data_5KI9 # _entry.id 5KI9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5KI9 WWPDB D_1000222275 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'human beta-defensin 1' 1ijv unspecified PDB 'human beta-defensin 2' 1fd3 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KI9 _pdbx_database_status.recvd_initial_deposition_date 2016-06-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jacek, L.' 1 'Adam, P.' 2 'Marzenam, P.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Human beta-Defensin 4: defensin without the "twist" ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Adam, P.' 1 primary 'Marzenam, P.' 2 primary 'Jerry, A.' 3 primary 'Jacek, L.' 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5KI9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.704 _cell.length_a_esd ? _cell.length_b 41.704 _cell.length_b_esd ? _cell.length_c 52.945 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KI9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Beta-defensin 104' 5257.094 1 ? ? 'UNP residues 23-65' 'LYSINE RESIDUES ARE DI-METHYLATED' 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn 'trifluoroacetic acid' 114.023 1 ? ? ? ? 4 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Beta-defensin 4,hBD-4,Defensin,beta 104' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'EFELDRICGYGTARCR(MLY)(MLY)CRSQEYRIGRCPNTYACCLR(MLY)WDES' _entity_poly.pdbx_seq_one_letter_code_can EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDES _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PHE n 1 3 GLU n 1 4 LEU n 1 5 ASP n 1 6 ARG n 1 7 ILE n 1 8 CYS n 1 9 GLY n 1 10 TYR n 1 11 GLY n 1 12 THR n 1 13 ALA n 1 14 ARG n 1 15 CYS n 1 16 ARG n 1 17 MLY n 1 18 MLY n 1 19 CYS n 1 20 ARG n 1 21 SER n 1 22 GLN n 1 23 GLU n 1 24 TYR n 1 25 ARG n 1 26 ILE n 1 27 GLY n 1 28 ARG n 1 29 CYS n 1 30 PRO n 1 31 ASN n 1 32 THR n 1 33 TYR n 1 34 ALA n 1 35 CYS n 1 36 CYS n 1 37 LEU n 1 38 ARG n 1 39 MLY n 1 40 TRP n 1 41 ASP n 1 42 GLU n 1 43 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 43 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DEFB104A, DEFB104, DEFB4, DEFB104B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D104A_HUMAN _struct_ref.pdbx_db_accession Q8WTQ1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDES _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KI9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WTQ1 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2' 174.241 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 TFA non-polymer . 'trifluoroacetic acid' ? 'C2 H F3 O2' 114.023 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KI9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25.5% PEG 8,000, 0.085 M sodium acetate buffer pH 4.5, 0.17 M Lithium Sulfate, 15% Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-10-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5KI9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.550 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6994 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.600 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 90.170 _reflns.pdbx_netI_over_sigmaI 16.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.697 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.060 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 116371 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.550 1.580 ? ? ? ? ? ? ? 8.000 ? ? ? ? 0.865 ? ? ? ? ? ? ? ? 7.300 ? ? ? ? ? ? ? 1 1 ? ? 1.580 1.610 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.703 ? ? ? ? ? ? ? ? 11.700 ? ? ? ? ? ? ? 2 1 ? ? 1.610 1.640 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.509 ? ? ? ? ? ? ? ? 12.400 ? ? ? ? ? ? ? 3 1 ? ? 1.640 1.670 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.426 ? ? ? ? ? ? ? ? 12.200 ? ? ? ? ? ? ? 4 1 ? ? 1.670 1.710 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.319 ? ? ? ? ? ? ? ? 12.600 ? ? ? ? ? ? ? 5 1 ? ? 1.710 1.750 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.274 ? ? ? ? ? ? ? ? 12.200 ? ? ? ? ? ? ? 6 1 ? ? 1.750 1.790 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.197 ? ? ? ? ? ? ? ? 12.500 ? ? ? ? ? ? ? 7 1 ? ? 1.790 1.840 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.150 ? ? ? ? ? ? ? ? 12.300 ? ? ? ? ? ? ? 8 1 ? ? 1.840 1.890 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 12.400 ? ? ? ? ? ? ? 9 1 ? ? 1.890 1.950 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 12.400 ? ? ? ? ? ? ? 10 1 ? ? 1.950 2.020 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 12.300 ? ? ? ? ? ? ? 11 1 ? ? 2.020 2.100 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 12.200 ? ? ? ? ? ? ? 12 1 ? ? 2.100 2.200 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.177 ? ? ? ? ? ? ? ? 16.600 ? ? ? ? ? ? ? 13 1 ? ? 2.200 2.320 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.200 ? ? ? ? ? ? ? ? 25.800 ? ? ? ? ? ? ? 14 1 ? ? 2.320 2.460 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 25.800 ? ? ? ? ? ? ? 15 1 ? ? 2.460 2.650 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 25.600 ? ? ? ? ? ? ? 16 1 ? ? 2.650 2.920 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 25.200 ? ? ? ? ? ? ? 17 1 ? ? 2.920 3.340 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 23.900 ? ? ? ? ? ? ? 18 1 ? ? 3.340 4.210 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 21.600 ? ? ? ? ? ? ? 19 1 ? ? 4.210 50.000 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 15.600 ? ? ? ? ? ? ? 20 1 ? ? # _refine.aniso_B[1][1] -0.4900 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.4900 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.9900 _refine.B_iso_max 170.240 _refine.B_iso_mean 51.1730 _refine.B_iso_min 30.090 _refine.correlation_coeff_Fo_to_Fc 0.9560 _refine.correlation_coeff_Fo_to_Fc_free 0.9310 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5KI9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6000 _refine.ls_d_res_low 15.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5916 _refine.ls_number_reflns_R_free 645 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.0000 _refine.ls_percent_reflns_R_free 9.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2336 _refine.ls_R_factor_R_free 0.2678 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2300 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1590 _refine.pdbx_overall_ESU_R_Free 0.1150 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.6580 _refine.overall_SU_ML 0.0870 _refine.overall_SU_R_Cruickshank_DPI 0.1588 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.6000 _refine_hist.d_res_low 15.0000 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 401 _refine_hist.pdbx_number_residues_total 43 _refine_hist.pdbx_B_iso_mean_ligand 56.03 _refine_hist.pdbx_B_iso_mean_solvent 74.82 _refine_hist.pdbx_number_atoms_protein 363 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 0.021 389 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 2.050 2.047 523 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 7.294 5.000 42 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.161 20.500 20 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.258 15.000 57 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.028 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.129 0.200 46 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 292 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 2.880 1.500 214 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.964 2.000 341 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.452 3.000 175 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 8.514 4.500 182 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 2.926 3.000 389 ? r_rigid_bond_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.6000 _refine_ls_shell.d_res_low 1.6410 _refine_ls_shell.number_reflns_all 462 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 46 _refine_ls_shell.number_reflns_R_work 416 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3470 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2900 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5KI9 _struct.title 'Crystal structure of human beta-defensin 4 (HBD4)' _struct.pdbx_descriptor 'Beta-defensin 104' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KI9 _struct_keywords.text 'DEFENSIN, ANTIMICROBIAL, CHEMOTACTIC, DIMERIZATION, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details 'author states the biological assembly is unknown' # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 8 A CYS 35 1_555 ? ? ? ? ? ? ? 2.076 ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 15 A CYS 29 1_555 ? ? ? ? ? ? ? 2.016 ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 19 A CYS 36 1_555 ? ? ? ? ? ? ? 2.092 ? covale1 covale both ? A ARG 16 C ? ? ? 1_555 A MLY 17 N ? ? A ARG 16 A MLY 17 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale both ? A MLY 17 C ? ? ? 1_555 A MLY 18 N ? ? A MLY 17 A MLY 18 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale both ? A MLY 18 C ? ? ? 1_555 A CYS 19 N ? ? A MLY 18 A CYS 19 1_555 ? ? ? ? ? ? ? 1.324 ? covale4 covale both ? A ARG 38 C ? ? ? 1_555 A MLY 39 N ? ? A ARG 38 A MLY 39 1_555 ? ? ? ? ? ? ? 1.327 ? covale5 covale both ? A MLY 39 C ? ? ? 1_555 A TRP 40 N ? ? A MLY 39 A TRP 40 1_555 ? ? ? ? ? ? ? 1.322 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 7 ? CYS A 8 ? ILE A 7 CYS A 8 AA1 2 ALA A 13 ? ARG A 16 ? ALA A 13 ARG A 16 AA1 3 ALA A 34 ? ARG A 38 ? ALA A 34 ARG A 38 AA1 4 GLU A 23 ? ARG A 28 ? GLU A 23 ARG A 28 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 8 ? N CYS A 8 O ALA A 13 ? O ALA A 13 AA1 2 3 N ARG A 14 ? N ARG A 14 O CYS A 36 ? O CYS A 36 AA1 3 4 O LEU A 37 ? O LEU A 37 N TYR A 24 ? N TYR A 24 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 101 ? 3 'binding site for residue SO4 A 101' AC2 Software A SO4 102 ? 4 'binding site for residue SO4 A 102' AC3 Software A SO4 103 ? 3 'binding site for residue SO4 A 103' AC4 Software A TFA 104 ? 6 'binding site for residue TFA A 104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLU A 1 ? GLU A 1 . ? 3_554 ? 2 AC1 3 TYR A 24 ? TYR A 24 . ? 1_555 ? 3 AC1 3 ARG A 25 ? ARG A 25 . ? 1_555 ? 4 AC2 4 ARG A 20 ? ARG A 20 . ? 7_556 ? 5 AC2 4 ARG A 20 ? ARG A 20 . ? 1_555 ? 6 AC2 4 SER A 21 ? SER A 21 . ? 1_555 ? 7 AC2 4 SER A 21 ? SER A 21 . ? 7_556 ? 8 AC3 3 MLY A 17 ? MLY A 17 . ? 7_556 ? 9 AC3 3 ARG A 38 ? ARG A 38 . ? 1_555 ? 10 AC3 3 SER A 43 ? SER A 43 . ? 1_555 ? 11 AC4 6 ARG A 14 ? ARG A 14 . ? 1_555 ? 12 AC4 6 ARG A 16 ? ARG A 16 . ? 7_556 ? 13 AC4 6 ARG A 16 ? ARG A 16 . ? 1_555 ? 14 AC4 6 MLY A 17 ? MLY A 17 . ? 7_556 ? 15 AC4 6 MLY A 18 ? MLY A 18 . ? 7_556 ? 16 AC4 6 ARG A 20 ? ARG A 20 . ? 1_555 ? # _atom_sites.entry_id 5KI9 _atom_sites.fract_transf_matrix[1][1] 0.023979 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023979 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018888 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 MLY 17 17 17 MLY MLY A . n A 1 18 MLY 18 18 18 MLY MLY A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 MLY 39 39 39 MLY MLY A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 SER 43 43 43 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 101 1 SO4 SO4 A . C 2 SO4 1 102 2 SO4 SO4 A . D 2 SO4 1 103 3 SO4 SO4 A . E 3 TFA 1 104 1 TFA TFA A . F 4 HOH 1 201 12 HOH HOH A . F 4 HOH 2 202 14 HOH HOH A . F 4 HOH 3 203 8 HOH HOH A . F 4 HOH 4 204 1 HOH HOH A . F 4 HOH 5 205 5 HOH HOH A . F 4 HOH 6 206 2 HOH HOH A . F 4 HOH 7 207 15 HOH HOH A . F 4 HOH 8 208 4 HOH HOH A . F 4 HOH 9 209 6 HOH HOH A . F 4 HOH 10 210 9 HOH HOH A . F 4 HOH 11 211 10 HOH HOH A . F 4 HOH 12 212 7 HOH HOH A . F 4 HOH 13 213 11 HOH HOH A . F 4 HOH 14 214 13 HOH HOH A . F 4 HOH 15 215 3 HOH HOH A . F 4 HOH 16 216 16 HOH HOH A . F 4 HOH 17 217 17 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MLY 17 A MLY 17 ? LYS 'modified residue' 2 A MLY 18 A MLY 18 ? LYS 'modified residue' 3 A MLY 39 A MLY 39 ? LYS 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3070 ? 1 MORE -92 ? 1 'SSA (A^2)' 6290 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 52.9450000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2017-06-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _phasing.method MAD # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELX ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.5.0104 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 8 ? ? -105.69 -165.08 2 1 GLN A 22 ? ? -99.24 34.80 3 1 THR A 32 ? ? 112.47 -26.91 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id TFA _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 104 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OXT _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id E _pdbx_unobs_or_zero_occ_atoms.label_comp_id TFA _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OXT # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'trifluoroacetic acid' TFA 4 water HOH #