data_5K56 # _entry.id 5K56 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5K56 pdb_00005k56 10.2210/pdb5k56/pdb WWPDB D_1000214485 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-07 2 'Structure model' 1 1 2018-08-08 3 'Structure model' 1 2 2020-07-29 4 'Structure model' 1 3 2024-01-10 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_related_exp_data_set 2 3 'Structure model' chem_comp 3 3 'Structure model' diffrn_radiation_wavelength 4 3 'Structure model' entity 5 3 'Structure model' pdbx_chem_comp_identifier 6 3 'Structure model' pdbx_entity_nonpoly 7 3 'Structure model' struct_site 8 3 'Structure model' struct_site_gen 9 4 'Structure model' chem_comp 10 4 'Structure model' chem_comp_atom 11 4 'Structure model' chem_comp_bond 12 4 'Structure model' database_2 13 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_related_exp_data_set.data_reference' 2 2 'Structure model' '_pdbx_related_exp_data_set.metadata_reference' 3 3 'Structure model' '_chem_comp.mon_nstd_flag' 4 3 'Structure model' '_chem_comp.name' 5 3 'Structure model' '_chem_comp.type' 6 3 'Structure model' '_entity.pdbx_description' 7 3 'Structure model' '_pdbx_entity_nonpoly.name' 8 4 'Structure model' '_chem_comp.pdbx_synonyms' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5K56 _pdbx_database_status.recvd_initial_deposition_date 2016-05-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Human muscle fructose-1,6-bisphosphatase E69Q mutant in T-state in complex with AMP' 3IFA unspecified PDB 'Human muscle fructose-1,6-bisphosphatase E69Q mutant in T-state in complex with AMP and fructose-6-phosphate' 3IFC unspecified PDB 'Crystal structure of human muscle fructose-1,6-bisphosphatase' 4HE0 unspecified PDB 'Crystal structure of human muscle fructose-1,6-bisphosphatase Q32R mutant complex with fructose-6-phosphate and phosphate' 4HE1 unspecified PDB 'Crystal structure of human muscle fructose-1,6-bisphosphatase Q32R mutant complex with AMP' 4HE2 unspecified PDB 'Human muscle fructose-1,6-bisphosphatase in active R-state' 5ET5 unspecified PDB 'Human muscle fructose-1,6-bisphosphatase in inactive T-state in complex with AMP' 5ET6 unspecified PDB 'Human muscle fructose-1,6-bisphosphatase in inactive T-state' 5ET7 unspecified PDB 'Human muscle fructose-1,6-bisphosphatase in active R-state in complex with fructose-6-phosphate' 5ET8 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Barciszewski, J.' 1 ? 'Wisniewski, J.' 2 ? 'Kolodziejczyk, R.' 3 ? 'Dzugaj, A.' 4 ? 'Jaskolski, M.' 5 ? 'Rakus, D.' 6 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Structural studies of human muscle FBPase' ? ? ? ? ? ? ? ? ? ? ? ? US ? ? 1 'Acta Crystallogr. D Biol. Crystallogr.' ABCRE6 ? 1399-0047 ? ? 67 ? 1028 1034 'Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase.' 2011 ? 10.1107/S090744491104385X 22120740 ? ? ? ? ? ? ? ? US ? ? 2 'PLoS ONE' ? ? 1932-6203 ? ? 8 ? e71242 ? ;Crystal structures of human muscle fructose-1,6-bisphosphatase: novel quaternary states, enhanced AMP affinity, and allosteric signal transmission pathway. ; 2013 ? 10.1371/journal.pone.0071242 24086250 ? ? ? ? ? ? ? ? ? ? ? 3 'Acta Crystallogr D Struct Biol' ? ? 2059-7983 ? ? 72 ? 536 550 'T-to-R switch of muscle fructose-1,6-bisphosphatase involves fundamental changes of secondary and quaternary structure.' 2016 ? 10.1107/S2059798316001765 27050133 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barciszewski, J.' 1 ? primary 'Wisniewski, J.' 2 ? primary 'Kolodziejczyk, R.' 3 ? primary 'Dzugaj, A.' 4 ? primary 'Jaskolski, M.' 5 ? primary 'Rakus, D.' 6 ? 1 'Zarzycki, M.' 7 ? 1 'Kolodziejczyk, R.' 8 ? 1 'Maciaszczyk-Dziubinska, E.' 9 ? 1 'Wysocki, R.' 10 ? 1 'Jaskolski, M.' 11 ? 1 'Dzugaj, A.' 12 ? 2 'Shi, R.' 13 ? 2 'Chen, Z.Y.' 14 ? 2 'Zhu, D.W.' 15 ? 2 'Li, C.' 16 ? 2 'Shan, Y.' 17 ? 2 'Xu, G.' 18 ? 2 'Lin, S.X.' 19 ? 3 'Barciszewski, J.' 20 ? 3 'Wisniewski, J.' 21 ? 3 'Kolodziejczyk, R.' 22 ? 3 'Jaskolski, M.' 23 ? 3 'Rakus, D.' 24 ? 3 'Dzugaj, A.' 25 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fructose-1,6-bisphosphatase isozyme 2' 36666.895 1 3.1.3.11 ? ? ;V85L IS A NATURAL VARIANT OF FBP2 Gaps in the sequence indicate residues that were not modeled because of poor electron density ; 2 non-polymer man 1,6-di-O-phosphono-beta-D-fructofuranose 340.116 1 ? ? ? ? 3 water nat water 18.015 25 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FBPase 2,D-fructose-1,6-bisphosphate 1-phosphohydrolase 2,Muscle FBPase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSL VINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIV AAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPY GARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGS PEDVQEYLTCVQKNQAGS ; _entity_poly.pdbx_seq_one_letter_code_can ;TDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSL VINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIV AAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPY GARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGS PEDVQEYLTCVQKNQAGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,6-di-O-phosphono-beta-D-fructofuranose FBP 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ASP n 1 3 ARG n 1 4 SER n 1 5 PRO n 1 6 PHE n 1 7 GLU n 1 8 THR n 1 9 ASP n 1 10 MET n 1 11 LEU n 1 12 THR n 1 13 LEU n 1 14 THR n 1 15 ARG n 1 16 TYR n 1 17 VAL n 1 18 MET n 1 19 GLU n 1 20 LYS n 1 21 GLY n 1 22 ARG n 1 23 GLN n 1 24 ALA n 1 25 LYS n 1 26 GLY n 1 27 THR n 1 28 GLY n 1 29 GLU n 1 30 LEU n 1 31 THR n 1 32 GLN n 1 33 LEU n 1 34 LEU n 1 35 ASN n 1 36 SER n 1 37 MET n 1 38 LEU n 1 39 THR n 1 40 ALA n 1 41 ILE n 1 42 LYS n 1 43 ALA n 1 44 ILE n 1 45 SER n 1 46 SER n 1 47 ALA n 1 48 VAL n 1 49 ARG n 1 50 LYS n 1 51 ALA n 1 52 GLY n 1 53 LEU n 1 54 ALA n 1 55 HIS n 1 56 LEU n 1 57 TYR n 1 58 GLY n 1 59 ILE n 1 60 ALA n 1 61 GLY n 1 62 SER n 1 63 VAL n 1 64 ASN n 1 65 VAL n 1 66 THR n 1 67 GLY n 1 68 ASP n 1 69 GLU n 1 70 VAL n 1 71 LYS n 1 72 LYS n 1 73 LEU n 1 74 ASP n 1 75 VAL n 1 76 LEU n 1 77 SER n 1 78 ASN n 1 79 SER n 1 80 LEU n 1 81 VAL n 1 82 ILE n 1 83 ASN n 1 84 MET n 1 85 LEU n 1 86 GLN n 1 87 SER n 1 88 SER n 1 89 TYR n 1 90 SER n 1 91 THR n 1 92 CYS n 1 93 VAL n 1 94 LEU n 1 95 VAL n 1 96 SER n 1 97 GLU n 1 98 GLU n 1 99 ASN n 1 100 LYS n 1 101 ASP n 1 102 ALA n 1 103 ILE n 1 104 ILE n 1 105 THR n 1 106 ALA n 1 107 LYS n 1 108 GLU n 1 109 LYS n 1 110 ARG n 1 111 GLY n 1 112 LYS n 1 113 TYR n 1 114 VAL n 1 115 VAL n 1 116 CYS n 1 117 PHE n 1 118 ASP n 1 119 PRO n 1 120 LEU n 1 121 ASP n 1 122 GLY n 1 123 SER n 1 124 SER n 1 125 ASN n 1 126 ILE n 1 127 ASP n 1 128 CYS n 1 129 LEU n 1 130 ALA n 1 131 SER n 1 132 ILE n 1 133 GLY n 1 134 THR n 1 135 ILE n 1 136 PHE n 1 137 ALA n 1 138 ILE n 1 139 TYR n 1 140 ARG n 1 141 LYS n 1 142 THR n 1 143 SER n 1 144 GLU n 1 145 ASP n 1 146 GLU n 1 147 PRO n 1 148 SER n 1 149 GLU n 1 150 LYS n 1 151 ASP n 1 152 ALA n 1 153 LEU n 1 154 GLN n 1 155 CYS n 1 156 GLY n 1 157 ARG n 1 158 ASN n 1 159 ILE n 1 160 VAL n 1 161 ALA n 1 162 ALA n 1 163 GLY n 1 164 TYR n 1 165 ALA n 1 166 LEU n 1 167 TYR n 1 168 GLY n 1 169 SER n 1 170 ALA n 1 171 THR n 1 172 LEU n 1 173 VAL n 1 174 ALA n 1 175 LEU n 1 176 SER n 1 177 THR n 1 178 GLY n 1 179 GLN n 1 180 GLY n 1 181 VAL n 1 182 ASP n 1 183 LEU n 1 184 PHE n 1 185 MET n 1 186 LEU n 1 187 ASP n 1 188 PRO n 1 189 ALA n 1 190 LEU n 1 191 GLY n 1 192 GLU n 1 193 PHE n 1 194 VAL n 1 195 LEU n 1 196 VAL n 1 197 GLU n 1 198 LYS n 1 199 ASP n 1 200 VAL n 1 201 LYS n 1 202 ILE n 1 203 LYS n 1 204 LYS n 1 205 LYS n 1 206 GLY n 1 207 LYS n 1 208 ILE n 1 209 TYR n 1 210 SER n 1 211 LEU n 1 212 ASN n 1 213 GLU n 1 214 GLY n 1 215 TYR n 1 216 ALA n 1 217 LYS n 1 218 TYR n 1 219 PHE n 1 220 ASP n 1 221 ALA n 1 222 ALA n 1 223 THR n 1 224 THR n 1 225 GLU n 1 226 TYR n 1 227 VAL n 1 228 GLN n 1 229 LYS n 1 230 LYS n 1 231 LYS n 1 232 PHE n 1 233 PRO n 1 234 GLU n 1 235 ASP n 1 236 GLY n 1 237 SER n 1 238 ALA n 1 239 PRO n 1 240 TYR n 1 241 GLY n 1 242 ALA n 1 243 ARG n 1 244 TYR n 1 245 VAL n 1 246 GLY n 1 247 SER n 1 248 MET n 1 249 VAL n 1 250 ALA n 1 251 ASP n 1 252 VAL n 1 253 HIS n 1 254 ARG n 1 255 THR n 1 256 LEU n 1 257 VAL n 1 258 TYR n 1 259 GLY n 1 260 GLY n 1 261 ILE n 1 262 PHE n 1 263 LEU n 1 264 TYR n 1 265 PRO n 1 266 ALA n 1 267 ASN n 1 268 GLN n 1 269 LYS n 1 270 SER n 1 271 PRO n 1 272 LYS n 1 273 GLY n 1 274 LYS n 1 275 LEU n 1 276 ARG n 1 277 LEU n 1 278 LEU n 1 279 TYR n 1 280 GLU n 1 281 CYS n 1 282 ASN n 1 283 PRO n 1 284 VAL n 1 285 ALA n 1 286 TYR n 1 287 ILE n 1 288 ILE n 1 289 GLU n 1 290 GLN n 1 291 ALA n 1 292 GLY n 1 293 GLY n 1 294 LEU n 1 295 ALA n 1 296 THR n 1 297 THR n 1 298 GLY n 1 299 THR n 1 300 GLN n 1 301 PRO n 1 302 VAL n 1 303 LEU n 1 304 ASP n 1 305 VAL n 1 306 LYS n 1 307 PRO n 1 308 GLU n 1 309 ALA n 1 310 ILE n 1 311 HIS n 1 312 GLN n 1 313 ARG n 1 314 VAL n 1 315 PRO n 1 316 LEU n 1 317 ILE n 1 318 LEU n 1 319 GLY n 1 320 SER n 1 321 PRO n 1 322 GLU n 1 323 ASP n 1 324 VAL n 1 325 GLN n 1 326 GLU n 1 327 TYR n 1 328 LEU n 1 329 THR n 1 330 CYS n 1 331 VAL n 1 332 GLN n 1 333 LYS n 1 334 ASN n 1 335 GLN n 1 336 ALA n 1 337 GLY n 1 338 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 338 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FBP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue 'skeletal muscle' _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain C100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pKK223-3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FBP 'D-saccharide, beta linking' n 1,6-di-O-phosphono-beta-D-fructofuranose ;BETA-FRUCTOSE-1,6-DIPHOSPHATE; FRUCTOSE-1,6-BISPHOSPHATE; 1,6-di-O-phosphono-beta-D-fructose; 1,6-di-O-phosphono-D-fructose; 1,6-di-O-phosphono-fructose ; 'C6 H14 O12 P2' 340.116 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_chem_comp_identifier.comp_id FBP _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-D-Fruf1PO36PO3 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 PHE 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 TYR 16 16 ? ? ? A . n A 1 17 VAL 17 17 ? ? ? A . n A 1 18 MET 18 18 ? ? ? A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 LYS 20 20 ? ? ? A . n A 1 21 GLY 21 21 ? ? ? A . n A 1 22 ARG 22 22 ? ? ? A . n A 1 23 GLN 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 LYS 25 25 ? ? ? A . n A 1 26 GLY 26 26 ? ? ? A . n A 1 27 THR 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ARG 49 49 ? ? ? A . n A 1 50 LYS 50 50 ? ? ? A . n A 1 51 ALA 51 51 ? ? ? A . n A 1 52 GLY 52 52 ? ? ? A . n A 1 53 LEU 53 53 ? ? ? A . n A 1 54 ALA 54 54 ? ? ? A . n A 1 55 HIS 55 55 ? ? ? A . n A 1 56 LEU 56 56 ? ? ? A . n A 1 57 TYR 57 57 ? ? ? A . n A 1 58 GLY 58 58 ? ? ? A . n A 1 59 ILE 59 59 ? ? ? A . n A 1 60 ALA 60 60 ? ? ? A . n A 1 61 GLY 61 61 ? ? ? A . n A 1 62 SER 62 62 ? ? ? A . n A 1 63 VAL 63 63 ? ? ? A . n A 1 64 ASN 64 64 ? ? ? A . n A 1 65 VAL 65 65 ? ? ? A . n A 1 66 THR 66 66 ? ? ? A . n A 1 67 GLY 67 67 ? ? ? A . n A 1 68 ASP 68 68 ? ? ? A . n A 1 69 GLU 69 69 ? ? ? A . n A 1 70 VAL 70 70 ? ? ? A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 SER 123 123 ? ? ? A . n A 1 124 SER 124 124 ? ? ? A . n A 1 125 ASN 125 125 ? ? ? A . n A 1 126 ILE 126 126 ? ? ? A . n A 1 127 ASP 127 127 ? ? ? A . n A 1 128 CYS 128 128 ? ? ? A . n A 1 129 LEU 129 129 ? ? ? A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ARG 140 140 ? ? ? A . n A 1 141 LYS 141 141 ? ? ? A . n A 1 142 THR 142 142 ? ? ? A . n A 1 143 SER 143 143 ? ? ? A . n A 1 144 GLU 144 144 ? ? ? A . n A 1 145 ASP 145 145 ? ? ? A . n A 1 146 GLU 146 146 ? ? ? A . n A 1 147 PRO 147 147 ? ? ? A . n A 1 148 SER 148 148 ? ? ? A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 MET 185 185 185 MET MET A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 TYR 209 209 209 TYR TYR A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 ASN 212 212 212 ASN ASN A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 THR 223 223 223 THR THR A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 GLN 228 228 228 GLN GLN A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 PHE 232 232 232 PHE PHE A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 MET 248 248 248 MET MET A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 ASP 251 251 251 ASP ASP A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 HIS 253 253 253 HIS HIS A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 TYR 264 264 264 TYR TYR A . n A 1 265 PRO 265 265 265 PRO PRO A . n A 1 266 ALA 266 266 266 ALA ALA A . n A 1 267 ASN 267 267 267 ASN ASN A . n A 1 268 GLN 268 268 268 GLN GLN A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 PRO 271 271 271 PRO PRO A . n A 1 272 LYS 272 272 272 LYS LYS A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 ARG 276 276 276 ARG ARG A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 TYR 279 279 279 TYR TYR A . n A 1 280 GLU 280 280 280 GLU GLU A . n A 1 281 CYS 281 281 281 CYS CYS A . n A 1 282 ASN 282 282 282 ASN ASN A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 VAL 284 284 284 VAL VAL A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 TYR 286 286 286 TYR TYR A . n A 1 287 ILE 287 287 287 ILE ILE A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 GLN 290 290 290 GLN GLN A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 GLY 292 292 292 GLY GLY A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 ALA 295 295 295 ALA ALA A . n A 1 296 THR 296 296 296 THR THR A . n A 1 297 THR 297 297 297 THR THR A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 GLN 300 300 300 GLN GLN A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 VAL 302 302 302 VAL VAL A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 ASP 304 304 304 ASP ASP A . n A 1 305 VAL 305 305 305 VAL VAL A . n A 1 306 LYS 306 306 306 LYS LYS A . n A 1 307 PRO 307 307 307 PRO PRO A . n A 1 308 GLU 308 308 308 GLU GLU A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 HIS 311 311 311 HIS HIS A . n A 1 312 GLN 312 312 312 GLN GLN A . n A 1 313 ARG 313 313 313 ARG ARG A . n A 1 314 VAL 314 314 314 VAL VAL A . n A 1 315 PRO 315 315 315 PRO PRO A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 ILE 317 317 317 ILE ILE A . n A 1 318 LEU 318 318 318 LEU LEU A . n A 1 319 GLY 319 319 319 GLY GLY A . n A 1 320 SER 320 320 320 SER SER A . n A 1 321 PRO 321 321 321 PRO PRO A . n A 1 322 GLU 322 322 322 GLU GLU A . n A 1 323 ASP 323 323 323 ASP ASP A . n A 1 324 VAL 324 324 324 VAL VAL A . n A 1 325 GLN 325 325 325 GLN GLN A . n A 1 326 GLU 326 326 326 GLU GLU A . n A 1 327 TYR 327 327 327 TYR TYR A . n A 1 328 LEU 328 328 328 LEU LEU A . n A 1 329 THR 329 329 329 THR THR A . n A 1 330 CYS 330 330 330 CYS CYS A . n A 1 331 VAL 331 331 331 VAL VAL A . n A 1 332 GLN 332 332 332 GLN GLN A . n A 1 333 LYS 333 333 333 LYS LYS A . n A 1 334 ASN 334 334 334 ASN ASN A . n A 1 335 GLN 335 335 ? ? ? A . n A 1 336 ALA 336 336 ? ? ? A . n A 1 337 GLY 337 337 ? ? ? A . n A 1 338 SER 338 338 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FBP 1 401 1 FBP FBP A . C 3 HOH 1 501 32 HOH HOH A . C 3 HOH 2 502 23 HOH HOH A . C 3 HOH 3 503 31 HOH HOH A . C 3 HOH 4 504 1 HOH HOH A . C 3 HOH 5 505 11 HOH HOH A . C 3 HOH 6 506 33 HOH HOH A . C 3 HOH 7 507 18 HOH HOH A . C 3 HOH 8 508 25 HOH HOH A . C 3 HOH 9 509 19 HOH HOH A . C 3 HOH 10 510 6 HOH HOH A . C 3 HOH 11 511 14 HOH HOH A . C 3 HOH 12 512 30 HOH HOH A . C 3 HOH 13 513 21 HOH HOH A . C 3 HOH 14 514 27 HOH HOH A . C 3 HOH 15 515 2 HOH HOH A . C 3 HOH 16 516 5 HOH HOH A . C 3 HOH 17 517 7 HOH HOH A . C 3 HOH 18 518 4 HOH HOH A . C 3 HOH 19 519 16 HOH HOH A . C 3 HOH 20 520 9 HOH HOH A . C 3 HOH 21 521 12 HOH HOH A . C 3 HOH 22 522 26 HOH HOH A . C 3 HOH 23 523 17 HOH HOH A . C 3 HOH 24 524 15 HOH HOH A . C 3 HOH 25 525 13 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.entry_id 5K56 _cell.length_a 72.581 _cell.length_b 72.581 _cell.length_c 232.442 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5K56 _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5K56 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10mM magnesium chloride, 2M sodium chloride, 10% PEG6000, 10mM Tris' _exptl_crystal_grow.pdbx_pH_range 7.4 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX SX-165mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-01-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double crystal monochromator, Si-111 crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.89430 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.89430 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.3 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 47.51 _reflns.entry_id 5K56 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.198 _reflns.d_resolution_low 34.65 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16183 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.58 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.03 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.198 _reflns_shell.d_res_low 2.33 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.55 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 95.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.785 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.48 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5K56 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 16178 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 34.641 _refine.ls_d_res_high 2.198 _refine.ls_percent_reflns_obs 98.85 _refine.ls_R_factor_obs 0.2099 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2050 _refine.ls_R_factor_R_free 0.2798 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 6.44 _refine.ls_number_reflns_R_free 1042 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 5ET5 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.42 _refine.pdbx_overall_phase_error 33.41 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2105 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 2150 _refine_hist.d_res_high 2.198 _refine_hist.d_res_low 34.641 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 2160 'X-RAY DIFFRACTION' ? f_angle_d 1.138 ? ? 2925 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.553 ? ? 805 'X-RAY DIFFRACTION' ? f_chiral_restr 0.041 ? ? 345 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 363 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.1980 2.3139 2020 0.4831 95.00 0.5524 . . 139 . . . . 'X-RAY DIFFRACTION' . 2.3139 2.4588 2137 0.2791 100.00 0.3085 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.4588 2.6486 2146 0.2343 100.00 0.2946 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.6486 2.9150 2164 0.2148 100.00 0.2960 . . 149 . . . . 'X-RAY DIFFRACTION' . 2.9150 3.3365 2172 0.2118 100.00 0.2999 . . 150 . . . . 'X-RAY DIFFRACTION' . 3.3365 4.2025 2202 0.1751 100.00 0.2709 . . 151 . . . . 'X-RAY DIFFRACTION' . 4.2025 34.6453 2295 0.1661 98.00 0.2298 . . 159 . . . . # _struct.entry_id 5K56 _struct.title 'Human muscle fructose-1,6-bisphosphatase in active R-state in complex with fructose-1,6-bisphosphate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5K56 _struct_keywords.text 'Hydrolase, carbohydrate metabolism, glyconeogenesis, muscle izozyme, FBPase, R-state, Leucine lock, F16BP' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F16P2_HUMAN _struct_ref.pdbx_db_accession O00757 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSL VINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIV AAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPY GARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGS PEDVQEYLTCVQKNQAGS ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5K56 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 338 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00757 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 339 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 338 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5K56 _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 85 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O00757 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 86 _struct_ref_seq_dif.details variant _struct_ref_seq_dif.pdbx_auth_seq_num 85 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11090 ? 1 MORE -69 ? 1 'SSA (A^2)' 44050 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_445 -y-1,-x-1,-z 0.0000000000 -1.0000000000 0.0000000000 -72.5810000000 -1.0000000000 0.0000000000 0.0000000000 -72.5810000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_445 -x-1,-y-1,z -1.0000000000 0.0000000000 0.0000000000 -72.5810000000 0.0000000000 -1.0000000000 0.0000000000 -72.5810000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 30 ? VAL A 48 ? LEU A 30 VAL A 48 1 ? 19 HELX_P HELX_P2 AA2 LYS A 72 ? GLN A 86 ? LYS A 72 GLN A 86 1 ? 15 HELX_P HELX_P3 AA3 ALA A 106 ? GLU A 108 ? ALA A 106 GLU A 108 5 ? 3 HELX_P HELX_P4 AA4 GLU A 149 ? LEU A 153 ? GLU A 149 LEU A 153 5 ? 5 HELX_P HELX_P5 AA5 CYS A 155 ? ILE A 159 ? CYS A 155 ILE A 159 5 ? 5 HELX_P HELX_P6 AA6 ASN A 212 ? PHE A 219 ? ASN A 212 PHE A 219 5 ? 8 HELX_P HELX_P7 AA7 ASP A 220 ? PHE A 232 ? ASP A 220 PHE A 232 1 ? 13 HELX_P HELX_P8 AA8 SER A 247 ? GLY A 259 ? SER A 247 GLY A 259 1 ? 13 HELX_P HELX_P9 AA9 GLU A 280 ? ALA A 291 ? GLU A 280 ALA A 291 1 ? 12 HELX_P HELX_P10 AB1 PRO A 301 ? VAL A 305 ? PRO A 301 VAL A 305 5 ? 5 HELX_P HELX_P11 AB2 SER A 320 ? LYS A 333 ? SER A 320 LYS A 333 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 103 ? ILE A 104 ? ILE A 103 ILE A 104 AA1 2 THR A 91 ? SER A 96 ? THR A 91 SER A 96 AA1 3 ARG A 110 ? ASP A 121 ? ARG A 110 ASP A 121 AA1 4 ILE A 132 ? TYR A 139 ? ILE A 132 TYR A 139 AA1 5 ALA A 161 ? TYR A 167 ? ALA A 161 TYR A 167 AA1 6 THR A 171 ? SER A 176 ? THR A 171 SER A 176 AA1 7 ASP A 182 ? ASP A 187 ? ASP A 182 ASP A 187 AA1 8 GLU A 192 ? GLU A 197 ? GLU A 192 GLU A 197 AA2 1 GLY A 241 ? ALA A 242 ? GLY A 241 ALA A 242 AA2 2 ILE A 208 ? SER A 210 ? ILE A 208 SER A 210 AA2 3 ILE A 261 ? TYR A 264 ? ILE A 261 TYR A 264 AA2 4 LEU A 316 ? GLY A 319 ? LEU A 316 GLY A 319 AA2 5 LEU A 294 ? THR A 296 ? LEU A 294 THR A 296 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 103 ? O ILE A 103 N LEU A 94 ? N LEU A 94 AA1 2 3 N VAL A 95 ? N VAL A 95 O PHE A 117 ? O PHE A 117 AA1 3 4 N ASP A 121 ? N ASP A 121 O GLY A 133 ? O GLY A 133 AA1 4 5 N ILE A 138 ? N ILE A 138 O ALA A 161 ? O ALA A 161 AA1 5 6 N LEU A 166 ? N LEU A 166 O LEU A 172 ? O LEU A 172 AA1 6 7 N VAL A 173 ? N VAL A 173 O PHE A 184 ? O PHE A 184 AA1 7 8 N ASP A 187 ? N ASP A 187 O GLU A 192 ? O GLU A 192 AA2 1 2 O GLY A 241 ? O GLY A 241 N TYR A 209 ? N TYR A 209 AA2 2 3 N SER A 210 ? N SER A 210 O LEU A 263 ? O LEU A 263 AA2 3 4 N TYR A 264 ? N TYR A 264 O LEU A 316 ? O LEU A 316 AA2 4 5 O ILE A 317 ? O ILE A 317 N THR A 296 ? N THR A 296 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 153 ? ? -103.82 46.01 2 1 GLU A 280 ? ? -124.64 -65.01 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -24.6381 -41.6246 10.5520 0.5043 0.5567 0.7019 -0.1505 0.1271 0.0432 1.4064 5.8503 2.6793 1.9135 0.5578 3.4181 0.2096 -0.1439 -0.3037 0.4920 -0.1676 0.2662 0.3695 -0.3651 -0.0473 'X-RAY DIFFRACTION' 2 ? refined -29.3491 -28.5100 20.3471 0.6179 0.6756 0.6430 -0.1724 0.2896 -0.0886 8.5038 3.4078 4.0606 -4.2242 3.6295 -2.8637 -0.2218 -0.3324 -0.6429 1.7371 0.3259 1.1632 -0.3897 -0.7210 -0.0789 'X-RAY DIFFRACTION' 3 ? refined -17.9607 -31.9624 24.8699 0.8271 0.5266 0.4391 -0.1179 0.0801 0.0704 6.6600 3.8498 4.3154 0.4314 -0.0026 -0.8145 0.1779 -0.9926 -0.5795 1.1625 -0.1561 0.3071 0.6288 -0.0670 -0.0352 'X-RAY DIFFRACTION' 4 ? refined -19.2512 -37.3711 6.3718 0.3655 0.3740 0.4980 -0.1008 0.0281 -0.0257 1.6186 6.3395 3.4921 0.3617 -1.2026 -0.0642 -0.0598 0.0616 -0.8984 -0.0147 -0.0788 0.7468 0.3368 -0.4726 0.0856 'X-RAY DIFFRACTION' 5 ? refined -3.4475 -15.8324 1.4340 0.2670 0.3301 0.3480 -0.0082 0.0180 0.0183 3.3007 6.6311 2.0722 -0.0109 -0.2376 0.8550 -0.0192 -0.0361 0.0651 -0.1839 0.0609 -0.9738 -0.1816 0.2551 -0.0175 'X-RAY DIFFRACTION' 6 ? refined -9.6348 -18.6324 8.6976 0.3193 0.3327 0.2665 -0.0170 -0.0455 0.0749 6.2602 8.7487 1.1980 -0.5899 -1.4643 0.8476 0.2199 -0.2199 -0.2211 0.3783 -0.1841 -0.1941 -0.0254 -0.1468 0.0309 'X-RAY DIFFRACTION' 7 ? refined -3.3378 -23.0682 14.8564 0.3739 0.3322 0.3593 -0.0431 -0.1240 0.0144 3.0190 4.5041 4.4900 -0.0848 -0.9057 -0.1760 0.2075 -0.2596 -0.0831 0.7399 -0.1334 -0.6092 -0.0658 0.2307 -0.0830 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 9 through 48 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 71 through 86 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 87 through 160 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 161 through 197 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 198 through 247 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 248 through 274 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 275 through 334 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A PHE 6 ? A PHE 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A TYR 16 ? A TYR 16 10 1 Y 1 A VAL 17 ? A VAL 17 11 1 Y 1 A MET 18 ? A MET 18 12 1 Y 1 A GLU 19 ? A GLU 19 13 1 Y 1 A LYS 20 ? A LYS 20 14 1 Y 1 A GLY 21 ? A GLY 21 15 1 Y 1 A ARG 22 ? A ARG 22 16 1 Y 1 A GLN 23 ? A GLN 23 17 1 Y 1 A ALA 24 ? A ALA 24 18 1 Y 1 A LYS 25 ? A LYS 25 19 1 Y 1 A GLY 26 ? A GLY 26 20 1 Y 1 A THR 27 ? A THR 27 21 1 Y 1 A GLY 28 ? A GLY 28 22 1 Y 1 A ARG 49 ? A ARG 49 23 1 Y 1 A LYS 50 ? A LYS 50 24 1 Y 1 A ALA 51 ? A ALA 51 25 1 Y 1 A GLY 52 ? A GLY 52 26 1 Y 1 A LEU 53 ? A LEU 53 27 1 Y 1 A ALA 54 ? A ALA 54 28 1 Y 1 A HIS 55 ? A HIS 55 29 1 Y 1 A LEU 56 ? A LEU 56 30 1 Y 1 A TYR 57 ? A TYR 57 31 1 Y 1 A GLY 58 ? A GLY 58 32 1 Y 1 A ILE 59 ? A ILE 59 33 1 Y 1 A ALA 60 ? A ALA 60 34 1 Y 1 A GLY 61 ? A GLY 61 35 1 Y 1 A SER 62 ? A SER 62 36 1 Y 1 A VAL 63 ? A VAL 63 37 1 Y 1 A ASN 64 ? A ASN 64 38 1 Y 1 A VAL 65 ? A VAL 65 39 1 Y 1 A THR 66 ? A THR 66 40 1 Y 1 A GLY 67 ? A GLY 67 41 1 Y 1 A ASP 68 ? A ASP 68 42 1 Y 1 A GLU 69 ? A GLU 69 43 1 Y 1 A VAL 70 ? A VAL 70 44 1 Y 1 A SER 123 ? A SER 123 45 1 Y 1 A SER 124 ? A SER 124 46 1 Y 1 A ASN 125 ? A ASN 125 47 1 Y 1 A ILE 126 ? A ILE 126 48 1 Y 1 A ASP 127 ? A ASP 127 49 1 Y 1 A CYS 128 ? A CYS 128 50 1 Y 1 A LEU 129 ? A LEU 129 51 1 Y 1 A ARG 140 ? A ARG 140 52 1 Y 1 A LYS 141 ? A LYS 141 53 1 Y 1 A THR 142 ? A THR 142 54 1 Y 1 A SER 143 ? A SER 143 55 1 Y 1 A GLU 144 ? A GLU 144 56 1 Y 1 A ASP 145 ? A ASP 145 57 1 Y 1 A GLU 146 ? A GLU 146 58 1 Y 1 A PRO 147 ? A PRO 147 59 1 Y 1 A SER 148 ? A SER 148 60 1 Y 1 A GLN 335 ? A GLN 335 61 1 Y 1 A ALA 336 ? A ALA 336 62 1 Y 1 A GLY 337 ? A GLY 337 63 1 Y 1 A SER 338 ? A SER 338 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FBP P1 P N N 88 FBP O1P O N N 89 FBP O2P O N N 90 FBP O3P O N N 91 FBP O1 O N N 92 FBP C1 C N N 93 FBP C2 C N R 94 FBP O2 O N N 95 FBP C3 C N S 96 FBP O3 O N N 97 FBP C4 C N S 98 FBP O4 O N N 99 FBP C5 C N R 100 FBP O5 O N N 101 FBP C6 C N N 102 FBP O6 O N N 103 FBP P2 P N N 104 FBP O4P O N N 105 FBP O5P O N N 106 FBP O6P O N N 107 FBP HOP2 H N N 108 FBP HOP3 H N N 109 FBP H11 H N N 110 FBP H12 H N N 111 FBP HO2 H N N 112 FBP H3 H N N 113 FBP HO3 H N N 114 FBP H4 H N N 115 FBP HO4 H N N 116 FBP H5 H N N 117 FBP H61 H N N 118 FBP H62 H N N 119 FBP HOP5 H N N 120 FBP HOP6 H N N 121 GLN N N N N 122 GLN CA C N S 123 GLN C C N N 124 GLN O O N N 125 GLN CB C N N 126 GLN CG C N N 127 GLN CD C N N 128 GLN OE1 O N N 129 GLN NE2 N N N 130 GLN OXT O N N 131 GLN H H N N 132 GLN H2 H N N 133 GLN HA H N N 134 GLN HB2 H N N 135 GLN HB3 H N N 136 GLN HG2 H N N 137 GLN HG3 H N N 138 GLN HE21 H N N 139 GLN HE22 H N N 140 GLN HXT H N N 141 GLU N N N N 142 GLU CA C N S 143 GLU C C N N 144 GLU O O N N 145 GLU CB C N N 146 GLU CG C N N 147 GLU CD C N N 148 GLU OE1 O N N 149 GLU OE2 O N N 150 GLU OXT O N N 151 GLU H H N N 152 GLU H2 H N N 153 GLU HA H N N 154 GLU HB2 H N N 155 GLU HB3 H N N 156 GLU HG2 H N N 157 GLU HG3 H N N 158 GLU HE2 H N N 159 GLU HXT H N N 160 GLY N N N N 161 GLY CA C N N 162 GLY C C N N 163 GLY O O N N 164 GLY OXT O N N 165 GLY H H N N 166 GLY H2 H N N 167 GLY HA2 H N N 168 GLY HA3 H N N 169 GLY HXT H N N 170 HIS N N N N 171 HIS CA C N S 172 HIS C C N N 173 HIS O O N N 174 HIS CB C N N 175 HIS CG C Y N 176 HIS ND1 N Y N 177 HIS CD2 C Y N 178 HIS CE1 C Y N 179 HIS NE2 N Y N 180 HIS OXT O N N 181 HIS H H N N 182 HIS H2 H N N 183 HIS HA H N N 184 HIS HB2 H N N 185 HIS HB3 H N N 186 HIS HD1 H N N 187 HIS HD2 H N N 188 HIS HE1 H N N 189 HIS HE2 H N N 190 HIS HXT H N N 191 HOH O O N N 192 HOH H1 H N N 193 HOH H2 H N N 194 ILE N N N N 195 ILE CA C N S 196 ILE C C N N 197 ILE O O N N 198 ILE CB C N S 199 ILE CG1 C N N 200 ILE CG2 C N N 201 ILE CD1 C N N 202 ILE OXT O N N 203 ILE H H N N 204 ILE H2 H N N 205 ILE HA H N N 206 ILE HB H N N 207 ILE HG12 H N N 208 ILE HG13 H N N 209 ILE HG21 H N N 210 ILE HG22 H N N 211 ILE HG23 H N N 212 ILE HD11 H N N 213 ILE HD12 H N N 214 ILE HD13 H N N 215 ILE HXT H N N 216 LEU N N N N 217 LEU CA C N S 218 LEU C C N N 219 LEU O O N N 220 LEU CB C N N 221 LEU CG C N N 222 LEU CD1 C N N 223 LEU CD2 C N N 224 LEU OXT O N N 225 LEU H H N N 226 LEU H2 H N N 227 LEU HA H N N 228 LEU HB2 H N N 229 LEU HB3 H N N 230 LEU HG H N N 231 LEU HD11 H N N 232 LEU HD12 H N N 233 LEU HD13 H N N 234 LEU HD21 H N N 235 LEU HD22 H N N 236 LEU HD23 H N N 237 LEU HXT H N N 238 LYS N N N N 239 LYS CA C N S 240 LYS C C N N 241 LYS O O N N 242 LYS CB C N N 243 LYS CG C N N 244 LYS CD C N N 245 LYS CE C N N 246 LYS NZ N N N 247 LYS OXT O N N 248 LYS H H N N 249 LYS H2 H N N 250 LYS HA H N N 251 LYS HB2 H N N 252 LYS HB3 H N N 253 LYS HG2 H N N 254 LYS HG3 H N N 255 LYS HD2 H N N 256 LYS HD3 H N N 257 LYS HE2 H N N 258 LYS HE3 H N N 259 LYS HZ1 H N N 260 LYS HZ2 H N N 261 LYS HZ3 H N N 262 LYS HXT H N N 263 MET N N N N 264 MET CA C N S 265 MET C C N N 266 MET O O N N 267 MET CB C N N 268 MET CG C N N 269 MET SD S N N 270 MET CE C N N 271 MET OXT O N N 272 MET H H N N 273 MET H2 H N N 274 MET HA H N N 275 MET HB2 H N N 276 MET HB3 H N N 277 MET HG2 H N N 278 MET HG3 H N N 279 MET HE1 H N N 280 MET HE2 H N N 281 MET HE3 H N N 282 MET HXT H N N 283 PHE N N N N 284 PHE CA C N S 285 PHE C C N N 286 PHE O O N N 287 PHE CB C N N 288 PHE CG C Y N 289 PHE CD1 C Y N 290 PHE CD2 C Y N 291 PHE CE1 C Y N 292 PHE CE2 C Y N 293 PHE CZ C Y N 294 PHE OXT O N N 295 PHE H H N N 296 PHE H2 H N N 297 PHE HA H N N 298 PHE HB2 H N N 299 PHE HB3 H N N 300 PHE HD1 H N N 301 PHE HD2 H N N 302 PHE HE1 H N N 303 PHE HE2 H N N 304 PHE HZ H N N 305 PHE HXT H N N 306 PRO N N N N 307 PRO CA C N S 308 PRO C C N N 309 PRO O O N N 310 PRO CB C N N 311 PRO CG C N N 312 PRO CD C N N 313 PRO OXT O N N 314 PRO H H N N 315 PRO HA H N N 316 PRO HB2 H N N 317 PRO HB3 H N N 318 PRO HG2 H N N 319 PRO HG3 H N N 320 PRO HD2 H N N 321 PRO HD3 H N N 322 PRO HXT H N N 323 SER N N N N 324 SER CA C N S 325 SER C C N N 326 SER O O N N 327 SER CB C N N 328 SER OG O N N 329 SER OXT O N N 330 SER H H N N 331 SER H2 H N N 332 SER HA H N N 333 SER HB2 H N N 334 SER HB3 H N N 335 SER HG H N N 336 SER HXT H N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FBP P1 O1P doub N N 83 FBP P1 O2P sing N N 84 FBP P1 O3P sing N N 85 FBP P1 O1 sing N N 86 FBP O2P HOP2 sing N N 87 FBP O3P HOP3 sing N N 88 FBP O1 C1 sing N N 89 FBP C1 C2 sing N N 90 FBP C1 H11 sing N N 91 FBP C1 H12 sing N N 92 FBP C2 O2 sing N N 93 FBP C2 C3 sing N N 94 FBP C2 O5 sing N N 95 FBP O2 HO2 sing N N 96 FBP C3 O3 sing N N 97 FBP C3 C4 sing N N 98 FBP C3 H3 sing N N 99 FBP O3 HO3 sing N N 100 FBP C4 O4 sing N N 101 FBP C4 C5 sing N N 102 FBP C4 H4 sing N N 103 FBP O4 HO4 sing N N 104 FBP C5 O5 sing N N 105 FBP C5 C6 sing N N 106 FBP C5 H5 sing N N 107 FBP C6 O6 sing N N 108 FBP C6 H61 sing N N 109 FBP C6 H62 sing N N 110 FBP O6 P2 sing N N 111 FBP P2 O4P doub N N 112 FBP P2 O5P sing N N 113 FBP P2 O6P sing N N 114 FBP O5P HOP5 sing N N 115 FBP O6P HOP6 sing N N 116 GLN N CA sing N N 117 GLN N H sing N N 118 GLN N H2 sing N N 119 GLN CA C sing N N 120 GLN CA CB sing N N 121 GLN CA HA sing N N 122 GLN C O doub N N 123 GLN C OXT sing N N 124 GLN CB CG sing N N 125 GLN CB HB2 sing N N 126 GLN CB HB3 sing N N 127 GLN CG CD sing N N 128 GLN CG HG2 sing N N 129 GLN CG HG3 sing N N 130 GLN CD OE1 doub N N 131 GLN CD NE2 sing N N 132 GLN NE2 HE21 sing N N 133 GLN NE2 HE22 sing N N 134 GLN OXT HXT sing N N 135 GLU N CA sing N N 136 GLU N H sing N N 137 GLU N H2 sing N N 138 GLU CA C sing N N 139 GLU CA CB sing N N 140 GLU CA HA sing N N 141 GLU C O doub N N 142 GLU C OXT sing N N 143 GLU CB CG sing N N 144 GLU CB HB2 sing N N 145 GLU CB HB3 sing N N 146 GLU CG CD sing N N 147 GLU CG HG2 sing N N 148 GLU CG HG3 sing N N 149 GLU CD OE1 doub N N 150 GLU CD OE2 sing N N 151 GLU OE2 HE2 sing N N 152 GLU OXT HXT sing N N 153 GLY N CA sing N N 154 GLY N H sing N N 155 GLY N H2 sing N N 156 GLY CA C sing N N 157 GLY CA HA2 sing N N 158 GLY CA HA3 sing N N 159 GLY C O doub N N 160 GLY C OXT sing N N 161 GLY OXT HXT sing N N 162 HIS N CA sing N N 163 HIS N H sing N N 164 HIS N H2 sing N N 165 HIS CA C sing N N 166 HIS CA CB sing N N 167 HIS CA HA sing N N 168 HIS C O doub N N 169 HIS C OXT sing N N 170 HIS CB CG sing N N 171 HIS CB HB2 sing N N 172 HIS CB HB3 sing N N 173 HIS CG ND1 sing Y N 174 HIS CG CD2 doub Y N 175 HIS ND1 CE1 doub Y N 176 HIS ND1 HD1 sing N N 177 HIS CD2 NE2 sing Y N 178 HIS CD2 HD2 sing N N 179 HIS CE1 NE2 sing Y N 180 HIS CE1 HE1 sing N N 181 HIS NE2 HE2 sing N N 182 HIS OXT HXT sing N N 183 HOH O H1 sing N N 184 HOH O H2 sing N N 185 ILE N CA sing N N 186 ILE N H sing N N 187 ILE N H2 sing N N 188 ILE CA C sing N N 189 ILE CA CB sing N N 190 ILE CA HA sing N N 191 ILE C O doub N N 192 ILE C OXT sing N N 193 ILE CB CG1 sing N N 194 ILE CB CG2 sing N N 195 ILE CB HB sing N N 196 ILE CG1 CD1 sing N N 197 ILE CG1 HG12 sing N N 198 ILE CG1 HG13 sing N N 199 ILE CG2 HG21 sing N N 200 ILE CG2 HG22 sing N N 201 ILE CG2 HG23 sing N N 202 ILE CD1 HD11 sing N N 203 ILE CD1 HD12 sing N N 204 ILE CD1 HD13 sing N N 205 ILE OXT HXT sing N N 206 LEU N CA sing N N 207 LEU N H sing N N 208 LEU N H2 sing N N 209 LEU CA C sing N N 210 LEU CA CB sing N N 211 LEU CA HA sing N N 212 LEU C O doub N N 213 LEU C OXT sing N N 214 LEU CB CG sing N N 215 LEU CB HB2 sing N N 216 LEU CB HB3 sing N N 217 LEU CG CD1 sing N N 218 LEU CG CD2 sing N N 219 LEU CG HG sing N N 220 LEU CD1 HD11 sing N N 221 LEU CD1 HD12 sing N N 222 LEU CD1 HD13 sing N N 223 LEU CD2 HD21 sing N N 224 LEU CD2 HD22 sing N N 225 LEU CD2 HD23 sing N N 226 LEU OXT HXT sing N N 227 LYS N CA sing N N 228 LYS N H sing N N 229 LYS N H2 sing N N 230 LYS CA C sing N N 231 LYS CA CB sing N N 232 LYS CA HA sing N N 233 LYS C O doub N N 234 LYS C OXT sing N N 235 LYS CB CG sing N N 236 LYS CB HB2 sing N N 237 LYS CB HB3 sing N N 238 LYS CG CD sing N N 239 LYS CG HG2 sing N N 240 LYS CG HG3 sing N N 241 LYS CD CE sing N N 242 LYS CD HD2 sing N N 243 LYS CD HD3 sing N N 244 LYS CE NZ sing N N 245 LYS CE HE2 sing N N 246 LYS CE HE3 sing N N 247 LYS NZ HZ1 sing N N 248 LYS NZ HZ2 sing N N 249 LYS NZ HZ3 sing N N 250 LYS OXT HXT sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 PHE N CA sing N N 271 PHE N H sing N N 272 PHE N H2 sing N N 273 PHE CA C sing N N 274 PHE CA CB sing N N 275 PHE CA HA sing N N 276 PHE C O doub N N 277 PHE C OXT sing N N 278 PHE CB CG sing N N 279 PHE CB HB2 sing N N 280 PHE CB HB3 sing N N 281 PHE CG CD1 doub Y N 282 PHE CG CD2 sing Y N 283 PHE CD1 CE1 sing Y N 284 PHE CD1 HD1 sing N N 285 PHE CD2 CE2 doub Y N 286 PHE CD2 HD2 sing N N 287 PHE CE1 CZ doub Y N 288 PHE CE1 HE1 sing N N 289 PHE CE2 CZ sing Y N 290 PHE CE2 HE2 sing N N 291 PHE CZ HZ sing N N 292 PHE OXT HXT sing N N 293 PRO N CA sing N N 294 PRO N CD sing N N 295 PRO N H sing N N 296 PRO CA C sing N N 297 PRO CA CB sing N N 298 PRO CA HA sing N N 299 PRO C O doub N N 300 PRO C OXT sing N N 301 PRO CB CG sing N N 302 PRO CB HB2 sing N N 303 PRO CB HB3 sing N N 304 PRO CG CD sing N N 305 PRO CG HG2 sing N N 306 PRO CG HG3 sing N N 307 PRO CD HD2 sing N N 308 PRO CD HD3 sing N N 309 PRO OXT HXT sing N N 310 SER N CA sing N N 311 SER N H sing N N 312 SER N H2 sing N N 313 SER CA C sing N N 314 SER CA CB sing N N 315 SER CA HA sing N N 316 SER C O doub N N 317 SER C OXT sing N N 318 SER CB OG sing N N 319 SER CB HB2 sing N N 320 SER CB HB3 sing N N 321 SER OG HG sing N N 322 SER OXT HXT sing N N 323 THR N CA sing N N 324 THR N H sing N N 325 THR N H2 sing N N 326 THR CA C sing N N 327 THR CA CB sing N N 328 THR CA HA sing N N 329 THR C O doub N N 330 THR C OXT sing N N 331 THR CB OG1 sing N N 332 THR CB CG2 sing N N 333 THR CB HB sing N N 334 THR OG1 HG1 sing N N 335 THR CG2 HG21 sing N N 336 THR CG2 HG22 sing N N 337 THR CG2 HG23 sing N N 338 THR OXT HXT sing N N 339 TYR N CA sing N N 340 TYR N H sing N N 341 TYR N H2 sing N N 342 TYR CA C sing N N 343 TYR CA CB sing N N 344 TYR CA HA sing N N 345 TYR C O doub N N 346 TYR C OXT sing N N 347 TYR CB CG sing N N 348 TYR CB HB2 sing N N 349 TYR CB HB3 sing N N 350 TYR CG CD1 doub Y N 351 TYR CG CD2 sing Y N 352 TYR CD1 CE1 sing Y N 353 TYR CD1 HD1 sing N N 354 TYR CD2 CE2 doub Y N 355 TYR CD2 HD2 sing N N 356 TYR CE1 CZ doub Y N 357 TYR CE1 HE1 sing N N 358 TYR CE2 CZ sing Y N 359 TYR CE2 HE2 sing N N 360 TYR CZ OH sing N N 361 TYR OH HH sing N N 362 TYR OXT HXT sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # _pdbx_audit_support.funding_organization 'Polish National Science Centre' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number 2013/09/B/NZ1/01081 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5ET5 _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.18150/repod.7369446 _pdbx_related_exp_data_set.metadata_reference 10.18150/repod.7369446 _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _atom_sites.entry_id 5K56 _atom_sites.fract_transf_matrix[1][1] 0.013778 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013778 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004302 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_