_database_id_PubMed 27405756 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tong, S.' 1 ? primary 'Lin, Y.' 2 ? primary 'Lu, S.' 3 ? primary 'Wang, M.' 4 ? primary 'Bogdanov, M.' 5 ? primary 'Zheng, L.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5JWY _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.533 _cell.length_a_esd ? _cell.length_b 73.593 _cell.length_b_esd ? _cell.length_c 132.095 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JWY _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Phosphatidylglycerophosphatase B' 29946.375 1 '3.1.3.27, 3.1.3.81, 3.1.3.4, 3.6.1.27' ? ? ? 2 non-polymer syn '(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl tetradecanoate' 635.853 1 ? ? ? ? 3 water nat water 18.015 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Diacylglycerol pyrophosphate phosphatase, DGPP phosphatase, Phosphatidate phosphatase, Undecaprenyl pyrophosphate phosphatase, Undecaprenyl-diphosphatase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)RSIARRTAVGAALLLV(MSE)PVAVWISGWRWQPGEQSWLLKAAFWVTETVTQPWGVITHLILFGWFLWCLRFRI KAAFVLFAILAAAILVGQGVKSWIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQ KETGFAFPSGHT(MSE)FAASWALLAVGLLWPRRRTLTIAILLVWATGV(MSE)GSRLLLG(MSE)HWPRDLVVATLISW ALVAVATWLAQRICGPLTPPAEENREIAQREQESLEHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRSIARRTAVGAALLLVMPVAVWISGWRWQPGEQSWLLKAAFWVTETVTQPWGVITHLILFGWFLWCLRFRIKAAFVLFA ILAAAILVGQGVKSWIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFP SGHTMFAASWALLAVGLLWPRRRTLTIAILLVWATGVMGSRLLLGMHWPRDLVVATLISWALVAVATWLAQRICGPLTPP AEENREIAQREQESLEHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ARG n 1 3 SER n 1 4 ILE n 1 5 ALA n 1 6 ARG n 1 7 ARG n 1 8 THR n 1 9 ALA n 1 10 VAL n 1 11 GLY n 1 12 ALA n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 LEU n 1 17 VAL n 1 18 MSE n 1 19 PRO n 1 20 VAL n 1 21 ALA n 1 22 VAL n 1 23 TRP n 1 24 ILE n 1 25 SER n 1 26 GLY n 1 27 TRP n 1 28 ARG n 1 29 TRP n 1 30 GLN n 1 31 PRO n 1 32 GLY n 1 33 GLU n 1 34 GLN n 1 35 SER n 1 36 TRP n 1 37 LEU n 1 38 LEU n 1 39 LYS n 1 40 ALA n 1 41 ALA n 1 42 PHE n 1 43 TRP n 1 44 VAL n 1 45 THR n 1 46 GLU n 1 47 THR n 1 48 VAL n 1 49 THR n 1 50 GLN n 1 51 PRO n 1 52 TRP n 1 53 GLY n 1 54 VAL n 1 55 ILE n 1 56 THR n 1 57 HIS n 1 58 LEU n 1 59 ILE n 1 60 LEU n 1 61 PHE n 1 62 GLY n 1 63 TRP n 1 64 PHE n 1 65 LEU n 1 66 TRP n 1 67 CYS n 1 68 LEU n 1 69 ARG n 1 70 PHE n 1 71 ARG n 1 72 ILE n 1 73 LYS n 1 74 ALA n 1 75 ALA n 1 76 PHE n 1 77 VAL n 1 78 LEU n 1 79 PHE n 1 80 ALA n 1 81 ILE n 1 82 LEU n 1 83 ALA n 1 84 ALA n 1 85 ALA n 1 86 ILE n 1 87 LEU n 1 88 VAL n 1 89 GLY n 1 90 GLN n 1 91 GLY n 1 92 VAL n 1 93 LYS n 1 94 SER n 1 95 TRP n 1 96 ILE n 1 97 LYS n 1 98 ASP n 1 99 LYS n 1 100 VAL n 1 101 GLN n 1 102 GLU n 1 103 PRO n 1 104 ARG n 1 105 PRO n 1 106 PHE n 1 107 VAL n 1 108 ILE n 1 109 TRP n 1 110 LEU n 1 111 GLU n 1 112 LYS n 1 113 THR n 1 114 HIS n 1 115 HIS n 1 116 ILE n 1 117 PRO n 1 118 VAL n 1 119 ASP n 1 120 GLU n 1 121 PHE n 1 122 TYR n 1 123 THR n 1 124 LEU n 1 125 LYS n 1 126 ARG n 1 127 ALA n 1 128 GLU n 1 129 ARG n 1 130 GLY n 1 131 ASN n 1 132 LEU n 1 133 VAL n 1 134 LYS n 1 135 GLU n 1 136 GLN n 1 137 LEU n 1 138 ALA n 1 139 GLU n 1 140 GLU n 1 141 LYS n 1 142 ASN n 1 143 ILE n 1 144 PRO n 1 145 GLN n 1 146 TYR n 1 147 LEU n 1 148 ARG n 1 149 SER n 1 150 HIS n 1 151 TRP n 1 152 GLN n 1 153 LYS n 1 154 GLU n 1 155 THR n 1 156 GLY n 1 157 PHE n 1 158 ALA n 1 159 PHE n 1 160 PRO n 1 161 SER n 1 162 GLY n 1 163 HIS n 1 164 THR n 1 165 MSE n 1 166 PHE n 1 167 ALA n 1 168 ALA n 1 169 SER n 1 170 TRP n 1 171 ALA n 1 172 LEU n 1 173 LEU n 1 174 ALA n 1 175 VAL n 1 176 GLY n 1 177 LEU n 1 178 LEU n 1 179 TRP n 1 180 PRO n 1 181 ARG n 1 182 ARG n 1 183 ARG n 1 184 THR n 1 185 LEU n 1 186 THR n 1 187 ILE n 1 188 ALA n 1 189 ILE n 1 190 LEU n 1 191 LEU n 1 192 VAL n 1 193 TRP n 1 194 ALA n 1 195 THR n 1 196 GLY n 1 197 VAL n 1 198 MSE n 1 199 GLY n 1 200 SER n 1 201 ARG n 1 202 LEU n 1 203 LEU n 1 204 LEU n 1 205 GLY n 1 206 MSE n 1 207 HIS n 1 208 TRP n 1 209 PRO n 1 210 ARG n 1 211 ASP n 1 212 LEU n 1 213 VAL n 1 214 VAL n 1 215 ALA n 1 216 THR n 1 217 LEU n 1 218 ILE n 1 219 SER n 1 220 TRP n 1 221 ALA n 1 222 LEU n 1 223 VAL n 1 224 ALA n 1 225 VAL n 1 226 ALA n 1 227 THR n 1 228 TRP n 1 229 LEU n 1 230 ALA n 1 231 GLN n 1 232 ARG n 1 233 ILE n 1 234 CYS n 1 235 GLY n 1 236 PRO n 1 237 LEU n 1 238 THR n 1 239 PRO n 1 240 PRO n 1 241 ALA n 1 242 GLU n 1 243 GLU n 1 244 ASN n 1 245 ARG n 1 246 GLU n 1 247 ILE n 1 248 ALA n 1 249 GLN n 1 250 ARG n 1 251 GLU n 1 252 GLN n 1 253 GLU n 1 254 SER n 1 255 LEU n 1 256 GLU n 1 257 HIS n 1 258 HIS n 1 259 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 259 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pgpB, b1278, JW1270' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'C41(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGPB_ECOLI _struct_ref.pdbx_db_accession P0A924 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRSIARRTAVGAALLLVMPVAVWISGWRWQPGEQSWLLKAAFWVTETVTQPWGVITHLILFGWFLWCLRFRIKAAFVLFA ILAAAILVGQGVKSWIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFP SGHTMFAASWALLAVGLLWPRRRTLTIAILLVWATGVMGSRLLLGMHWPRDLVVATLISWALVAVATWLAQRICGPLTPP AEENREIAQREQES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JWY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 254 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A924 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 254 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 254 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5JWY LEU A 255 ? UNP P0A924 ? ? 'expression tag' 255 1 1 5JWY GLU A 256 ? UNP P0A924 ? ? 'expression tag' 256 2 1 5JWY HIS A 257 ? UNP P0A924 ? ? 'expression tag' 257 3 1 5JWY HIS A 258 ? UNP P0A924 ? ? 'expression tag' 258 4 1 5JWY HIS A 259 ? UNP P0A924 ? ? 'expression tag' 259 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 46E non-polymer . '(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl tetradecanoate' ? 'C33 H66 N O8 P' 635.853 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JWY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG6000, sodium chloride, ADA' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-11-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9794 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9794 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5JWY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.200 _reflns.d_resolution_low 132.100 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6838 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.000 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.102 _reflns.pdbx_netI_over_av_sigmaI 7.048 _reflns.pdbx_netI_over_sigmaI 25.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.200 3.370 ? 1.000 ? ? ? ? ? 100.000 ? ? ? ? 0.778 ? ? ? ? ? ? ? ? 14.500 ? ? ? ? ? ? ? 1 1 ? ? 3.370 3.580 ? 1.400 ? ? ? ? ? 100.000 ? ? ? ? 0.501 ? ? ? ? ? ? ? ? 14.400 ? ? ? ? ? ? ? 2 1 ? ? 3.580 3.820 ? 2.200 ? ? ? ? ? 100.000 ? ? ? ? 0.307 ? ? ? ? ? ? ? ? 14.400 ? ? ? ? ? ? ? 3 1 ? ? 3.820 4.130 ? 4.700 ? ? ? ? ? 100.000 ? ? ? ? 0.163 ? ? ? ? ? ? ? ? 14.100 ? ? ? ? ? ? ? 4 1 ? ? 4.130 4.530 ? 8.000 ? ? ? ? ? 100.000 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 14.300 ? ? ? ? ? ? ? 5 1 ? ? 4.530 5.060 ? 10.200 ? ? ? ? ? 100.000 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 14.100 ? ? ? ? ? ? ? 6 1 ? ? 5.060 5.840 ? 9.600 ? ? ? ? ? 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 13.900 ? ? ? ? ? ? ? 7 1 ? ? 5.840 7.160 ? 12.000 ? ? ? ? ? 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 13.700 ? ? ? ? ? ? ? 8 1 ? ? 7.160 10.120 ? 22.100 ? ? ? ? ? 100.000 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 13.000 ? ? ? ? ? ? ? 9 1 ? ? 10.120 73.593 ? 31.400 ? ? ? ? ? 98.900 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 11.200 ? ? ? ? ? ? ? 10 1 ? ? # _refine.aniso_B[1][1] 2.2100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 10.6200 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -12.8400 _refine.B_iso_max 173.150 _refine.B_iso_mean 93.5910 _refine.B_iso_min 49.440 _refine.correlation_coeff_Fo_to_Fc 0.8770 _refine.correlation_coeff_Fo_to_Fc_free 0.8790 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5JWY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.2000 _refine.ls_d_res_low 132.1000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6800 _refine.ls_number_reflns_R_free 323 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2691 _refine.ls_R_factor_R_free 0.3051 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2672 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.5720 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.2000 _refine_hist.d_res_low 132.1000 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 2149 _refine_hist.pdbx_number_residues_total 259 _refine_hist.pdbx_B_iso_mean_ligand 95.23 _refine_hist.pdbx_B_iso_mean_solvent 52.19 _refine_hist.pdbx_number_atoms_protein 2104 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.019 2214 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.000 0.020 2195 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.276 1.942 3013 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 3.468 3.011 5016 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.545 5.000 258 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.181 21.667 90 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.087 15.000 339 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.842 15.000 18 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.061 0.200 331 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 2394 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 546 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 4.438 9.035 1035 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.439 9.034 1034 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.210 13.532 1292 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.2000 _refine_ls_shell.d_res_low 3.2830 _refine_ls_shell.number_reflns_all 497 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 22 _refine_ls_shell.number_reflns_R_work 475 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3200 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3280 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5JWY _struct.title 'Structure of lipid phosphate phosphatase PgpB complex with PE' _struct.pdbx_descriptor 'Phosphatidylglycerophosphatase B (E.C.3.1.3.27, 3.1.3.81, 3.1.3.4, 3.6.1.27)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JWY _struct_keywords.text 'transmembrane helices, protein-lipid complex, enzyme, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 2 ? GLY A 26 ? ARG A 2 GLY A 26 1 ? 25 HELX_P HELX_P2 AA2 GLN A 34 ? THR A 47 ? GLN A 34 THR A 47 1 ? 14 HELX_P HELX_P3 AA3 TRP A 52 ? LEU A 68 ? TRP A 52 LEU A 68 1 ? 17 HELX_P HELX_P4 AA4 ARG A 71 ? LYS A 97 ? ARG A 71 LYS A 97 1 ? 27 HELX_P HELX_P5 AA5 ARG A 104 ? HIS A 114 ? ARG A 104 HIS A 114 1 ? 11 HELX_P HELX_P6 AA6 PRO A 117 ? THR A 123 ? PRO A 117 THR A 123 1 ? 7 HELX_P HELX_P7 AA7 LYS A 125 ? GLU A 140 ? LYS A 125 GLU A 140 1 ? 16 HELX_P HELX_P8 AA8 PRO A 144 ? THR A 155 ? PRO A 144 THR A 155 1 ? 12 HELX_P HELX_P9 AA9 SER A 161 ? TRP A 179 ? SER A 161 TRP A 179 1 ? 19 HELX_P HELX_P10 AB1 PRO A 180 ? ARG A 182 ? PRO A 180 ARG A 182 5 ? 3 HELX_P HELX_P11 AB2 ARG A 183 ? LEU A 204 ? ARG A 183 LEU A 204 1 ? 22 HELX_P HELX_P12 AB3 TRP A 208 ? GLY A 235 ? TRP A 208 GLY A 235 1 ? 28 HELX_P HELX_P13 AB4 PRO A 240 ? GLU A 256 ? PRO A 240 GLU A 256 1 ? 17 HELX_P HELX_P14 AB5 HIS A 257 ? HIS A 259 ? HIS A 257 HIS A 259 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ARG 2 N ? ? A MSE 1 A ARG 2 1_555 ? ? ? ? ? ? ? 1.336 ? covale2 covale both ? A VAL 17 C ? ? ? 1_555 A MSE 18 N ? ? A VAL 17 A MSE 18 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale both ? A MSE 18 C ? ? ? 1_555 A PRO 19 N ? ? A MSE 18 A PRO 19 1_555 ? ? ? ? ? ? ? 1.355 ? covale4 covale both ? A THR 164 C ? ? ? 1_555 A MSE 165 N ? ? A THR 164 A MSE 165 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale both ? A MSE 165 C ? ? ? 1_555 A PHE 166 N ? ? A MSE 165 A PHE 166 1_555 ? ? ? ? ? ? ? 1.336 ? covale6 covale both ? A VAL 197 C ? ? ? 1_555 A MSE 198 N ? ? A VAL 197 A MSE 198 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale both ? A MSE 198 C ? ? ? 1_555 A GLY 199 N ? ? A MSE 198 A GLY 199 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale both ? A GLY 205 C ? ? ? 1_555 A MSE 206 N ? ? A GLY 205 A MSE 206 1_555 ? ? ? ? ? ? ? 1.329 ? covale9 covale both ? A MSE 206 C ? ? ? 1_555 A HIS 207 N ? ? A MSE 206 A HIS 207 1_555 ? ? ? ? ? ? ? 1.335 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 46E _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue 46E A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 GLN A 50 ? GLN A 50 . ? 1_555 ? 2 AC1 9 VAL A 88 ? VAL A 88 . ? 1_555 ? 3 AC1 9 GLY A 89 ? GLY A 89 . ? 1_555 ? 4 AC1 9 LYS A 93 ? LYS A 93 . ? 1_555 ? 5 AC1 9 PRO A 160 ? PRO A 160 . ? 1_555 ? 6 AC1 9 PHE A 166 ? PHE A 166 . ? 1_555 ? 7 AC1 9 SER A 169 ? SER A 169 . ? 1_555 ? 8 AC1 9 TRP A 170 ? TRP A 170 . ? 1_555 ? 9 AC1 9 LEU A 222 ? LEU A 222 . ? 1_555 ? # _atom_sites.entry_id 5JWY _atom_sites.fract_transf_matrix[1][1] 0.025295 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013588 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007570 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 MSE 18 18 18 MSE MSE A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 TRP 95 95 95 TRP TRP A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 TRP 151 151 151 TRP TRP A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 HIS 163 163 163 HIS HIS A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 MSE 165 165 165 MSE MSE A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 TRP 193 193 193 TRP TRP A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 MSE 198 198 198 MSE MSE A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 MSE 206 206 206 MSE MSE A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 TRP 208 208 208 TRP TRP A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 TRP 220 220 220 TRP TRP A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 TRP 228 228 228 TRP TRP A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 CYS 234 234 234 CYS CYS A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 GLN 249 249 249 GLN GLN A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 HIS 257 257 257 HIS HIS A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 HIS 259 259 259 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 46E 1 301 1 46E 3PE A . C 3 HOH 1 401 1 HOH HOH A . C 3 HOH 2 402 2 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 18 A MSE 18 ? MET 'modified residue' 3 A MSE 165 A MSE 165 ? MET 'modified residue' 4 A MSE 198 A MSE 198 ? MET 'modified residue' 5 A MSE 206 A MSE 206 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13880 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-20 2 'Structure model' 1 1 2016-07-27 3 'Structure model' 1 2 2016-09-07 4 'Structure model' 1 3 2017-11-22 5 'Structure model' 1 4 2019-11-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' software 4 5 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 5 'Structure model' '_pdbx_audit_support.funding_organization' 4 5 'Structure model' '_pdbx_audit_support.grant_number' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 3.200 _diffrn_reflns.pdbx_d_res_low 132.095 _diffrn_reflns.pdbx_number_obs 6838 _diffrn_reflns.pdbx_Rmerge_I_obs ? _diffrn_reflns.pdbx_Rsym_value 0.102 _diffrn_reflns.pdbx_chi_squared ? _diffrn_reflns.pdbx_redundancy 14.00 _diffrn_reflns.pdbx_rejects ? _diffrn_reflns.pdbx_percent_possible_obs 100.00 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.number 95967 _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 10.12 73.59 ? ? 0.019 0.019 ? 11.20 ? 1 7.16 10.12 ? ? 0.028 0.028 ? 13.00 ? 1 5.84 7.16 ? ? 0.063 0.063 ? 13.70 ? 1 5.06 5.84 ? ? 0.078 0.078 ? 13.90 ? 1 4.53 5.06 ? ? 0.071 0.071 ? 14.10 ? 1 4.13 4.53 ? ? 0.095 0.095 ? 14.30 ? 1 3.82 4.13 ? ? 0.163 0.163 ? 14.10 ? 1 3.58 3.82 ? ? 0.307 0.307 ? 14.40 ? 1 3.37 3.58 ? ? 0.501 0.501 ? 14.40 ? 1 3.20 3.37 ? ? 0.778 0.778 ? 14.50 ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.16 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 104 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 PHE _pdbx_validate_close_contact.auth_seq_id_2 157 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 101 ? ? -134.48 -32.67 2 1 GLU A 102 ? ? -38.94 128.66 3 1 THR A 123 ? ? -91.78 50.05 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM097290 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(tetradecanoyloxy)propyl tetradecanoate' 46E 3 water HOH #