data_5JX1 # _entry.id 5JX1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5JX1 pdb_00005jx1 10.2210/pdb5jx1/pdb WWPDB D_1000221367 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5JV3 unspecified PDB . 5JVM unspecified PDB . 5JVP unspecified PDB . 5JVR unspecified PDB . 5JVS unspecified PDB . 5JVU unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5JX1 _pdbx_database_status.recvd_initial_deposition_date 2016-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Phillips, R.K.' 1 'Rayment, I.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 291 _citation.language ? _citation.page_first 20372 _citation.page_last 20386 _citation.title 'Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M116.737577 _citation.pdbx_database_id_PubMed 27462072 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Phillips, R.K.' 1 ? primary 'Peter, L.G.' 2 ? primary 'Gilbert, S.P.' 3 ? primary 'Rayment, I.' 4 ? # _cell.entry_id 5JX1 _cell.length_a 45.812 _cell.length_b 80.534 _cell.length_c 36.834 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5JX1 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chimera protein of Kinesin-like protein KIF3A and Microtubule-associated protein RP/EB family member 1' 8923.008 1 ? ? 'UNP P28741 residues 352-376,UNP Q15691 residues 210-257' ? 2 water nat water 18.015 71 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Microtubule plus end-directed kinesin motor 3A,APC-binding protein EB1,End-binding protein 1,EB1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LSNEDPKDALLRQFQKEIEELKKKLEELEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD _entity_poly.pdbx_seq_one_letter_code_can LSNEDPKDALLRQFQKEIEELKKKLEELEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 SER n 1 3 ASN n 1 4 GLU n 1 5 ASP n 1 6 PRO n 1 7 LYS n 1 8 ASP n 1 9 ALA n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 GLN n 1 14 PHE n 1 15 GLN n 1 16 LYS n 1 17 GLU n 1 18 ILE n 1 19 GLU n 1 20 GLU n 1 21 LEU n 1 22 LYS n 1 23 LYS n 1 24 LYS n 1 25 LEU n 1 26 GLU n 1 27 GLU n 1 28 LEU n 1 29 GLU n 1 30 LYS n 1 31 GLU n 1 32 ARG n 1 33 ASP n 1 34 PHE n 1 35 TYR n 1 36 PHE n 1 37 GLY n 1 38 LYS n 1 39 LEU n 1 40 ARG n 1 41 ASN n 1 42 ILE n 1 43 GLU n 1 44 LEU n 1 45 ILE n 1 46 CYS n 1 47 GLN n 1 48 GLU n 1 49 ASN n 1 50 GLU n 1 51 GLY n 1 52 GLU n 1 53 ASN n 1 54 ASP n 1 55 PRO n 1 56 VAL n 1 57 LEU n 1 58 GLN n 1 59 ARG n 1 60 ILE n 1 61 VAL n 1 62 ASP n 1 63 ILE n 1 64 LEU n 1 65 TYR n 1 66 ALA n 1 67 THR n 1 68 ASP n 1 69 GLU n 1 70 GLY n 1 71 PHE n 1 72 VAL n 1 73 ILE n 1 74 PRO n 1 75 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 27 Mouse ? 'Kif3a, Kif3' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 28 75 Human ? MAPRE1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KIF3A_MOUSE P28741 ? 1 NEDPKDALLRQFQKEIEELKKKLEE 352 2 UNP MARE1_HUMAN Q15691 ? 1 LEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD 210 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5JX1 A 3 ? 27 ? P28741 352 ? 376 ? 2 26 2 2 5JX1 A 28 ? 75 ? Q15691 210 ? 257 ? 27 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5JX1 LEU A 1 ? UNP P28741 ? ? 'expression tag' 0 1 1 5JX1 SER A 2 ? UNP P28741 ? ? 'expression tag' 1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JX1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 35.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;24% (w/v) 2-methyl-2,4-pentanediol (MPD), 10% (w/v) PEG 4000, 100 mM CaCl2, 100 mM (3-(N-morpholino)propanesulfonic acid) (MOPS) pH 7.0, 1 mM CdCl2 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97924 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97924 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5JX1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.67 _reflns.d_resolution_low 39.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14745 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.6 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 50.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.67 _reflns_shell.d_res_low 1.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 12.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 86.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.295 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5JX1 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 14745 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.820 _refine.ls_d_res_high 1.670 _refine.ls_percent_reflns_obs 96.32 _refine.ls_R_factor_obs 0.1940 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1923 _refine.ls_R_factor_R_free 0.2276 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.03 _refine.ls_number_reflns_R_free 742 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 1YIB _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.18 _refine.pdbx_overall_phase_error 22.85 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 541 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 612 _refine_hist.d_res_high 1.670 _refine_hist.d_res_low 39.820 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.006 ? ? 573 'X-RAY DIFFRACTION' ? f_angle_d 0.716 ? ? 767 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 22.231 ? ? 361 'X-RAY DIFFRACTION' ? f_chiral_restr 0.042 ? ? 84 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 101 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.6695 1.7984 2476 0.1916 86.00 0.2052 . . 144 . . . . 'X-RAY DIFFRACTION' . 1.7984 1.9794 2816 0.2015 96.00 0.2704 . . 144 . . . . 'X-RAY DIFFRACTION' . 1.9794 2.2658 2896 0.1789 99.00 0.2215 . . 149 . . . . 'X-RAY DIFFRACTION' . 2.2658 2.8546 2913 0.1931 100.00 0.2552 . . 153 . . . . 'X-RAY DIFFRACTION' . 2.8546 39.8314 2902 0.1955 100.00 0.2097 . . 152 . . . . # _struct.entry_id 5JX1 _struct.title 'The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JX1 _struct_keywords.text 'kinesin, coiled-coil, MOTOR PROTEIN' _struct_keywords.pdbx_keywords 'MOTOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 5 ? GLN A 47 ? ASP A 4 GLN A 46 1 ? 43 HELX_P HELX_P2 AA2 PRO A 55 ? ALA A 66 ? PRO A 54 ALA A 65 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5JX1 _atom_sites.fract_transf_matrix[1][1] 0.021828 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012417 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027149 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 0 ? ? ? A . n A 1 2 SER 2 1 ? ? ? A . n A 1 3 ASN 3 2 ? ? ? A . n A 1 4 GLU 4 3 ? ? ? A . n A 1 5 ASP 5 4 4 ASP ASP A . n A 1 6 PRO 6 5 5 PRO PRO A . n A 1 7 LYS 7 6 6 LYS LYS A . n A 1 8 ASP 8 7 7 ASP ASP A . n A 1 9 ALA 9 8 8 ALA ALA A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 ARG 12 11 11 ARG ARG A . n A 1 13 GLN 13 12 12 GLN GLN A . n A 1 14 PHE 14 13 13 PHE PHE A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 GLU 17 16 16 GLU GLU A . n A 1 18 ILE 18 17 17 ILE ILE A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 LYS 23 22 22 LYS LYS A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 GLU 27 26 26 GLU GLU A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 GLU 29 28 28 GLU GLU A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 ASP 33 32 32 ASP ASP A . n A 1 34 PHE 34 33 33 PHE PHE A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 PHE 36 35 35 PHE PHE A . n A 1 37 GLY 37 36 36 GLY GLY A . n A 1 38 LYS 38 37 37 LYS LYS A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 ARG 40 39 39 ARG ARG A . n A 1 41 ASN 41 40 40 ASN ASN A . n A 1 42 ILE 42 41 41 ILE ILE A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 ILE 45 44 44 ILE ILE A . n A 1 46 CYS 46 45 45 CYS CYS A . n A 1 47 GLN 47 46 46 GLN GLN A . n A 1 48 GLU 48 47 ? ? ? A . n A 1 49 ASN 49 48 ? ? ? A . n A 1 50 GLU 50 49 ? ? ? A . n A 1 51 GLY 51 50 ? ? ? A . n A 1 52 GLU 52 51 ? ? ? A . n A 1 53 ASN 53 52 ? ? ? A . n A 1 54 ASP 54 53 53 ASP ASP A . n A 1 55 PRO 55 54 54 PRO PRO A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 GLN 58 57 57 GLN GLN A . n A 1 59 ARG 59 58 58 ARG ARG A . n A 1 60 ILE 60 59 59 ILE ILE A . n A 1 61 VAL 61 60 60 VAL VAL A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 LEU 64 63 63 LEU LEU A . n A 1 65 TYR 65 64 64 TYR TYR A . n A 1 66 ALA 66 65 65 ALA ALA A . n A 1 67 THR 67 66 66 THR THR A . n A 1 68 ASP 68 67 67 ASP ASP A . n A 1 69 GLU 69 68 68 GLU GLU A . n A 1 70 GLY 70 69 69 GLY GLY A . n A 1 71 PHE 71 70 70 PHE PHE A . n A 1 72 VAL 72 71 71 VAL VAL A . n A 1 73 ILE 73 72 72 ILE ILE A . n A 1 74 PRO 74 73 73 PRO PRO A . n A 1 75 ASP 75 74 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 55 HOH HOH A . B 2 HOH 2 102 49 HOH HOH A . B 2 HOH 3 103 26 HOH HOH A . B 2 HOH 4 104 10 HOH HOH A . B 2 HOH 5 105 18 HOH HOH A . B 2 HOH 6 106 44 HOH HOH A . B 2 HOH 7 107 40 HOH HOH A . B 2 HOH 8 108 13 HOH HOH A . B 2 HOH 9 109 21 HOH HOH A . B 2 HOH 10 110 35 HOH HOH A . B 2 HOH 11 111 19 HOH HOH A . B 2 HOH 12 112 64 HOH HOH A . B 2 HOH 13 113 11 HOH HOH A . B 2 HOH 14 114 16 HOH HOH A . B 2 HOH 15 115 39 HOH HOH A . B 2 HOH 16 116 31 HOH HOH A . B 2 HOH 17 117 33 HOH HOH A . B 2 HOH 18 118 12 HOH HOH A . B 2 HOH 19 119 23 HOH HOH A . B 2 HOH 20 120 29 HOH HOH A . B 2 HOH 21 121 62 HOH HOH A . B 2 HOH 22 122 45 HOH HOH A . B 2 HOH 23 123 27 HOH HOH A . B 2 HOH 24 124 47 HOH HOH A . B 2 HOH 25 125 34 HOH HOH A . B 2 HOH 26 126 50 HOH HOH A . B 2 HOH 27 127 65 HOH HOH A . B 2 HOH 28 128 57 HOH HOH A . B 2 HOH 29 129 68 HOH HOH A . B 2 HOH 30 130 20 HOH HOH A . B 2 HOH 31 131 6 HOH HOH A . B 2 HOH 32 132 2 HOH HOH A . B 2 HOH 33 133 25 HOH HOH A . B 2 HOH 34 134 41 HOH HOH A . B 2 HOH 35 135 7 HOH HOH A . B 2 HOH 36 136 15 HOH HOH A . B 2 HOH 37 137 22 HOH HOH A . B 2 HOH 38 138 17 HOH HOH A . B 2 HOH 39 139 14 HOH HOH A . B 2 HOH 40 140 9 HOH HOH A . B 2 HOH 41 141 24 HOH HOH A . B 2 HOH 42 142 51 HOH HOH A . B 2 HOH 43 143 5 HOH HOH A . B 2 HOH 44 144 3 HOH HOH A . B 2 HOH 45 145 4 HOH HOH A . B 2 HOH 46 146 48 HOH HOH A . B 2 HOH 47 147 42 HOH HOH A . B 2 HOH 48 148 30 HOH HOH A . B 2 HOH 49 149 52 HOH HOH A . B 2 HOH 50 150 63 HOH HOH A . B 2 HOH 51 151 60 HOH HOH A . B 2 HOH 52 152 56 HOH HOH A . B 2 HOH 53 153 58 HOH HOH A . B 2 HOH 54 154 36 HOH HOH A . B 2 HOH 55 155 8 HOH HOH A . B 2 HOH 56 156 54 HOH HOH A . B 2 HOH 57 157 67 HOH HOH A . B 2 HOH 58 158 43 HOH HOH A . B 2 HOH 59 159 46 HOH HOH A . B 2 HOH 60 160 53 HOH HOH A . B 2 HOH 61 161 1 HOH HOH A . B 2 HOH 62 162 28 HOH HOH A . B 2 HOH 63 163 61 HOH HOH A . B 2 HOH 64 164 38 HOH HOH A . B 2 HOH 65 165 32 HOH HOH A . B 2 HOH 66 166 66 HOH HOH A . B 2 HOH 67 167 69 HOH HOH A . B 2 HOH 68 168 70 HOH HOH A . B 2 HOH 69 169 37 HOH HOH A . B 2 HOH 70 170 71 HOH HOH A . B 2 HOH 71 171 59 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3970 ? 1 MORE -32 ? 1 'SSA (A^2)' 9280 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 45.8120000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 18.4170000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 105 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-03 2 'Structure model' 1 1 2016-08-10 3 'Structure model' 1 2 2016-10-05 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' citation 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 20.6819 37.8148 12.4903 0.0546 0.1069 0.0459 0.0033 -0.0222 0.0068 0.2967 2.7594 0.2333 -0.5947 -0.0979 -0.4014 0.0366 -0.0253 -0.0221 0.3027 -0.0886 0.1182 0.0192 0.0365 0.0222 'X-RAY DIFFRACTION' 2 ? refined 30.2046 12.1285 4.7983 0.0832 0.1218 0.1666 0.0331 -0.0077 -0.0037 0.2376 4.0290 2.2509 0.5341 -0.0765 -2.3697 0.0913 0.0820 -0.4319 -0.2421 -0.0291 -0.0570 0.2169 0.2593 0.0629 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 4 through 46 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 53 through 73 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2142: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NZ A LYS 29 ? ? O A HOH 101 ? ? 1.93 2 1 OE1 A GLN 57 ? ? O A HOH 102 ? ? 2.16 3 1 O A ASP 4 ? ? O A HOH 103 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 166 ? ? 1_555 O A HOH 169 ? ? 2_665 2.11 2 1 O A HOH 115 ? ? 1_555 O A HOH 148 ? ? 7_545 2.16 3 1 O A HOH 147 ? ? 1_555 O A HOH 164 ? ? 5_455 2.18 4 1 O A HOH 128 ? ? 1_555 O A HOH 164 ? ? 5_455 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 67 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -122.84 _pdbx_validate_torsion.psi -164.50 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 0 ? A LEU 1 2 1 Y 1 A SER 1 ? A SER 2 3 1 Y 1 A ASN 2 ? A ASN 3 4 1 Y 1 A GLU 3 ? A GLU 4 5 1 Y 1 A GLU 47 ? A GLU 48 6 1 Y 1 A ASN 48 ? A ASN 49 7 1 Y 1 A GLU 49 ? A GLU 50 8 1 Y 1 A GLY 50 ? A GLY 51 9 1 Y 1 A GLU 51 ? A GLU 52 10 1 Y 1 A ASN 52 ? A ASN 53 11 1 Y 1 A ASP 74 ? A ASP 75 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 PHE N N N N 209 PHE CA C N S 210 PHE C C N N 211 PHE O O N N 212 PHE CB C N N 213 PHE CG C Y N 214 PHE CD1 C Y N 215 PHE CD2 C Y N 216 PHE CE1 C Y N 217 PHE CE2 C Y N 218 PHE CZ C Y N 219 PHE OXT O N N 220 PHE H H N N 221 PHE H2 H N N 222 PHE HA H N N 223 PHE HB2 H N N 224 PHE HB3 H N N 225 PHE HD1 H N N 226 PHE HD2 H N N 227 PHE HE1 H N N 228 PHE HE2 H N N 229 PHE HZ H N N 230 PHE HXT H N N 231 PRO N N N N 232 PRO CA C N S 233 PRO C C N N 234 PRO O O N N 235 PRO CB C N N 236 PRO CG C N N 237 PRO CD C N N 238 PRO OXT O N N 239 PRO H H N N 240 PRO HA H N N 241 PRO HB2 H N N 242 PRO HB3 H N N 243 PRO HG2 H N N 244 PRO HG3 H N N 245 PRO HD2 H N N 246 PRO HD3 H N N 247 PRO HXT H N N 248 SER N N N N 249 SER CA C N S 250 SER C C N N 251 SER O O N N 252 SER CB C N N 253 SER OG O N N 254 SER OXT O N N 255 SER H H N N 256 SER H2 H N N 257 SER HA H N N 258 SER HB2 H N N 259 SER HB3 H N N 260 SER HG H N N 261 SER HXT H N N 262 THR N N N N 263 THR CA C N S 264 THR C C N N 265 THR O O N N 266 THR CB C N R 267 THR OG1 O N N 268 THR CG2 C N N 269 THR OXT O N N 270 THR H H N N 271 THR H2 H N N 272 THR HA H N N 273 THR HB H N N 274 THR HG1 H N N 275 THR HG21 H N N 276 THR HG22 H N N 277 THR HG23 H N N 278 THR HXT H N N 279 TYR N N N N 280 TYR CA C N S 281 TYR C C N N 282 TYR O O N N 283 TYR CB C N N 284 TYR CG C Y N 285 TYR CD1 C Y N 286 TYR CD2 C Y N 287 TYR CE1 C Y N 288 TYR CE2 C Y N 289 TYR CZ C Y N 290 TYR OH O N N 291 TYR OXT O N N 292 TYR H H N N 293 TYR H2 H N N 294 TYR HA H N N 295 TYR HB2 H N N 296 TYR HB3 H N N 297 TYR HD1 H N N 298 TYR HD2 H N N 299 TYR HE1 H N N 300 TYR HE2 H N N 301 TYR HH H N N 302 TYR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 PHE N CA sing N N 197 PHE N H sing N N 198 PHE N H2 sing N N 199 PHE CA C sing N N 200 PHE CA CB sing N N 201 PHE CA HA sing N N 202 PHE C O doub N N 203 PHE C OXT sing N N 204 PHE CB CG sing N N 205 PHE CB HB2 sing N N 206 PHE CB HB3 sing N N 207 PHE CG CD1 doub Y N 208 PHE CG CD2 sing Y N 209 PHE CD1 CE1 sing Y N 210 PHE CD1 HD1 sing N N 211 PHE CD2 CE2 doub Y N 212 PHE CD2 HD2 sing N N 213 PHE CE1 CZ doub Y N 214 PHE CE1 HE1 sing N N 215 PHE CE2 CZ sing Y N 216 PHE CE2 HE2 sing N N 217 PHE CZ HZ sing N N 218 PHE OXT HXT sing N N 219 PRO N CA sing N N 220 PRO N CD sing N N 221 PRO N H sing N N 222 PRO CA C sing N N 223 PRO CA CB sing N N 224 PRO CA HA sing N N 225 PRO C O doub N N 226 PRO C OXT sing N N 227 PRO CB CG sing N N 228 PRO CB HB2 sing N N 229 PRO CB HB3 sing N N 230 PRO CG CD sing N N 231 PRO CG HG2 sing N N 232 PRO CG HG3 sing N N 233 PRO CD HD2 sing N N 234 PRO CD HD3 sing N N 235 PRO OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 THR N CA sing N N 250 THR N H sing N N 251 THR N H2 sing N N 252 THR CA C sing N N 253 THR CA CB sing N N 254 THR CA HA sing N N 255 THR C O doub N N 256 THR C OXT sing N N 257 THR CB OG1 sing N N 258 THR CB CG2 sing N N 259 THR CB HB sing N N 260 THR OG1 HG1 sing N N 261 THR CG2 HG21 sing N N 262 THR CG2 HG22 sing N N 263 THR CG2 HG23 sing N N 264 THR OXT HXT sing N N 265 TYR N CA sing N N 266 TYR N H sing N N 267 TYR N H2 sing N N 268 TYR CA C sing N N 269 TYR CA CB sing N N 270 TYR CA HA sing N N 271 TYR C O doub N N 272 TYR C OXT sing N N 273 TYR CB CG sing N N 274 TYR CB HB2 sing N N 275 TYR CB HB3 sing N N 276 TYR CG CD1 doub Y N 277 TYR CG CD2 sing Y N 278 TYR CD1 CE1 sing Y N 279 TYR CD1 HD1 sing N N 280 TYR CD2 CE2 doub Y N 281 TYR CD2 HD2 sing N N 282 TYR CE1 CZ doub Y N 283 TYR CE1 HE1 sing N N 284 TYR CE2 CZ sing Y N 285 TYR CE2 HE2 sing N N 286 TYR CZ OH sing N N 287 TYR OH HH sing N N 288 TYR OXT HXT sing N N 289 VAL N CA sing N N 290 VAL N H sing N N 291 VAL N H2 sing N N 292 VAL CA C sing N N 293 VAL CA CB sing N N 294 VAL CA HA sing N N 295 VAL C O doub N N 296 VAL C OXT sing N N 297 VAL CB CG1 sing N N 298 VAL CB CG2 sing N N 299 VAL CB HB sing N N 300 VAL CG1 HG11 sing N N 301 VAL CG1 HG12 sing N N 302 VAL CG1 HG13 sing N N 303 VAL CG2 HG21 sing N N 304 VAL CG2 HG22 sing N N 305 VAL CG2 HG23 sing N N 306 VAL OXT HXT sing N N 307 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1YIB _pdbx_initial_refinement_model.details ? #