data_5KIU # _entry.id 5KIU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5KIU pdb_00005kiu 10.2210/pdb5kiu/pdb WWPDB D_1000222314 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KIU _pdbx_database_status.recvd_initial_deposition_date 2016-06-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tang, W.K.' 1 'Xia, D.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Discov' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2056-5968 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 3 _citation.language ? _citation.page_first 17045 _citation.page_last 17045 _citation.title 'Structural basis for nucleotide-modulated p97 association with the ER membrane.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/celldisc.2017.45 _citation.pdbx_database_id_PubMed 29238611 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tang, W.K.' 1 ? primary 'Zhang, T.' 2 ? primary 'Ye, Y.' 3 ? primary 'Xia, D.' 4 ? # _cell.entry_id 5KIU _cell.length_a 121.729 _cell.length_b 17.973 _cell.length_c 33.993 _cell.angle_alpha 90.00 _cell.angle_beta 95.58 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KIU _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Selenoprotein S' 9729.287 1 ? ? ? ? 2 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SelS,VCP-interacting membrane protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS M ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS M ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLN n 1 9 LYS n 1 10 LEU n 1 11 SER n 1 12 ALA n 1 13 ARG n 1 14 LEU n 1 15 ARG n 1 16 ALA n 1 17 LEU n 1 18 ARG n 1 19 GLN n 1 20 ARG n 1 21 GLN n 1 22 LEU n 1 23 ASP n 1 24 ARG n 1 25 ALA n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 VAL n 1 30 GLU n 1 31 PRO n 1 32 ASP n 1 33 VAL n 1 34 VAL n 1 35 VAL n 1 36 LYS n 1 37 ARG n 1 38 GLN n 1 39 GLU n 1 40 ALA n 1 41 LEU n 1 42 ALA n 1 43 ALA n 1 44 ALA n 1 45 ARG n 1 46 LEU n 1 47 LYS n 1 48 MET n 1 49 GLN n 1 50 GLU n 1 51 GLU n 1 52 LEU n 1 53 ASN n 1 54 ALA n 1 55 GLN n 1 56 VAL n 1 57 GLU n 1 58 LYS n 1 59 HIS n 1 60 LYS n 1 61 GLU n 1 62 LYS n 1 63 LEU n 1 64 LYS n 1 65 GLN n 1 66 LEU n 1 67 GLU n 1 68 GLU n 1 69 GLU n 1 70 LYS n 1 71 ARG n 1 72 ARG n 1 73 GLN n 1 74 LYS n 1 75 ILE n 1 76 GLU n 1 77 MET n 1 78 TRP n 1 79 ASP n 1 80 SER n 1 81 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'VIMP, SELS, AD-015, SBBI8' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name Bacteria _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 2 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SELS_HUMAN _struct_ref.pdbx_db_accession Q9BQE4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSM _struct_ref.pdbx_align_begin 49 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KIU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BQE4 _struct_ref_seq.db_align_beg 49 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 122 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 49 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KIU MET A 1 ? UNP Q9BQE4 ? ? 'expression tag' 42 1 1 5KIU HIS A 2 ? UNP Q9BQE4 ? ? 'expression tag' 43 2 1 5KIU HIS A 3 ? UNP Q9BQE4 ? ? 'expression tag' 44 3 1 5KIU HIS A 4 ? UNP Q9BQE4 ? ? 'expression tag' 45 4 1 5KIU HIS A 5 ? UNP Q9BQE4 ? ? 'expression tag' 46 5 1 5KIU HIS A 6 ? UNP Q9BQE4 ? ? 'expression tag' 47 6 1 5KIU HIS A 7 ? UNP Q9BQE4 ? ? 'expression tag' 48 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KIU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 35.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 288 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES, pH 6.0, 20 % 2-propanol, 20 % PEG MME 2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-08-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5KIU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 60.58 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3854 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.28 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.286 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5KIU _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 3681 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 60.58 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 97.15 _refine.ls_R_factor_obs 0.18850 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18576 _refine.ls_R_factor_R_free 0.24434 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 173 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.944 _refine.B_iso_mean 48.188 _refine.aniso_B[1][1] 0.04 _refine.aniso_B[2][2] -1.55 _refine.aniso_B[3][3] 0.90 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 3.07 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 2Q2F _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.323 _refine.pdbx_overall_ESU_R_Free 0.231 _refine.overall_SU_ML 0.207 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 17.438 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 631 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 648 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 60.58 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.019 ? 636 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 664 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.943 1.964 ? 845 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.059 3.000 ? 1520 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.535 5.000 ? 75 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 38.193 23.714 ? 35 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.532 15.000 ? 143 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 19.862 15.000 ? 9 'X-RAY DIFFRACTION' ? r_chiral_restr 0.127 0.200 ? 91 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.009 0.020 ? 705 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 146 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.114 3.388 ? 303 'X-RAY DIFFRACTION' ? r_mcbond_other 2.036 3.367 ? 302 'X-RAY DIFFRACTION' ? r_mcangle_it 3.221 5.041 ? 377 'X-RAY DIFFRACTION' ? r_mcangle_other 3.221 5.064 ? 378 'X-RAY DIFFRACTION' ? r_scbond_it 3.776 4.301 ? 333 'X-RAY DIFFRACTION' ? r_scbond_other 3.771 4.317 ? 334 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 6.245 6.178 ? 469 'X-RAY DIFFRACTION' ? r_long_range_B_refined 7.991 26.768 ? 720 'X-RAY DIFFRACTION' ? r_long_range_B_other 8.092 26.745 ? 716 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.202 _refine_ls_shell.d_res_low 2.259 _refine_ls_shell.number_reflns_R_work 251 _refine_ls_shell.R_factor_R_work 0.262 _refine_ls_shell.percent_reflns_obs 87.50 _refine_ls_shell.R_factor_R_free 0.306 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 15 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5KIU _struct.title 'VCP-interacting membrane protein (VIMP)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KIU _struct_keywords.text 'p97 adaptor protein, VCP-interacting membrane protein, VIMP, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 6 ? ALA A 28 ? HIS A 47 ALA A 69 1 ? 23 HELX_P HELX_P2 AA2 GLU A 30 ? ASP A 79 ? GLU A 71 ASP A 120 1 ? 50 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5KIU _atom_sites.fract_transf_matrix[1][1] 0.008215 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000803 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.055639 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029558 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 42 ? ? ? A . n A 1 2 HIS 2 43 ? ? ? A . n A 1 3 HIS 3 44 ? ? ? A . n A 1 4 HIS 4 45 ? ? ? A . n A 1 5 HIS 5 46 ? ? ? A . n A 1 6 HIS 6 47 47 HIS HIS A . n A 1 7 HIS 7 48 48 HIS HIS A . n A 1 8 GLN 8 49 49 GLN GLN A . n A 1 9 LYS 9 50 50 LYS LYS A . n A 1 10 LEU 10 51 51 LEU LEU A . n A 1 11 SER 11 52 52 SER SER A . n A 1 12 ALA 12 53 53 ALA ALA A . n A 1 13 ARG 13 54 54 ARG ARG A . n A 1 14 LEU 14 55 55 LEU LEU A . n A 1 15 ARG 15 56 56 ARG ARG A . n A 1 16 ALA 16 57 57 ALA ALA A . n A 1 17 LEU 17 58 58 LEU LEU A . n A 1 18 ARG 18 59 59 ARG ARG A . n A 1 19 GLN 19 60 60 GLN GLN A . n A 1 20 ARG 20 61 61 ARG ARG A . n A 1 21 GLN 21 62 62 GLN GLN A . n A 1 22 LEU 22 63 63 LEU LEU A . n A 1 23 ASP 23 64 64 ASP ASP A . n A 1 24 ARG 24 65 65 ARG ARG A . n A 1 25 ALA 25 66 66 ALA ALA A . n A 1 26 ALA 26 67 67 ALA ALA A . n A 1 27 ALA 27 68 68 ALA ALA A . n A 1 28 ALA 28 69 69 ALA ALA A . n A 1 29 VAL 29 70 70 VAL VAL A . n A 1 30 GLU 30 71 71 GLU GLU A . n A 1 31 PRO 31 72 72 PRO PRO A . n A 1 32 ASP 32 73 73 ASP ASP A . n A 1 33 VAL 33 74 74 VAL VAL A . n A 1 34 VAL 34 75 75 VAL VAL A . n A 1 35 VAL 35 76 76 VAL VAL A . n A 1 36 LYS 36 77 77 LYS LYS A . n A 1 37 ARG 37 78 78 ARG ARG A . n A 1 38 GLN 38 79 79 GLN GLN A . n A 1 39 GLU 39 80 80 GLU GLU A . n A 1 40 ALA 40 81 81 ALA ALA A . n A 1 41 LEU 41 82 82 LEU LEU A . n A 1 42 ALA 42 83 83 ALA ALA A . n A 1 43 ALA 43 84 84 ALA ALA A . n A 1 44 ALA 44 85 85 ALA ALA A . n A 1 45 ARG 45 86 86 ARG ARG A . n A 1 46 LEU 46 87 87 LEU LEU A . n A 1 47 LYS 47 88 88 LYS LYS A . n A 1 48 MET 48 89 89 MET MET A . n A 1 49 GLN 49 90 90 GLN GLN A . n A 1 50 GLU 50 91 91 GLU GLU A . n A 1 51 GLU 51 92 92 GLU GLU A . n A 1 52 LEU 52 93 93 LEU LEU A . n A 1 53 ASN 53 94 94 ASN ASN A . n A 1 54 ALA 54 95 95 ALA ALA A . n A 1 55 GLN 55 96 96 GLN GLN A . n A 1 56 VAL 56 97 97 VAL VAL A . n A 1 57 GLU 57 98 98 GLU GLU A . n A 1 58 LYS 58 99 99 LYS LYS A . n A 1 59 HIS 59 100 100 HIS HIS A . n A 1 60 LYS 60 101 101 LYS LYS A . n A 1 61 GLU 61 102 102 GLU GLU A . n A 1 62 LYS 62 103 103 LYS LYS A . n A 1 63 LEU 63 104 104 LEU LEU A . n A 1 64 LYS 64 105 105 LYS LYS A . n A 1 65 GLN 65 106 106 GLN GLN A . n A 1 66 LEU 66 107 107 LEU LEU A . n A 1 67 GLU 67 108 108 GLU GLU A . n A 1 68 GLU 68 109 109 GLU GLU A . n A 1 69 GLU 69 110 110 GLU GLU A . n A 1 70 LYS 70 111 111 LYS LYS A . n A 1 71 ARG 71 112 112 ARG ARG A . n A 1 72 ARG 72 113 113 ARG ARG A . n A 1 73 GLN 73 114 114 GLN GLN A . n A 1 74 LYS 74 115 115 LYS LYS A . n A 1 75 ILE 75 116 116 ILE ILE A . n A 1 76 GLU 76 117 117 GLU GLU A . n A 1 77 MET 77 118 118 MET MET A . n A 1 78 TRP 78 119 119 TRP TRP A . n A 1 79 ASP 79 120 120 ASP ASP A . n A 1 80 SER 80 121 121 SER SER A . n A 1 81 MET 81 122 122 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 12 HOH HOH A . B 2 HOH 2 202 9 HOH HOH A . B 2 HOH 3 203 22 HOH HOH A . B 2 HOH 4 204 1 HOH HOH A . B 2 HOH 5 205 14 HOH HOH A . B 2 HOH 6 206 25 HOH HOH A . B 2 HOH 7 207 7 HOH HOH A . B 2 HOH 8 208 5 HOH HOH A . B 2 HOH 9 209 6 HOH HOH A . B 2 HOH 10 210 3 HOH HOH A . B 2 HOH 11 211 8 HOH HOH A . B 2 HOH 12 212 11 HOH HOH A . B 2 HOH 13 213 15 HOH HOH A . B 2 HOH 14 214 4 HOH HOH A . B 2 HOH 15 215 19 HOH HOH A . B 2 HOH 16 216 21 HOH HOH A . B 2 HOH 17 217 13 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-27 2 'Structure model' 1 1 2018-01-10 3 'Structure model' 1 2 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 33.6162 14.6151 47.3202 0.0792 0.0385 0.0858 0.0190 -0.0306 0.0215 2.9902 7.4322 3.0293 3.0446 -2.1657 -2.6032 0.0146 0.1908 -0.0110 -0.1688 -0.0491 -0.3506 -0.0588 -0.0223 0.0345 'X-RAY DIFFRACTION' 2 ? refined 27.0728 -3.3337 60.5088 0.1056 0.1240 0.0282 -0.0024 -0.0234 0.0086 2.6093 4.1740 6.0995 2.2754 -3.7124 -1.9199 -0.1659 -0.1096 -0.0625 -0.1419 0.0048 0.0831 0.2510 0.2649 0.1611 'X-RAY DIFFRACTION' 3 ? refined 16.0729 -7.5807 72.1795 0.1077 0.1207 0.0388 0.0748 -0.0163 0.0268 12.0930 5.0805 10.9114 0.8513 -8.5955 4.3001 0.3654 0.2803 0.2757 -0.2836 -0.1237 -0.0299 -0.5695 -0.3806 -0.2417 'X-RAY DIFFRACTION' 4 ? refined 3.8399 -9.6466 81.4468 0.0582 0.1190 0.0660 0.0429 0.0483 -0.0062 11.6599 3.0199 5.6124 2.4606 -6.1303 -3.4780 0.0386 0.1453 -0.2616 0.0060 -0.0616 -0.0645 -0.1827 -0.1503 0.0231 'X-RAY DIFFRACTION' 5 ? refined -8.6474 -11.8928 90.1334 0.0013 0.0997 0.0085 -0.0036 0.0013 0.0166 13.6709 0.4553 9.1233 1.4516 -9.1589 -0.0245 0.0905 -0.3777 -0.0816 0.0029 -0.0556 -0.0364 -0.0813 0.1866 -0.0349 'X-RAY DIFFRACTION' 6 ? refined -22.9618 -15.1459 99.0035 0.0174 0.0766 0.0540 -0.0145 0.0063 0.0336 16.2662 1.8885 7.9731 2.3443 -2.7500 -3.8081 -0.1735 -0.1985 -0.4447 0.0807 -0.0425 -0.1310 -0.2028 0.0556 0.2160 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 47 ? ? A 62 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 63 ? ? A 77 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 78 ? ? A 88 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 89 ? ? A 98 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 99 ? ? A 109 ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 110 ? ? A 121 ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 TRP _pdbx_validate_rmsd_bond.auth_seq_id_1 119 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 TRP _pdbx_validate_rmsd_bond.auth_seq_id_2 119 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.387 _pdbx_validate_rmsd_bond.bond_target_value 1.498 _pdbx_validate_rmsd_bond.bond_deviation -0.111 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.018 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 86 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 86 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 86 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.35 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.05 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 42 ? A MET 1 2 1 Y 1 A HIS 43 ? A HIS 2 3 1 Y 1 A HIS 44 ? A HIS 3 4 1 Y 1 A HIS 45 ? A HIS 4 5 1 Y 1 A HIS 46 ? A HIS 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 HIS N N N N 113 HIS CA C N S 114 HIS C C N N 115 HIS O O N N 116 HIS CB C N N 117 HIS CG C Y N 118 HIS ND1 N Y N 119 HIS CD2 C Y N 120 HIS CE1 C Y N 121 HIS NE2 N Y N 122 HIS OXT O N N 123 HIS H H N N 124 HIS H2 H N N 125 HIS HA H N N 126 HIS HB2 H N N 127 HIS HB3 H N N 128 HIS HD1 H N N 129 HIS HD2 H N N 130 HIS HE1 H N N 131 HIS HE2 H N N 132 HIS HXT H N N 133 HOH O O N N 134 HOH H1 H N N 135 HOH H2 H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PRO N N N N 226 PRO CA C N S 227 PRO C C N N 228 PRO O O N N 229 PRO CB C N N 230 PRO CG C N N 231 PRO CD C N N 232 PRO OXT O N N 233 PRO H H N N 234 PRO HA H N N 235 PRO HB2 H N N 236 PRO HB3 H N N 237 PRO HG2 H N N 238 PRO HG3 H N N 239 PRO HD2 H N N 240 PRO HD3 H N N 241 PRO HXT H N N 242 SER N N N N 243 SER CA C N S 244 SER C C N N 245 SER O O N N 246 SER CB C N N 247 SER OG O N N 248 SER OXT O N N 249 SER H H N N 250 SER H2 H N N 251 SER HA H N N 252 SER HB2 H N N 253 SER HB3 H N N 254 SER HG H N N 255 SER HXT H N N 256 TRP N N N N 257 TRP CA C N S 258 TRP C C N N 259 TRP O O N N 260 TRP CB C N N 261 TRP CG C Y N 262 TRP CD1 C Y N 263 TRP CD2 C Y N 264 TRP NE1 N Y N 265 TRP CE2 C Y N 266 TRP CE3 C Y N 267 TRP CZ2 C Y N 268 TRP CZ3 C Y N 269 TRP CH2 C Y N 270 TRP OXT O N N 271 TRP H H N N 272 TRP H2 H N N 273 TRP HA H N N 274 TRP HB2 H N N 275 TRP HB3 H N N 276 TRP HD1 H N N 277 TRP HE1 H N N 278 TRP HE3 H N N 279 TRP HZ2 H N N 280 TRP HZ3 H N N 281 TRP HH2 H N N 282 TRP HXT H N N 283 VAL N N N N 284 VAL CA C N S 285 VAL C C N N 286 VAL O O N N 287 VAL CB C N N 288 VAL CG1 C N N 289 VAL CG2 C N N 290 VAL OXT O N N 291 VAL H H N N 292 VAL H2 H N N 293 VAL HA H N N 294 VAL HB H N N 295 VAL HG11 H N N 296 VAL HG12 H N N 297 VAL HG13 H N N 298 VAL HG21 H N N 299 VAL HG22 H N N 300 VAL HG23 H N N 301 VAL HXT H N N 302 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 HOH O H1 sing N N 128 HOH O H2 sing N N 129 ILE N CA sing N N 130 ILE N H sing N N 131 ILE N H2 sing N N 132 ILE CA C sing N N 133 ILE CA CB sing N N 134 ILE CA HA sing N N 135 ILE C O doub N N 136 ILE C OXT sing N N 137 ILE CB CG1 sing N N 138 ILE CB CG2 sing N N 139 ILE CB HB sing N N 140 ILE CG1 CD1 sing N N 141 ILE CG1 HG12 sing N N 142 ILE CG1 HG13 sing N N 143 ILE CG2 HG21 sing N N 144 ILE CG2 HG22 sing N N 145 ILE CG2 HG23 sing N N 146 ILE CD1 HD11 sing N N 147 ILE CD1 HD12 sing N N 148 ILE CD1 HD13 sing N N 149 ILE OXT HXT sing N N 150 LEU N CA sing N N 151 LEU N H sing N N 152 LEU N H2 sing N N 153 LEU CA C sing N N 154 LEU CA CB sing N N 155 LEU CA HA sing N N 156 LEU C O doub N N 157 LEU C OXT sing N N 158 LEU CB CG sing N N 159 LEU CB HB2 sing N N 160 LEU CB HB3 sing N N 161 LEU CG CD1 sing N N 162 LEU CG CD2 sing N N 163 LEU CG HG sing N N 164 LEU CD1 HD11 sing N N 165 LEU CD1 HD12 sing N N 166 LEU CD1 HD13 sing N N 167 LEU CD2 HD21 sing N N 168 LEU CD2 HD22 sing N N 169 LEU CD2 HD23 sing N N 170 LEU OXT HXT sing N N 171 LYS N CA sing N N 172 LYS N H sing N N 173 LYS N H2 sing N N 174 LYS CA C sing N N 175 LYS CA CB sing N N 176 LYS CA HA sing N N 177 LYS C O doub N N 178 LYS C OXT sing N N 179 LYS CB CG sing N N 180 LYS CB HB2 sing N N 181 LYS CB HB3 sing N N 182 LYS CG CD sing N N 183 LYS CG HG2 sing N N 184 LYS CG HG3 sing N N 185 LYS CD CE sing N N 186 LYS CD HD2 sing N N 187 LYS CD HD3 sing N N 188 LYS CE NZ sing N N 189 LYS CE HE2 sing N N 190 LYS CE HE3 sing N N 191 LYS NZ HZ1 sing N N 192 LYS NZ HZ2 sing N N 193 LYS NZ HZ3 sing N N 194 LYS OXT HXT sing N N 195 MET N CA sing N N 196 MET N H sing N N 197 MET N H2 sing N N 198 MET CA C sing N N 199 MET CA CB sing N N 200 MET CA HA sing N N 201 MET C O doub N N 202 MET C OXT sing N N 203 MET CB CG sing N N 204 MET CB HB2 sing N N 205 MET CB HB3 sing N N 206 MET CG SD sing N N 207 MET CG HG2 sing N N 208 MET CG HG3 sing N N 209 MET SD CE sing N N 210 MET CE HE1 sing N N 211 MET CE HE2 sing N N 212 MET CE HE3 sing N N 213 MET OXT HXT sing N N 214 PRO N CA sing N N 215 PRO N CD sing N N 216 PRO N H sing N N 217 PRO CA C sing N N 218 PRO CA CB sing N N 219 PRO CA HA sing N N 220 PRO C O doub N N 221 PRO C OXT sing N N 222 PRO CB CG sing N N 223 PRO CB HB2 sing N N 224 PRO CB HB3 sing N N 225 PRO CG CD sing N N 226 PRO CG HG2 sing N N 227 PRO CG HG3 sing N N 228 PRO CD HD2 sing N N 229 PRO CD HD3 sing N N 230 PRO OXT HXT sing N N 231 SER N CA sing N N 232 SER N H sing N N 233 SER N H2 sing N N 234 SER CA C sing N N 235 SER CA CB sing N N 236 SER CA HA sing N N 237 SER C O doub N N 238 SER C OXT sing N N 239 SER CB OG sing N N 240 SER CB HB2 sing N N 241 SER CB HB3 sing N N 242 SER OG HG sing N N 243 SER OXT HXT sing N N 244 TRP N CA sing N N 245 TRP N H sing N N 246 TRP N H2 sing N N 247 TRP CA C sing N N 248 TRP CA CB sing N N 249 TRP CA HA sing N N 250 TRP C O doub N N 251 TRP C OXT sing N N 252 TRP CB CG sing N N 253 TRP CB HB2 sing N N 254 TRP CB HB3 sing N N 255 TRP CG CD1 doub Y N 256 TRP CG CD2 sing Y N 257 TRP CD1 NE1 sing Y N 258 TRP CD1 HD1 sing N N 259 TRP CD2 CE2 doub Y N 260 TRP CD2 CE3 sing Y N 261 TRP NE1 CE2 sing Y N 262 TRP NE1 HE1 sing N N 263 TRP CE2 CZ2 sing Y N 264 TRP CE3 CZ3 doub Y N 265 TRP CE3 HE3 sing N N 266 TRP CZ2 CH2 doub Y N 267 TRP CZ2 HZ2 sing N N 268 TRP CZ3 CH2 sing Y N 269 TRP CZ3 HZ3 sing N N 270 TRP CH2 HH2 sing N N 271 TRP OXT HXT sing N N 272 VAL N CA sing N N 273 VAL N H sing N N 274 VAL N H2 sing N N 275 VAL CA C sing N N 276 VAL CA CB sing N N 277 VAL CA HA sing N N 278 VAL C O doub N N 279 VAL C OXT sing N N 280 VAL CB CG1 sing N N 281 VAL CB CG2 sing N N 282 VAL CB HB sing N N 283 VAL CG1 HG11 sing N N 284 VAL CG1 HG12 sing N N 285 VAL CG1 HG13 sing N N 286 VAL CG2 HG21 sing N N 287 VAL CG2 HG22 sing N N 288 VAL CG2 HG23 sing N N 289 VAL OXT HXT sing N N 290 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Q2F _pdbx_initial_refinement_model.details ? #