data_5KSO # _entry.id 5KSO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5KSO pdb_00005kso 10.2210/pdb5kso/pdb WWPDB D_1000222690 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5KSP unspecified PDB . 5KSY unspecified PDB . 5KSZ unspecified PDB . 5KTY unspecified PDB . 5KU1 unspecified PDB . 5KUT unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KSO _pdbx_database_status.recvd_initial_deposition_date 2016-07-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Klosowiak, J.L.' 1 'Focia, P.J.' 2 'Rice, S.E.' 3 'Freymann, D.M.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 33019 _citation.page_last 33019 _citation.title 'Structural insights into Parkin substrate lysine targeting from minimal Miro substrates.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep33019 _citation.pdbx_database_id_PubMed 27605430 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klosowiak, J.L.' 1 ? primary 'Park, S.' 2 ? primary 'Smith, K.P.' 3 ? primary 'French, M.E.' 4 ? primary 'Focia, P.J.' 5 ? primary 'Freymann, D.M.' 6 ? primary 'Rice, S.E.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5KSO _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.510 _cell.length_a_esd ? _cell.length_b 65.510 _cell.length_b_esd ? _cell.length_c 82.520 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KSO _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitochondrial Rho GTPase 1' 22001.414 1 3.6.5.- ? 'C-terminal GTPase domain (UNP residues 411-592)' ? 2 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hMiro-1,Rac-GTP-binding protein-like protein,Ras homolog gene family member T1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICD VVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIF VKLTTMAMYPHVTQADLKSSTFLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;KKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICD VVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIF VKLTTMAMYPHVTQADLKSSTFLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LYS n 1 3 GLN n 1 4 THR n 1 5 GLN n 1 6 ARG n 1 7 ASN n 1 8 VAL n 1 9 PHE n 1 10 ARG n 1 11 CYS n 1 12 ASN n 1 13 VAL n 1 14 ILE n 1 15 GLY n 1 16 VAL n 1 17 LYS n 1 18 ASN n 1 19 CYS n 1 20 GLY n 1 21 LYS n 1 22 SER n 1 23 GLY n 1 24 VAL n 1 25 LEU n 1 26 GLN n 1 27 ALA n 1 28 LEU n 1 29 LEU n 1 30 GLY n 1 31 ARG n 1 32 ASN n 1 33 LEU n 1 34 MET n 1 35 ARG n 1 36 GLN n 1 37 LYS n 1 38 LYS n 1 39 ILE n 1 40 ARG n 1 41 GLU n 1 42 ASP n 1 43 HIS n 1 44 LYS n 1 45 SER n 1 46 TYR n 1 47 TYR n 1 48 ALA n 1 49 ILE n 1 50 ASN n 1 51 THR n 1 52 VAL n 1 53 TYR n 1 54 VAL n 1 55 TYR n 1 56 GLY n 1 57 GLN n 1 58 GLU n 1 59 LYS n 1 60 TYR n 1 61 LEU n 1 62 LEU n 1 63 LEU n 1 64 HIS n 1 65 ASP n 1 66 ILE n 1 67 SER n 1 68 GLU n 1 69 SER n 1 70 GLU n 1 71 PHE n 1 72 LEU n 1 73 THR n 1 74 GLU n 1 75 ALA n 1 76 GLU n 1 77 ILE n 1 78 ILE n 1 79 CYS n 1 80 ASP n 1 81 VAL n 1 82 VAL n 1 83 CYS n 1 84 LEU n 1 85 VAL n 1 86 TYR n 1 87 ASP n 1 88 VAL n 1 89 SER n 1 90 ASN n 1 91 PRO n 1 92 LYS n 1 93 SER n 1 94 PHE n 1 95 GLU n 1 96 TYR n 1 97 CYS n 1 98 ALA n 1 99 ARG n 1 100 ILE n 1 101 PHE n 1 102 LYS n 1 103 GLN n 1 104 HIS n 1 105 PHE n 1 106 MET n 1 107 ASP n 1 108 SER n 1 109 ARG n 1 110 ILE n 1 111 PRO n 1 112 CYS n 1 113 LEU n 1 114 ILE n 1 115 VAL n 1 116 ALA n 1 117 ALA n 1 118 LYS n 1 119 SER n 1 120 ASP n 1 121 LEU n 1 122 HIS n 1 123 GLU n 1 124 VAL n 1 125 LYS n 1 126 GLN n 1 127 GLU n 1 128 TYR n 1 129 SER n 1 130 ILE n 1 131 SER n 1 132 PRO n 1 133 THR n 1 134 ASP n 1 135 PHE n 1 136 CYS n 1 137 ARG n 1 138 LYS n 1 139 HIS n 1 140 LYS n 1 141 MET n 1 142 PRO n 1 143 PRO n 1 144 PRO n 1 145 GLN n 1 146 ALA n 1 147 PHE n 1 148 THR n 1 149 CYS n 1 150 ASN n 1 151 THR n 1 152 ALA n 1 153 ASP n 1 154 ALA n 1 155 PRO n 1 156 SER n 1 157 LYS n 1 158 ASP n 1 159 ILE n 1 160 PHE n 1 161 VAL n 1 162 LYS n 1 163 LEU n 1 164 THR n 1 165 THR n 1 166 MET n 1 167 ALA n 1 168 MET n 1 169 TYR n 1 170 PRO n 1 171 HIS n 1 172 VAL n 1 173 THR n 1 174 GLN n 1 175 ALA n 1 176 ASP n 1 177 LEU n 1 178 LYS n 1 179 SER n 1 180 SER n 1 181 THR n 1 182 PHE n 1 183 LEU n 1 184 GLU n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 190 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RHOT1, ARHT1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MIRO1_HUMAN _struct_ref.pdbx_db_accession Q8IXI2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICD VVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIF VKLTTMAMYPHVTQADLKSSTF ; _struct_ref.pdbx_align_begin 411 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KSO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IXI2 _struct_ref_seq.db_align_beg 411 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 592 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 411 _struct_ref_seq.pdbx_auth_seq_align_end 592 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KSO LEU A 183 ? UNP Q8IXI2 ? ? 'expression tag' 593 1 1 5KSO GLU A 184 ? UNP Q8IXI2 ? ? 'expression tag' 594 2 1 5KSO HIS A 185 ? UNP Q8IXI2 ? ? 'expression tag' 595 3 1 5KSO HIS A 186 ? UNP Q8IXI2 ? ? 'expression tag' 596 4 1 5KSO HIS A 187 ? UNP Q8IXI2 ? ? 'expression tag' 597 5 1 5KSO HIS A 188 ? UNP Q8IXI2 ? ? 'expression tag' 598 6 1 5KSO HIS A 189 ? UNP Q8IXI2 ? ? 'expression tag' 599 7 1 5KSO HIS A 190 ? UNP Q8IXI2 ? ? 'expression tag' 600 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KSO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;19 mg/mL protein, 5 mM magnesium chloride, 0.1 M SPG buffer, pH 5.0, 25% w/v PEG1500, GDP observed in the structure was carried through from the expression system during purification ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978590 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978590 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5KSO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.25 _reflns.d_resolution_low 82.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10140 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs 0.083 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 83.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.25 _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5KSO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.250 _refine.ls_d_res_low 33.369 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10107 _refine.ls_number_reflns_R_free 1015 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 10.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1785 _refine.ls_R_factor_R_free 0.2090 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1750 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 4C0L' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.75 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.23 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1318 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1409 _refine_hist.d_res_high 2.250 _refine_hist.d_res_low 33.369 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1389 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.680 ? 1885 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.238 ? 520 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.026 ? 206 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 234 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2501 2.3687 . . 140 1263 100.00 . . . 0.2315 . 0.1846 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3687 2.5171 . . 145 1286 100.00 . . . 0.2413 . 0.1906 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5171 2.7113 . . 138 1276 100.00 . . . 0.2647 . 0.1917 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7113 2.9840 . . 142 1295 100.00 . . . 0.2627 . 0.2092 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9840 3.4154 . . 149 1281 100.00 . . . 0.2229 . 0.1839 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4154 4.3016 . . 147 1307 100.00 . . . 0.1973 . 0.1555 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3016 33.3723 . . 154 1384 100.00 . . . 0.1661 . 0.1643 . . . . . . . . . . # _struct.entry_id 5KSO _struct.title 'hMiro1 C-domain GDP-Pi Complex P3121 Crystal Form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KSO _struct_keywords.text 'Miro, GTPase, Parkin, Mitochondria, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 20 ? LEU A 29 ? GLY A 430 LEU A 439 1 ? 10 HELX_P HELX_P2 AA2 ASN A 32 ? ILE A 39 ? ASN A 442 ILE A 449 1 ? 8 HELX_P HELX_P3 AA3 THR A 73 ? ILE A 78 ? THR A 483 ILE A 488 1 ? 6 HELX_P HELX_P4 AA4 LYS A 92 ? PHE A 105 ? LYS A 502 PHE A 515 1 ? 14 HELX_P HELX_P5 AA5 SER A 131 ? HIS A 139 ? SER A 541 HIS A 549 1 ? 9 HELX_P HELX_P6 AA6 LYS A 157 ? TYR A 169 ? LYS A 567 TYR A 579 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 47 ? VAL A 54 ? TYR A 457 VAL A 464 AA1 2 GLN A 57 ? ILE A 66 ? GLN A 467 ILE A 476 AA1 3 VAL A 8 ? ILE A 14 ? VAL A 418 ILE A 424 AA1 4 VAL A 81 ? ASP A 87 ? VAL A 491 ASP A 497 AA1 5 CYS A 112 ? ALA A 117 ? CYS A 522 ALA A 527 AA1 6 GLN A 145 ? ALA A 146 ? GLN A 555 ALA A 556 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 48 ? N ALA A 458 O LEU A 63 ? O LEU A 473 AA1 2 3 O LEU A 62 ? O LEU A 472 N CYS A 11 ? N CYS A 421 AA1 3 4 N ILE A 14 ? N ILE A 424 O VAL A 85 ? O VAL A 495 AA1 4 5 N LEU A 84 ? N LEU A 494 O VAL A 115 ? O VAL A 525 AA1 5 6 N ILE A 114 ? N ILE A 524 O GLN A 145 ? O GLN A 555 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GDP 701 ? 19 'binding site for residue GDP A 701' AC2 Software A PO4 702 ? 8 'binding site for residue PO4 A 702' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 VAL A 16 ? VAL A 426 . ? 1_555 ? 2 AC1 19 ASN A 18 ? ASN A 428 . ? 1_555 ? 3 AC1 19 CYS A 19 ? CYS A 429 . ? 1_555 ? 4 AC1 19 GLY A 20 ? GLY A 430 . ? 1_555 ? 5 AC1 19 LYS A 21 ? LYS A 431 . ? 1_555 ? 6 AC1 19 SER A 22 ? SER A 432 . ? 1_555 ? 7 AC1 19 GLY A 23 ? GLY A 433 . ? 1_555 ? 8 AC1 19 LEU A 33 ? LEU A 443 . ? 1_555 ? 9 AC1 19 LYS A 37 ? LYS A 447 . ? 1_555 ? 10 AC1 19 LYS A 118 ? LYS A 528 . ? 1_555 ? 11 AC1 19 ASP A 120 ? ASP A 530 . ? 1_555 ? 12 AC1 19 LEU A 121 ? LEU A 531 . ? 1_555 ? 13 AC1 19 THR A 148 ? THR A 558 . ? 1_555 ? 14 AC1 19 CYS A 149 ? CYS A 559 . ? 1_555 ? 15 AC1 19 PO4 C . ? PO4 A 702 . ? 1_555 ? 16 AC1 19 HOH D . ? HOH A 806 . ? 1_555 ? 17 AC1 19 HOH D . ? HOH A 820 . ? 1_555 ? 18 AC1 19 HOH D . ? HOH A 824 . ? 1_555 ? 19 AC1 19 HOH D . ? HOH A 836 . ? 1_555 ? 20 AC2 8 LYS A 17 ? LYS A 427 . ? 1_555 ? 21 AC2 8 ASN A 18 ? ASN A 428 . ? 1_555 ? 22 AC2 8 LYS A 21 ? LYS A 431 . ? 1_555 ? 23 AC2 8 SER A 67 ? SER A 477 . ? 1_555 ? 24 AC2 8 GLU A 68 ? GLU A 478 . ? 1_555 ? 25 AC2 8 GDP B . ? GDP A 701 . ? 1_555 ? 26 AC2 8 HOH D . ? HOH A 806 . ? 1_555 ? 27 AC2 8 HOH D . ? HOH A 813 . ? 1_555 ? # _atom_sites.entry_id 5KSO _atom_sites.fract_transf_matrix[1][1] 0.015265 _atom_sites.fract_transf_matrix[1][2] 0.008813 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017626 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012118 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 411 ? ? ? A . n A 1 2 LYS 2 412 ? ? ? A . n A 1 3 GLN 3 413 ? ? ? A . n A 1 4 THR 4 414 ? ? ? A . n A 1 5 GLN 5 415 415 GLN GLN A . n A 1 6 ARG 6 416 416 ARG ARG A . n A 1 7 ASN 7 417 417 ASN ASN A . n A 1 8 VAL 8 418 418 VAL VAL A . n A 1 9 PHE 9 419 419 PHE PHE A . n A 1 10 ARG 10 420 420 ARG ARG A . n A 1 11 CYS 11 421 421 CYS CYS A . n A 1 12 ASN 12 422 422 ASN ASN A . n A 1 13 VAL 13 423 423 VAL VAL A . n A 1 14 ILE 14 424 424 ILE ILE A . n A 1 15 GLY 15 425 425 GLY GLY A . n A 1 16 VAL 16 426 426 VAL VAL A . n A 1 17 LYS 17 427 427 LYS LYS A . n A 1 18 ASN 18 428 428 ASN ASN A . n A 1 19 CYS 19 429 429 CYS CYS A . n A 1 20 GLY 20 430 430 GLY GLY A . n A 1 21 LYS 21 431 431 LYS LYS A . n A 1 22 SER 22 432 432 SER SER A . n A 1 23 GLY 23 433 433 GLY GLY A . n A 1 24 VAL 24 434 434 VAL VAL A . n A 1 25 LEU 25 435 435 LEU LEU A . n A 1 26 GLN 26 436 436 GLN GLN A . n A 1 27 ALA 27 437 437 ALA ALA A . n A 1 28 LEU 28 438 438 LEU LEU A . n A 1 29 LEU 29 439 439 LEU LEU A . n A 1 30 GLY 30 440 440 GLY GLY A . n A 1 31 ARG 31 441 441 ARG ARG A . n A 1 32 ASN 32 442 442 ASN ASN A . n A 1 33 LEU 33 443 443 LEU LEU A . n A 1 34 MET 34 444 444 MET MET A . n A 1 35 ARG 35 445 445 ARG ARG A . n A 1 36 GLN 36 446 446 GLN GLN A . n A 1 37 LYS 37 447 447 LYS LYS A . n A 1 38 LYS 38 448 448 LYS LYS A . n A 1 39 ILE 39 449 449 ILE ALA A . n A 1 40 ARG 40 450 450 ARG ALA A . n A 1 41 GLU 41 451 451 GLU ALA A . n A 1 42 ASP 42 452 452 ASP ALA A . n A 1 43 HIS 43 453 453 HIS HIS A . n A 1 44 LYS 44 454 454 LYS LYS A . n A 1 45 SER 45 455 455 SER SER A . n A 1 46 TYR 46 456 456 TYR TYR A . n A 1 47 TYR 47 457 457 TYR TYR A . n A 1 48 ALA 48 458 458 ALA ALA A . n A 1 49 ILE 49 459 459 ILE ILE A . n A 1 50 ASN 50 460 460 ASN ASN A . n A 1 51 THR 51 461 461 THR THR A . n A 1 52 VAL 52 462 462 VAL VAL A . n A 1 53 TYR 53 463 463 TYR TYR A . n A 1 54 VAL 54 464 464 VAL VAL A . n A 1 55 TYR 55 465 465 TYR TYR A . n A 1 56 GLY 56 466 466 GLY GLY A . n A 1 57 GLN 57 467 467 GLN GLN A . n A 1 58 GLU 58 468 468 GLU GLU A . n A 1 59 LYS 59 469 469 LYS LYS A . n A 1 60 TYR 60 470 470 TYR TYR A . n A 1 61 LEU 61 471 471 LEU LEU A . n A 1 62 LEU 62 472 472 LEU LEU A . n A 1 63 LEU 63 473 473 LEU LEU A . n A 1 64 HIS 64 474 474 HIS HIS A . n A 1 65 ASP 65 475 475 ASP ASP A . n A 1 66 ILE 66 476 476 ILE ILE A . n A 1 67 SER 67 477 477 SER SER A . n A 1 68 GLU 68 478 478 GLU GLU A . n A 1 69 SER 69 479 479 SER SER A . n A 1 70 GLU 70 480 480 GLU GLU A . n A 1 71 PHE 71 481 481 PHE PHE A . n A 1 72 LEU 72 482 482 LEU LEU A . n A 1 73 THR 73 483 483 THR THR A . n A 1 74 GLU 74 484 484 GLU GLU A . n A 1 75 ALA 75 485 485 ALA ALA A . n A 1 76 GLU 76 486 486 GLU GLU A . n A 1 77 ILE 77 487 487 ILE ILE A . n A 1 78 ILE 78 488 488 ILE ILE A . n A 1 79 CYS 79 489 489 CYS CYS A . n A 1 80 ASP 80 490 490 ASP ASP A . n A 1 81 VAL 81 491 491 VAL VAL A . n A 1 82 VAL 82 492 492 VAL VAL A . n A 1 83 CYS 83 493 493 CYS CYS A . n A 1 84 LEU 84 494 494 LEU LEU A . n A 1 85 VAL 85 495 495 VAL VAL A . n A 1 86 TYR 86 496 496 TYR TYR A . n A 1 87 ASP 87 497 497 ASP ASP A . n A 1 88 VAL 88 498 498 VAL VAL A . n A 1 89 SER 89 499 499 SER SER A . n A 1 90 ASN 90 500 500 ASN ASN A . n A 1 91 PRO 91 501 501 PRO PRO A . n A 1 92 LYS 92 502 502 LYS LYS A . n A 1 93 SER 93 503 503 SER SER A . n A 1 94 PHE 94 504 504 PHE PHE A . n A 1 95 GLU 95 505 505 GLU GLU A . n A 1 96 TYR 96 506 506 TYR TYR A . n A 1 97 CYS 97 507 507 CYS CYS A . n A 1 98 ALA 98 508 508 ALA ALA A . n A 1 99 ARG 99 509 509 ARG ARG A . n A 1 100 ILE 100 510 510 ILE ILE A . n A 1 101 PHE 101 511 511 PHE PHE A . n A 1 102 LYS 102 512 512 LYS LYS A . n A 1 103 GLN 103 513 513 GLN GLN A . n A 1 104 HIS 104 514 514 HIS HIS A . n A 1 105 PHE 105 515 515 PHE PHE A . n A 1 106 MET 106 516 516 MET MET A . n A 1 107 ASP 107 517 517 ASP ASP A . n A 1 108 SER 108 518 518 SER SER A . n A 1 109 ARG 109 519 519 ARG ARG A . n A 1 110 ILE 110 520 520 ILE ILE A . n A 1 111 PRO 111 521 521 PRO PRO A . n A 1 112 CYS 112 522 522 CYS CYS A . n A 1 113 LEU 113 523 523 LEU LEU A . n A 1 114 ILE 114 524 524 ILE ILE A . n A 1 115 VAL 115 525 525 VAL VAL A . n A 1 116 ALA 116 526 526 ALA ALA A . n A 1 117 ALA 117 527 527 ALA ALA A . n A 1 118 LYS 118 528 528 LYS LYS A . n A 1 119 SER 119 529 529 SER SER A . n A 1 120 ASP 120 530 530 ASP ASP A . n A 1 121 LEU 121 531 531 LEU LEU A . n A 1 122 HIS 122 532 532 HIS HIS A . n A 1 123 GLU 123 533 533 GLU GLU A . n A 1 124 VAL 124 534 534 VAL VAL A . n A 1 125 LYS 125 535 535 LYS LYS A . n A 1 126 GLN 126 536 536 GLN GLN A . n A 1 127 GLU 127 537 537 GLU GLU A . n A 1 128 TYR 128 538 538 TYR TYR A . n A 1 129 SER 129 539 539 SER SER A . n A 1 130 ILE 130 540 540 ILE ILE A . n A 1 131 SER 131 541 541 SER SER A . n A 1 132 PRO 132 542 542 PRO PRO A . n A 1 133 THR 133 543 543 THR THR A . n A 1 134 ASP 134 544 544 ASP ASP A . n A 1 135 PHE 135 545 545 PHE PHE A . n A 1 136 CYS 136 546 546 CYS CYS A . n A 1 137 ARG 137 547 547 ARG ARG A . n A 1 138 LYS 138 548 548 LYS LYS A . n A 1 139 HIS 139 549 549 HIS HIS A . n A 1 140 LYS 140 550 550 LYS LYS A . n A 1 141 MET 141 551 551 MET MET A . n A 1 142 PRO 142 552 552 PRO PRO A . n A 1 143 PRO 143 553 553 PRO PRO A . n A 1 144 PRO 144 554 554 PRO PRO A . n A 1 145 GLN 145 555 555 GLN GLN A . n A 1 146 ALA 146 556 556 ALA ALA A . n A 1 147 PHE 147 557 557 PHE PHE A . n A 1 148 THR 148 558 558 THR THR A . n A 1 149 CYS 149 559 559 CYS CYS A . n A 1 150 ASN 150 560 560 ASN ASN A . n A 1 151 THR 151 561 561 THR THR A . n A 1 152 ALA 152 562 562 ALA ALA A . n A 1 153 ASP 153 563 563 ASP ASP A . n A 1 154 ALA 154 564 564 ALA ALA A . n A 1 155 PRO 155 565 565 PRO PRO A . n A 1 156 SER 156 566 566 SER SER A . n A 1 157 LYS 157 567 567 LYS LYS A . n A 1 158 ASP 158 568 568 ASP ASP A . n A 1 159 ILE 159 569 569 ILE ILE A . n A 1 160 PHE 160 570 570 PHE PHE A . n A 1 161 VAL 161 571 571 VAL VAL A . n A 1 162 LYS 162 572 572 LYS LYS A . n A 1 163 LEU 163 573 573 LEU LEU A . n A 1 164 THR 164 574 574 THR THR A . n A 1 165 THR 165 575 575 THR THR A . n A 1 166 MET 166 576 576 MET MET A . n A 1 167 ALA 167 577 577 ALA ALA A . n A 1 168 MET 168 578 578 MET MET A . n A 1 169 TYR 169 579 579 TYR TYR A . n A 1 170 PRO 170 580 580 PRO PRO A . n A 1 171 HIS 171 581 ? ? ? A . n A 1 172 VAL 172 582 ? ? ? A . n A 1 173 THR 173 583 ? ? ? A . n A 1 174 GLN 174 584 ? ? ? A . n A 1 175 ALA 175 585 ? ? ? A . n A 1 176 ASP 176 586 ? ? ? A . n A 1 177 LEU 177 587 ? ? ? A . n A 1 178 LYS 178 588 ? ? ? A . n A 1 179 SER 179 589 ? ? ? A . n A 1 180 SER 180 590 ? ? ? A . n A 1 181 THR 181 591 ? ? ? A . n A 1 182 PHE 182 592 ? ? ? A . n A 1 183 LEU 183 593 ? ? ? A . n A 1 184 GLU 184 594 ? ? ? A . n A 1 185 HIS 185 595 ? ? ? A . n A 1 186 HIS 186 596 ? ? ? A . n A 1 187 HIS 187 597 ? ? ? A . n A 1 188 HIS 188 598 ? ? ? A . n A 1 189 HIS 189 599 ? ? ? A . n A 1 190 HIS 190 600 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GDP 1 701 1 GDP GDP A . C 3 PO4 1 702 2 PO4 PO4 A . D 4 HOH 1 801 55 HOH HOH A . D 4 HOH 2 802 32 HOH HOH A . D 4 HOH 3 803 7 HOH HOH A . D 4 HOH 4 804 31 HOH HOH A . D 4 HOH 5 805 37 HOH HOH A . D 4 HOH 6 806 40 HOH HOH A . D 4 HOH 7 807 13 HOH HOH A . D 4 HOH 8 808 24 HOH HOH A . D 4 HOH 9 809 14 HOH HOH A . D 4 HOH 10 810 6 HOH HOH A . D 4 HOH 11 811 18 HOH HOH A . D 4 HOH 12 812 25 HOH HOH A . D 4 HOH 13 813 42 HOH HOH A . D 4 HOH 14 814 33 HOH HOH A . D 4 HOH 15 815 56 HOH HOH A . D 4 HOH 16 816 26 HOH HOH A . D 4 HOH 17 817 4 HOH HOH A . D 4 HOH 18 818 49 HOH HOH A . D 4 HOH 19 819 20 HOH HOH A . D 4 HOH 20 820 8 HOH HOH A . D 4 HOH 21 821 2 HOH HOH A . D 4 HOH 22 822 28 HOH HOH A . D 4 HOH 23 823 30 HOH HOH A . D 4 HOH 24 824 5 HOH HOH A . D 4 HOH 25 825 1 HOH HOH A . D 4 HOH 26 826 39 HOH HOH A . D 4 HOH 27 827 23 HOH HOH A . D 4 HOH 28 828 29 HOH HOH A . D 4 HOH 29 829 11 HOH HOH A . D 4 HOH 30 830 3 HOH HOH A . D 4 HOH 31 831 19 HOH HOH A . D 4 HOH 32 832 9 HOH HOH A . D 4 HOH 33 833 10 HOH HOH A . D 4 HOH 34 834 47 HOH HOH A . D 4 HOH 35 835 36 HOH HOH A . D 4 HOH 36 836 34 HOH HOH A . D 4 HOH 37 837 46 HOH HOH A . D 4 HOH 38 838 21 HOH HOH A . D 4 HOH 39 839 50 HOH HOH A . D 4 HOH 40 840 17 HOH HOH A . D 4 HOH 41 841 12 HOH HOH A . D 4 HOH 42 842 27 HOH HOH A . D 4 HOH 43 843 41 HOH HOH A . D 4 HOH 44 844 44 HOH HOH A . D 4 HOH 45 845 57 HOH HOH A . D 4 HOH 46 846 16 HOH HOH A . D 4 HOH 47 847 43 HOH HOH A . D 4 HOH 48 848 48 HOH HOH A . D 4 HOH 49 849 15 HOH HOH A . D 4 HOH 50 850 35 HOH HOH A . D 4 HOH 51 851 45 HOH HOH A . D 4 HOH 52 852 51 HOH HOH A . D 4 HOH 53 853 22 HOH HOH A . D 4 HOH 54 854 38 HOH HOH A . D 4 HOH 55 855 53 HOH HOH A . D 4 HOH 56 856 54 HOH HOH A . D 4 HOH 57 857 58 HOH HOH A . D 4 HOH 58 858 52 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 970 ? 1 MORE -16 ? 1 'SSA (A^2)' 8990 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-21 2 'Structure model' 1 1 2017-09-13 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2019-12-25 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Author supporting evidence' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' software 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_software.classification' 4 4 'Structure model' '_pdbx_audit_support.funding_organization' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? 7.1.0 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.3.8 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 2.5.6 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 857 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 857 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_465 _pdbx_validate_symm_contact.dist 2.09 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 563 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -112.07 _pdbx_validate_torsion.psi -158.61 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 449 ? CG1 ? A ILE 39 CG1 2 1 Y 1 A ILE 449 ? CG2 ? A ILE 39 CG2 3 1 Y 1 A ILE 449 ? CD1 ? A ILE 39 CD1 4 1 Y 1 A ARG 450 ? CG ? A ARG 40 CG 5 1 Y 1 A ARG 450 ? CD ? A ARG 40 CD 6 1 Y 1 A ARG 450 ? NE ? A ARG 40 NE 7 1 Y 1 A ARG 450 ? CZ ? A ARG 40 CZ 8 1 Y 1 A ARG 450 ? NH1 ? A ARG 40 NH1 9 1 Y 1 A ARG 450 ? NH2 ? A ARG 40 NH2 10 1 Y 1 A GLU 451 ? CG ? A GLU 41 CG 11 1 Y 1 A GLU 451 ? CD ? A GLU 41 CD 12 1 Y 1 A GLU 451 ? OE1 ? A GLU 41 OE1 13 1 Y 1 A GLU 451 ? OE2 ? A GLU 41 OE2 14 1 Y 1 A ASP 452 ? CG ? A ASP 42 CG 15 1 Y 1 A ASP 452 ? OD1 ? A ASP 42 OD1 16 1 Y 1 A ASP 452 ? OD2 ? A ASP 42 OD2 17 1 Y 1 A PRO 580 ? CG ? A PRO 170 CG 18 1 Y 1 A PRO 580 ? CD ? A PRO 170 CD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 411 ? A LYS 1 2 1 Y 1 A LYS 412 ? A LYS 2 3 1 Y 1 A GLN 413 ? A GLN 3 4 1 Y 1 A THR 414 ? A THR 4 5 1 Y 1 A HIS 581 ? A HIS 171 6 1 Y 1 A VAL 582 ? A VAL 172 7 1 Y 1 A THR 583 ? A THR 173 8 1 Y 1 A GLN 584 ? A GLN 174 9 1 Y 1 A ALA 585 ? A ALA 175 10 1 Y 1 A ASP 586 ? A ASP 176 11 1 Y 1 A LEU 587 ? A LEU 177 12 1 Y 1 A LYS 588 ? A LYS 178 13 1 Y 1 A SER 589 ? A SER 179 14 1 Y 1 A SER 590 ? A SER 180 15 1 Y 1 A THR 591 ? A THR 181 16 1 Y 1 A PHE 592 ? A PHE 182 17 1 Y 1 A LEU 593 ? A LEU 183 18 1 Y 1 A GLU 594 ? A GLU 184 19 1 Y 1 A HIS 595 ? A HIS 185 20 1 Y 1 A HIS 596 ? A HIS 186 21 1 Y 1 A HIS 597 ? A HIS 187 22 1 Y 1 A HIS 598 ? A HIS 188 23 1 Y 1 A HIS 599 ? A HIS 189 24 1 Y 1 A HIS 600 ? A HIS 190 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GDP PB P N N 88 GDP O1B O N N 89 GDP O2B O N N 90 GDP O3B O N N 91 GDP O3A O N N 92 GDP PA P N N 93 GDP O1A O N N 94 GDP O2A O N N 95 GDP "O5'" O N N 96 GDP "C5'" C N N 97 GDP "C4'" C N R 98 GDP "O4'" O N N 99 GDP "C3'" C N S 100 GDP "O3'" O N N 101 GDP "C2'" C N R 102 GDP "O2'" O N N 103 GDP "C1'" C N R 104 GDP N9 N Y N 105 GDP C8 C Y N 106 GDP N7 N Y N 107 GDP C5 C Y N 108 GDP C6 C N N 109 GDP O6 O N N 110 GDP N1 N N N 111 GDP C2 C N N 112 GDP N2 N N N 113 GDP N3 N N N 114 GDP C4 C Y N 115 GDP HOB2 H N N 116 GDP HOB3 H N N 117 GDP HOA2 H N N 118 GDP "H5'" H N N 119 GDP "H5''" H N N 120 GDP "H4'" H N N 121 GDP "H3'" H N N 122 GDP "HO3'" H N N 123 GDP "H2'" H N N 124 GDP "HO2'" H N N 125 GDP "H1'" H N N 126 GDP H8 H N N 127 GDP HN1 H N N 128 GDP HN21 H N N 129 GDP HN22 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PO4 P P N N 316 PO4 O1 O N N 317 PO4 O2 O N N 318 PO4 O3 O N N 319 PO4 O4 O N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GDP PB O1B doub N N 83 GDP PB O2B sing N N 84 GDP PB O3B sing N N 85 GDP PB O3A sing N N 86 GDP O2B HOB2 sing N N 87 GDP O3B HOB3 sing N N 88 GDP O3A PA sing N N 89 GDP PA O1A doub N N 90 GDP PA O2A sing N N 91 GDP PA "O5'" sing N N 92 GDP O2A HOA2 sing N N 93 GDP "O5'" "C5'" sing N N 94 GDP "C5'" "C4'" sing N N 95 GDP "C5'" "H5'" sing N N 96 GDP "C5'" "H5''" sing N N 97 GDP "C4'" "O4'" sing N N 98 GDP "C4'" "C3'" sing N N 99 GDP "C4'" "H4'" sing N N 100 GDP "O4'" "C1'" sing N N 101 GDP "C3'" "O3'" sing N N 102 GDP "C3'" "C2'" sing N N 103 GDP "C3'" "H3'" sing N N 104 GDP "O3'" "HO3'" sing N N 105 GDP "C2'" "O2'" sing N N 106 GDP "C2'" "C1'" sing N N 107 GDP "C2'" "H2'" sing N N 108 GDP "O2'" "HO2'" sing N N 109 GDP "C1'" N9 sing N N 110 GDP "C1'" "H1'" sing N N 111 GDP N9 C8 sing Y N 112 GDP N9 C4 sing Y N 113 GDP C8 N7 doub Y N 114 GDP C8 H8 sing N N 115 GDP N7 C5 sing Y N 116 GDP C5 C6 sing N N 117 GDP C5 C4 doub Y N 118 GDP C6 O6 doub N N 119 GDP C6 N1 sing N N 120 GDP N1 C2 sing N N 121 GDP N1 HN1 sing N N 122 GDP C2 N2 sing N N 123 GDP C2 N3 doub N N 124 GDP N2 HN21 sing N N 125 GDP N2 HN22 sing N N 126 GDP N3 C4 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PO4 P O1 doub N N 305 PO4 P O2 sing N N 306 PO4 P O3 sing N N 307 PO4 P O4 sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 VAL N CA sing N N 379 VAL N H sing N N 380 VAL N H2 sing N N 381 VAL CA C sing N N 382 VAL CA CB sing N N 383 VAL CA HA sing N N 384 VAL C O doub N N 385 VAL C OXT sing N N 386 VAL CB CG1 sing N N 387 VAL CB CG2 sing N N 388 VAL CB HB sing N N 389 VAL CG1 HG11 sing N N 390 VAL CG1 HG12 sing N N 391 VAL CG1 HG13 sing N N 392 VAL CG2 HG21 sing N N 393 VAL CG2 HG22 sing N N 394 VAL CG2 HG23 sing N N 395 VAL OXT HXT sing N N 396 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM072656 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' T32GM008152 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "GUANOSINE-5'-DIPHOSPHATE" GDP 3 'PHOSPHATE ION' PO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4C0L _pdbx_initial_refinement_model.details 'PDB entry 4C0L' #