data_5KT0 # _entry.id 5KT0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5KT0 pdb_00005kt0 10.2210/pdb5kt0/pdb WWPDB D_1000222167 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-07 2 'Structure model' 1 1 2017-09-06 3 'Structure model' 1 2 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_detector 2 2 'Structure model' diffrn_source 3 2 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_detector.detector' 2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KT0 _pdbx_database_status.recvd_initial_deposition_date 2016-07-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5KTL _pdbx_database_related.db_name PDB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Christensen, J.B.' 1 'Soares da Costa, T.P.' 2 'Faou, P.' 3 'Pearce, F.G.' 4 'Panjikar, S.' 5 'Perugini, M.A.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Dihydrodipicolinate Reductase from the industrial and evolutionarily important cyanobacteria Anabaena variabilis.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Christensen, J.B.' 1 ? primary 'Soares da Costa, T.P.' 2 ? primary 'Faou, P.' 3 ? primary 'Pearce, F.G.' 4 ? primary 'Panjikar, S.' 5 ? primary 'Perugini, M.A.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '4-hydroxy-tetrahydrodipicolinate reductase' 33109.555 1 1.17.1.8 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HTPA reductase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPTNQAPIPVIVNGAAGKMGREVVKAIAQAPDLNLLGAIDSSPEHQGKD AGELAGLSEPLEVPITNQLEPMLGYVAGERQGPPGVIVDFTHPDSVYDNVRSAIAYGIRPVVGTTGLSPAQIQNLADFAE KASTGCLIIPNFSIGMVLLQQAAVTASQYFDHVEIIELHHNQKADAPSGTAIQTAELLAELGKTFNSAIVEETEKIPGAR GSLAGEGIRIHSVRLPGLIAHQEVIFGAPGQIYTLRHDTSDRACYMPGVLLAIRKVLQLKSLVYGLEKIL ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPTNQAPIPVIVNGAAGKMGREVVKAIAQAPDLNLLGAIDSSPEHQGKD AGELAGLSEPLEVPITNQLEPMLGYVAGERQGPPGVIVDFTHPDSVYDNVRSAIAYGIRPVVGTTGLSPAQIQNLADFAE KASTGCLIIPNFSIGMVLLQQAAVTASQYFDHVEIIELHHNQKADAPSGTAIQTAELLAELGKTFNSAIVEETEKIPGAR GSLAGEGIRIHSVRLPGLIAHQEVIFGAPGQIYTLRHDTSDRACYMPGVLLAIRKVLQLKSLVYGLEKIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 MET n 1 13 ALA n 1 14 SER n 1 15 MET n 1 16 THR n 1 17 GLY n 1 18 GLY n 1 19 GLN n 1 20 GLN n 1 21 MET n 1 22 GLY n 1 23 ARG n 1 24 ASP n 1 25 LEU n 1 26 TYR n 1 27 ASP n 1 28 ASP n 1 29 ASP n 1 30 ASP n 1 31 LYS n 1 32 ASP n 1 33 PRO n 1 34 THR n 1 35 ASN n 1 36 GLN n 1 37 ALA n 1 38 PRO n 1 39 ILE n 1 40 PRO n 1 41 VAL n 1 42 ILE n 1 43 VAL n 1 44 ASN n 1 45 GLY n 1 46 ALA n 1 47 ALA n 1 48 GLY n 1 49 LYS n 1 50 MET n 1 51 GLY n 1 52 ARG n 1 53 GLU n 1 54 VAL n 1 55 VAL n 1 56 LYS n 1 57 ALA n 1 58 ILE n 1 59 ALA n 1 60 GLN n 1 61 ALA n 1 62 PRO n 1 63 ASP n 1 64 LEU n 1 65 ASN n 1 66 LEU n 1 67 LEU n 1 68 GLY n 1 69 ALA n 1 70 ILE n 1 71 ASP n 1 72 SER n 1 73 SER n 1 74 PRO n 1 75 GLU n 1 76 HIS n 1 77 GLN n 1 78 GLY n 1 79 LYS n 1 80 ASP n 1 81 ALA n 1 82 GLY n 1 83 GLU n 1 84 LEU n 1 85 ALA n 1 86 GLY n 1 87 LEU n 1 88 SER n 1 89 GLU n 1 90 PRO n 1 91 LEU n 1 92 GLU n 1 93 VAL n 1 94 PRO n 1 95 ILE n 1 96 THR n 1 97 ASN n 1 98 GLN n 1 99 LEU n 1 100 GLU n 1 101 PRO n 1 102 MET n 1 103 LEU n 1 104 GLY n 1 105 TYR n 1 106 VAL n 1 107 ALA n 1 108 GLY n 1 109 GLU n 1 110 ARG n 1 111 GLN n 1 112 GLY n 1 113 PRO n 1 114 PRO n 1 115 GLY n 1 116 VAL n 1 117 ILE n 1 118 VAL n 1 119 ASP n 1 120 PHE n 1 121 THR n 1 122 HIS n 1 123 PRO n 1 124 ASP n 1 125 SER n 1 126 VAL n 1 127 TYR n 1 128 ASP n 1 129 ASN n 1 130 VAL n 1 131 ARG n 1 132 SER n 1 133 ALA n 1 134 ILE n 1 135 ALA n 1 136 TYR n 1 137 GLY n 1 138 ILE n 1 139 ARG n 1 140 PRO n 1 141 VAL n 1 142 VAL n 1 143 GLY n 1 144 THR n 1 145 THR n 1 146 GLY n 1 147 LEU n 1 148 SER n 1 149 PRO n 1 150 ALA n 1 151 GLN n 1 152 ILE n 1 153 GLN n 1 154 ASN n 1 155 LEU n 1 156 ALA n 1 157 ASP n 1 158 PHE n 1 159 ALA n 1 160 GLU n 1 161 LYS n 1 162 ALA n 1 163 SER n 1 164 THR n 1 165 GLY n 1 166 CYS n 1 167 LEU n 1 168 ILE n 1 169 ILE n 1 170 PRO n 1 171 ASN n 1 172 PHE n 1 173 SER n 1 174 ILE n 1 175 GLY n 1 176 MET n 1 177 VAL n 1 178 LEU n 1 179 LEU n 1 180 GLN n 1 181 GLN n 1 182 ALA n 1 183 ALA n 1 184 VAL n 1 185 THR n 1 186 ALA n 1 187 SER n 1 188 GLN n 1 189 TYR n 1 190 PHE n 1 191 ASP n 1 192 HIS n 1 193 VAL n 1 194 GLU n 1 195 ILE n 1 196 ILE n 1 197 GLU n 1 198 LEU n 1 199 HIS n 1 200 HIS n 1 201 ASN n 1 202 GLN n 1 203 LYS n 1 204 ALA n 1 205 ASP n 1 206 ALA n 1 207 PRO n 1 208 SER n 1 209 GLY n 1 210 THR n 1 211 ALA n 1 212 ILE n 1 213 GLN n 1 214 THR n 1 215 ALA n 1 216 GLU n 1 217 LEU n 1 218 LEU n 1 219 ALA n 1 220 GLU n 1 221 LEU n 1 222 GLY n 1 223 LYS n 1 224 THR n 1 225 PHE n 1 226 ASN n 1 227 SER n 1 228 ALA n 1 229 ILE n 1 230 VAL n 1 231 GLU n 1 232 GLU n 1 233 THR n 1 234 GLU n 1 235 LYS n 1 236 ILE n 1 237 PRO n 1 238 GLY n 1 239 ALA n 1 240 ARG n 1 241 GLY n 1 242 SER n 1 243 LEU n 1 244 ALA n 1 245 GLY n 1 246 GLU n 1 247 GLY n 1 248 ILE n 1 249 ARG n 1 250 ILE n 1 251 HIS n 1 252 SER n 1 253 VAL n 1 254 ARG n 1 255 LEU n 1 256 PRO n 1 257 GLY n 1 258 LEU n 1 259 ILE n 1 260 ALA n 1 261 HIS n 1 262 GLN n 1 263 GLU n 1 264 VAL n 1 265 ILE n 1 266 PHE n 1 267 GLY n 1 268 ALA n 1 269 PRO n 1 270 GLY n 1 271 GLN n 1 272 ILE n 1 273 TYR n 1 274 THR n 1 275 LEU n 1 276 ARG n 1 277 HIS n 1 278 ASP n 1 279 THR n 1 280 SER n 1 281 ASP n 1 282 ARG n 1 283 ALA n 1 284 CYS n 1 285 TYR n 1 286 MET n 1 287 PRO n 1 288 GLY n 1 289 VAL n 1 290 LEU n 1 291 LEU n 1 292 ALA n 1 293 ILE n 1 294 ARG n 1 295 LYS n 1 296 VAL n 1 297 LEU n 1 298 GLN n 1 299 LEU n 1 300 LYS n 1 301 SER n 1 302 LEU n 1 303 VAL n 1 304 TYR n 1 305 GLY n 1 306 LEU n 1 307 GLU n 1 308 LYS n 1 309 ILE n 1 310 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 310 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dapB, Ava_0474' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 29413 / PCC 7937' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anabaena variabilis (strain ATCC 29413 / PCC 7937)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 240292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type b _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pLys _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 2 ? ? ? A . n A 1 2 ARG 2 3 ? ? ? A . n A 1 3 GLY 3 4 ? ? ? A . n A 1 4 SER 4 5 ? ? ? A . n A 1 5 HIS 5 6 ? ? ? A . n A 1 6 HIS 6 7 ? ? ? A . n A 1 7 HIS 7 8 ? ? ? A . n A 1 8 HIS 8 9 ? ? ? A . n A 1 9 HIS 9 10 ? ? ? A . n A 1 10 HIS 10 11 ? ? ? A . n A 1 11 GLY 11 12 ? ? ? A . n A 1 12 MET 12 13 ? ? ? A . n A 1 13 ALA 13 14 ? ? ? A . n A 1 14 SER 14 15 ? ? ? A . n A 1 15 MET 15 16 ? ? ? A . n A 1 16 THR 16 17 ? ? ? A . n A 1 17 GLY 17 18 ? ? ? A . n A 1 18 GLY 18 19 ? ? ? A . n A 1 19 GLN 19 20 ? ? ? A . n A 1 20 GLN 20 21 ? ? ? A . n A 1 21 MET 21 22 ? ? ? A . n A 1 22 GLY 22 23 ? ? ? A . n A 1 23 ARG 23 24 ? ? ? A . n A 1 24 ASP 24 25 ? ? ? A . n A 1 25 LEU 25 26 ? ? ? A . n A 1 26 TYR 26 27 ? ? ? A . n A 1 27 ASP 27 28 ? ? ? A . n A 1 28 ASP 28 29 ? ? ? A . n A 1 29 ASP 29 30 ? ? ? A . n A 1 30 ASP 30 31 ? ? ? A . n A 1 31 LYS 31 32 ? ? ? A . n A 1 32 ASP 32 33 ? ? ? A . n A 1 33 PRO 33 34 ? ? ? A . n A 1 34 THR 34 35 ? ? ? A . n A 1 35 ASN 35 36 ? ? ? A . n A 1 36 GLN 36 37 ? ? ? A . n A 1 37 ALA 37 38 38 ALA ALA A . n A 1 38 PRO 38 39 39 PRO PRO A . n A 1 39 ILE 39 40 40 ILE ILE A . n A 1 40 PRO 40 41 41 PRO PRO A . n A 1 41 VAL 41 42 42 VAL VAL A . n A 1 42 ILE 42 43 43 ILE ILE A . n A 1 43 VAL 43 44 44 VAL VAL A . n A 1 44 ASN 44 45 45 ASN ASN A . n A 1 45 GLY 45 46 46 GLY GLY A . n A 1 46 ALA 46 47 47 ALA ALA A . n A 1 47 ALA 47 48 48 ALA ALA A . n A 1 48 GLY 48 49 49 GLY GLY A . n A 1 49 LYS 49 50 50 LYS LYS A . n A 1 50 MET 50 51 51 MET MET A . n A 1 51 GLY 51 52 52 GLY GLY A . n A 1 52 ARG 52 53 53 ARG ARG A . n A 1 53 GLU 53 54 54 GLU GLU A . n A 1 54 VAL 54 55 55 VAL VAL A . n A 1 55 VAL 55 56 56 VAL VAL A . n A 1 56 LYS 56 57 57 LYS LYS A . n A 1 57 ALA 57 58 58 ALA ALA A . n A 1 58 ILE 58 59 59 ILE ILE A . n A 1 59 ALA 59 60 60 ALA ALA A . n A 1 60 GLN 60 61 61 GLN GLN A . n A 1 61 ALA 61 62 62 ALA ALA A . n A 1 62 PRO 62 63 63 PRO PRO A . n A 1 63 ASP 63 64 64 ASP ASP A . n A 1 64 LEU 64 65 65 LEU LEU A . n A 1 65 ASN 65 66 66 ASN ASN A . n A 1 66 LEU 66 67 67 LEU LEU A . n A 1 67 LEU 67 68 68 LEU LEU A . n A 1 68 GLY 68 69 69 GLY GLY A . n A 1 69 ALA 69 70 70 ALA ALA A . n A 1 70 ILE 70 71 71 ILE ILE A . n A 1 71 ASP 71 72 72 ASP ASP A . n A 1 72 SER 72 73 73 SER SER A . n A 1 73 SER 73 74 74 SER SER A . n A 1 74 PRO 74 75 75 PRO PRO A . n A 1 75 GLU 75 76 76 GLU GLU A . n A 1 76 HIS 76 77 77 HIS HIS A . n A 1 77 GLN 77 78 78 GLN GLN A . n A 1 78 GLY 78 79 79 GLY GLY A . n A 1 79 LYS 79 80 80 LYS LYS A . n A 1 80 ASP 80 81 81 ASP ASP A . n A 1 81 ALA 81 82 82 ALA ALA A . n A 1 82 GLY 82 83 83 GLY GLY A . n A 1 83 GLU 83 84 84 GLU GLU A . n A 1 84 LEU 84 85 85 LEU LEU A . n A 1 85 ALA 85 86 86 ALA ALA A . n A 1 86 GLY 86 87 87 GLY GLY A . n A 1 87 LEU 87 88 88 LEU LEU A . n A 1 88 SER 88 89 89 SER SER A . n A 1 89 GLU 89 90 90 GLU GLU A . n A 1 90 PRO 90 91 91 PRO PRO A . n A 1 91 LEU 91 92 92 LEU LEU A . n A 1 92 GLU 92 93 93 GLU GLU A . n A 1 93 VAL 93 94 94 VAL VAL A . n A 1 94 PRO 94 95 95 PRO PRO A . n A 1 95 ILE 95 96 96 ILE ILE A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 ASN 97 98 98 ASN ASN A . n A 1 98 GLN 98 99 99 GLN GLN A . n A 1 99 LEU 99 100 100 LEU LEU A . n A 1 100 GLU 100 101 101 GLU GLU A . n A 1 101 PRO 101 102 102 PRO PRO A . n A 1 102 MET 102 103 103 MET MET A . n A 1 103 LEU 103 104 104 LEU LEU A . n A 1 104 GLY 104 105 105 GLY GLY A . n A 1 105 TYR 105 106 106 TYR TYR A . n A 1 106 VAL 106 107 107 VAL VAL A . n A 1 107 ALA 107 108 108 ALA ALA A . n A 1 108 GLY 108 109 109 GLY GLY A . n A 1 109 GLU 109 110 110 GLU GLU A . n A 1 110 ARG 110 111 111 ARG ARG A . n A 1 111 GLN 111 112 112 GLN GLN A . n A 1 112 GLY 112 113 113 GLY GLY A . n A 1 113 PRO 113 114 114 PRO PRO A . n A 1 114 PRO 114 115 115 PRO PRO A . n A 1 115 GLY 115 116 116 GLY GLY A . n A 1 116 VAL 116 117 117 VAL VAL A . n A 1 117 ILE 117 118 118 ILE ILE A . n A 1 118 VAL 118 119 119 VAL VAL A . n A 1 119 ASP 119 120 120 ASP ASP A . n A 1 120 PHE 120 121 121 PHE PHE A . n A 1 121 THR 121 122 122 THR THR A . n A 1 122 HIS 122 123 123 HIS HIS A . n A 1 123 PRO 123 124 124 PRO PRO A . n A 1 124 ASP 124 125 125 ASP ASP A . n A 1 125 SER 125 126 126 SER SER A . n A 1 126 VAL 126 127 127 VAL VAL A . n A 1 127 TYR 127 128 128 TYR TYR A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 ASN 129 130 130 ASN ASN A . n A 1 130 VAL 130 131 131 VAL VAL A . n A 1 131 ARG 131 132 132 ARG ARG A . n A 1 132 SER 132 133 133 SER SER A . n A 1 133 ALA 133 134 134 ALA ALA A . n A 1 134 ILE 134 135 135 ILE ILE A . n A 1 135 ALA 135 136 136 ALA ALA A . n A 1 136 TYR 136 137 137 TYR TYR A . n A 1 137 GLY 137 138 138 GLY GLY A . n A 1 138 ILE 138 139 139 ILE ILE A . n A 1 139 ARG 139 140 140 ARG ARG A . n A 1 140 PRO 140 141 141 PRO PRO A . n A 1 141 VAL 141 142 142 VAL VAL A . n A 1 142 VAL 142 143 143 VAL VAL A . n A 1 143 GLY 143 144 144 GLY GLY A . n A 1 144 THR 144 145 145 THR THR A . n A 1 145 THR 145 146 146 THR THR A . n A 1 146 GLY 146 147 147 GLY GLY A . n A 1 147 LEU 147 148 148 LEU LEU A . n A 1 148 SER 148 149 149 SER SER A . n A 1 149 PRO 149 150 150 PRO PRO A . n A 1 150 ALA 150 151 151 ALA ALA A . n A 1 151 GLN 151 152 152 GLN GLN A . n A 1 152 ILE 152 153 153 ILE ILE A . n A 1 153 GLN 153 154 154 GLN GLN A . n A 1 154 ASN 154 155 155 ASN ASN A . n A 1 155 LEU 155 156 156 LEU LEU A . n A 1 156 ALA 156 157 157 ALA ALA A . n A 1 157 ASP 157 158 158 ASP ASP A . n A 1 158 PHE 158 159 159 PHE PHE A . n A 1 159 ALA 159 160 160 ALA ALA A . n A 1 160 GLU 160 161 161 GLU GLU A . n A 1 161 LYS 161 162 162 LYS LYS A . n A 1 162 ALA 162 163 163 ALA ALA A . n A 1 163 SER 163 164 164 SER SER A . n A 1 164 THR 164 165 165 THR THR A . n A 1 165 GLY 165 166 166 GLY GLY A . n A 1 166 CYS 166 167 167 CYS CYS A . n A 1 167 LEU 167 168 168 LEU LEU A . n A 1 168 ILE 168 169 169 ILE ILE A . n A 1 169 ILE 169 170 170 ILE ILE A . n A 1 170 PRO 170 171 171 PRO PRO A . n A 1 171 ASN 171 172 172 ASN ASN A . n A 1 172 PHE 172 173 173 PHE PHE A . n A 1 173 SER 173 174 174 SER SER A . n A 1 174 ILE 174 175 175 ILE ILE A . n A 1 175 GLY 175 176 176 GLY GLY A . n A 1 176 MET 176 177 177 MET MET A . n A 1 177 VAL 177 178 178 VAL VAL A . n A 1 178 LEU 178 179 179 LEU LEU A . n A 1 179 LEU 179 180 180 LEU LEU A . n A 1 180 GLN 180 181 181 GLN GLN A . n A 1 181 GLN 181 182 182 GLN GLN A . n A 1 182 ALA 182 183 183 ALA ALA A . n A 1 183 ALA 183 184 184 ALA ALA A . n A 1 184 VAL 184 185 185 VAL VAL A . n A 1 185 THR 185 186 186 THR THR A . n A 1 186 ALA 186 187 187 ALA ALA A . n A 1 187 SER 187 188 188 SER SER A . n A 1 188 GLN 188 189 189 GLN GLN A . n A 1 189 TYR 189 190 190 TYR TYR A . n A 1 190 PHE 190 191 191 PHE PHE A . n A 1 191 ASP 191 192 192 ASP ASP A . n A 1 192 HIS 192 193 193 HIS HIS A . n A 1 193 VAL 193 194 194 VAL VAL A . n A 1 194 GLU 194 195 195 GLU GLU A . n A 1 195 ILE 195 196 196 ILE ILE A . n A 1 196 ILE 196 197 197 ILE ILE A . n A 1 197 GLU 197 198 198 GLU GLU A . n A 1 198 LEU 198 199 199 LEU LEU A . n A 1 199 HIS 199 200 200 HIS HIS A . n A 1 200 HIS 200 201 201 HIS HIS A . n A 1 201 ASN 201 202 202 ASN ASN A . n A 1 202 GLN 202 203 203 GLN GLN A . n A 1 203 LYS 203 204 204 LYS LYS A . n A 1 204 ALA 204 205 205 ALA ALA A . n A 1 205 ASP 205 206 206 ASP ASP A . n A 1 206 ALA 206 207 207 ALA ALA A . n A 1 207 PRO 207 208 208 PRO PRO A . n A 1 208 SER 208 209 209 SER SER A . n A 1 209 GLY 209 210 210 GLY GLY A . n A 1 210 THR 210 211 211 THR THR A . n A 1 211 ALA 211 212 212 ALA ALA A . n A 1 212 ILE 212 213 213 ILE ILE A . n A 1 213 GLN 213 214 214 GLN GLN A . n A 1 214 THR 214 215 215 THR THR A . n A 1 215 ALA 215 216 216 ALA ALA A . n A 1 216 GLU 216 217 217 GLU GLU A . n A 1 217 LEU 217 218 218 LEU LEU A . n A 1 218 LEU 218 219 219 LEU LEU A . n A 1 219 ALA 219 220 220 ALA ALA A . n A 1 220 GLU 220 221 221 GLU GLU A . n A 1 221 LEU 221 222 222 LEU LEU A . n A 1 222 GLY 222 223 223 GLY GLY A . n A 1 223 LYS 223 224 224 LYS LYS A . n A 1 224 THR 224 225 225 THR THR A . n A 1 225 PHE 225 226 226 PHE PHE A . n A 1 226 ASN 226 227 227 ASN ASN A . n A 1 227 SER 227 228 228 SER SER A . n A 1 228 ALA 228 229 229 ALA ALA A . n A 1 229 ILE 229 230 230 ILE ILE A . n A 1 230 VAL 230 231 231 VAL VAL A . n A 1 231 GLU 231 232 232 GLU GLU A . n A 1 232 GLU 232 233 233 GLU GLU A . n A 1 233 THR 233 234 234 THR THR A . n A 1 234 GLU 234 235 235 GLU GLU A . n A 1 235 LYS 235 236 236 LYS LYS A . n A 1 236 ILE 236 237 237 ILE ILE A . n A 1 237 PRO 237 238 238 PRO PRO A . n A 1 238 GLY 238 239 239 GLY GLY A . n A 1 239 ALA 239 240 240 ALA ALA A . n A 1 240 ARG 240 241 241 ARG ARG A . n A 1 241 GLY 241 242 242 GLY GLY A . n A 1 242 SER 242 243 243 SER SER A . n A 1 243 LEU 243 244 244 LEU LEU A . n A 1 244 ALA 244 245 245 ALA ALA A . n A 1 245 GLY 245 246 246 GLY GLY A . n A 1 246 GLU 246 247 247 GLU GLU A . n A 1 247 GLY 247 248 248 GLY GLY A . n A 1 248 ILE 248 249 249 ILE ILE A . n A 1 249 ARG 249 250 250 ARG ARG A . n A 1 250 ILE 250 251 251 ILE ILE A . n A 1 251 HIS 251 252 252 HIS HIS A . n A 1 252 SER 252 253 253 SER SER A . n A 1 253 VAL 253 254 254 VAL VAL A . n A 1 254 ARG 254 255 255 ARG ARG A . n A 1 255 LEU 255 256 256 LEU LEU A . n A 1 256 PRO 256 257 257 PRO PRO A . n A 1 257 GLY 257 258 258 GLY GLY A . n A 1 258 LEU 258 259 259 LEU LEU A . n A 1 259 ILE 259 260 260 ILE ILE A . n A 1 260 ALA 260 261 261 ALA ALA A . n A 1 261 HIS 261 262 262 HIS HIS A . n A 1 262 GLN 262 263 263 GLN GLN A . n A 1 263 GLU 263 264 264 GLU GLU A . n A 1 264 VAL 264 265 265 VAL VAL A . n A 1 265 ILE 265 266 266 ILE ILE A . n A 1 266 PHE 266 267 267 PHE PHE A . n A 1 267 GLY 267 268 268 GLY GLY A . n A 1 268 ALA 268 269 269 ALA ALA A . n A 1 269 PRO 269 270 270 PRO PRO A . n A 1 270 GLY 270 271 271 GLY GLY A . n A 1 271 GLN 271 272 272 GLN GLN A . n A 1 272 ILE 272 273 273 ILE ILE A . n A 1 273 TYR 273 274 274 TYR TYR A . n A 1 274 THR 274 275 275 THR THR A . n A 1 275 LEU 275 276 276 LEU LEU A . n A 1 276 ARG 276 277 277 ARG ARG A . n A 1 277 HIS 277 278 278 HIS HIS A . n A 1 278 ASP 278 279 279 ASP ASP A . n A 1 279 THR 279 280 280 THR THR A . n A 1 280 SER 280 281 281 SER SER A . n A 1 281 ASP 281 282 282 ASP ASP A . n A 1 282 ARG 282 283 283 ARG ARG A . n A 1 283 ALA 283 284 284 ALA ALA A . n A 1 284 CYS 284 285 285 CYS CYS A . n A 1 285 TYR 285 286 286 TYR TYR A . n A 1 286 MET 286 287 287 MET MET A . n A 1 287 PRO 287 288 288 PRO PRO A . n A 1 288 GLY 288 289 289 GLY GLY A . n A 1 289 VAL 289 290 290 VAL VAL A . n A 1 290 LEU 290 291 291 LEU LEU A . n A 1 291 LEU 291 292 292 LEU LEU A . n A 1 292 ALA 292 293 293 ALA ALA A . n A 1 293 ILE 293 294 294 ILE ILE A . n A 1 294 ARG 294 295 295 ARG ARG A . n A 1 295 LYS 295 296 296 LYS LYS A . n A 1 296 VAL 296 297 297 VAL VAL A . n A 1 297 LEU 297 298 298 LEU LEU A . n A 1 298 GLN 298 299 299 GLN GLN A . n A 1 299 LEU 299 300 300 LEU LEU A . n A 1 300 LYS 300 301 301 LYS LYS A . n A 1 301 SER 301 302 302 SER SER A . n A 1 302 LEU 302 303 303 LEU LEU A . n A 1 303 VAL 303 304 304 VAL VAL A . n A 1 304 TYR 304 305 305 TYR TYR A . n A 1 305 GLY 305 306 306 GLY GLY A . n A 1 306 LEU 306 307 307 LEU LEU A . n A 1 307 GLU 307 308 308 GLU GLU A . n A 1 308 LYS 308 309 309 LYS LYS A . n A 1 309 ILE 309 310 310 ILE ILE A . n A 1 310 LEU 310 311 311 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MG A . C 3 HOH 1 501 1 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0073 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5KT0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.728 _cell.length_a_esd ? _cell.length_b 89.361 _cell.length_b_esd ? _cell.length_c 95.917 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KT0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KT0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 281 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '21% PEG3350, 0.2 M lithium sulphate, 0.1 M bis-tris chloride pH 5.5.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5KT0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.82 _reflns.d_resolution_low 55.50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7762 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.18 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.76 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.32 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.01 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.34 _refine.B_iso_max ? _refine.B_iso_mean 42.395 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.905 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5KT0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.83 _refine.ls_d_res_low 2.899 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7280 _refine.ls_number_reflns_R_free 452 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.36 _refine.ls_percent_reflns_R_free 5.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.18629 _refine.ls_R_factor_R_free 0.24346 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.18263 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.373 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 15.370 _refine.overall_SU_ML 0.301 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2040 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 2042 _refine_hist.d_res_high 2.83 _refine_hist.d_res_low 2.899 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.019 2078 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 2047 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.503 1.981 2827 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.813 3.000 4716 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.195 5.000 273 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.440 25.000 82 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.688 15.000 340 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.356 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 332 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.021 2369 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 429 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.674 4.101 1095 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.673 4.100 1094 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.422 6.146 1367 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.421 6.146 1368 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.677 4.441 983 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.676 4.441 984 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.553 6.512 1461 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.060 32.646 2207 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.059 32.652 2208 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.827 _refine_ls_shell.d_res_low 2.899 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 32 _refine_ls_shell.number_reflns_R_work 520 _refine_ls_shell.percent_reflns_obs 97.01 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.288 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.279 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5KT0 _struct.title 'Dihydrodipicolinate reductase from the industrial and evolutionarily important cyanobacteria Anabaena variabilis.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KT0 _struct_keywords.text 'DHDPR, Diaminopimelate biosynthesis pathway, enzyme, cyanobacteria, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DAPB_ANAVT _struct_ref.pdbx_db_accession Q3MFY8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TNQAPIPVIVNGAAGKMGREVVKAIAQAPDLNLLGAIDSSPEHQGKDAGELAGLSEPLEVPITNQLEPMLGYVAGERQGP PGVIVDFTHPDSVYDNVRSAIAYGIRPVVGTTGLSPAQIQNLADFAEKASTGCLIIPNFSIGMVLLQQAAVTASQYFDHV EIIELHHNQKADAPSGTAIQTAELLAELGKTFNSAIVEETEKIPGARGSLAGEGIRIHSVRLPGLIAHQEVIFGAPGQIY TLRHDTSDRACYMPGVLLAIRKVLQLKSLVYGLEKIL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KT0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 34 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 310 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q3MFY8 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 278 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 35 _struct_ref_seq.pdbx_auth_seq_align_end 311 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KT0 MET A 1 ? UNP Q3MFY8 ? ? 'initiating methionine' 2 1 1 5KT0 ARG A 2 ? UNP Q3MFY8 ? ? 'expression tag' 3 2 1 5KT0 GLY A 3 ? UNP Q3MFY8 ? ? 'expression tag' 4 3 1 5KT0 SER A 4 ? UNP Q3MFY8 ? ? 'expression tag' 5 4 1 5KT0 HIS A 5 ? UNP Q3MFY8 ? ? 'expression tag' 6 5 1 5KT0 HIS A 6 ? UNP Q3MFY8 ? ? 'expression tag' 7 6 1 5KT0 HIS A 7 ? UNP Q3MFY8 ? ? 'expression tag' 8 7 1 5KT0 HIS A 8 ? UNP Q3MFY8 ? ? 'expression tag' 9 8 1 5KT0 HIS A 9 ? UNP Q3MFY8 ? ? 'expression tag' 10 9 1 5KT0 HIS A 10 ? UNP Q3MFY8 ? ? 'expression tag' 11 10 1 5KT0 GLY A 11 ? UNP Q3MFY8 ? ? 'expression tag' 12 11 1 5KT0 MET A 12 ? UNP Q3MFY8 ? ? 'expression tag' 13 12 1 5KT0 ALA A 13 ? UNP Q3MFY8 ? ? 'expression tag' 14 13 1 5KT0 SER A 14 ? UNP Q3MFY8 ? ? 'expression tag' 15 14 1 5KT0 MET A 15 ? UNP Q3MFY8 ? ? 'expression tag' 16 15 1 5KT0 THR A 16 ? UNP Q3MFY8 ? ? 'expression tag' 17 16 1 5KT0 GLY A 17 ? UNP Q3MFY8 ? ? 'expression tag' 18 17 1 5KT0 GLY A 18 ? UNP Q3MFY8 ? ? 'expression tag' 19 18 1 5KT0 GLN A 19 ? UNP Q3MFY8 ? ? 'expression tag' 20 19 1 5KT0 GLN A 20 ? UNP Q3MFY8 ? ? 'expression tag' 21 20 1 5KT0 MET A 21 ? UNP Q3MFY8 ? ? 'expression tag' 22 21 1 5KT0 GLY A 22 ? UNP Q3MFY8 ? ? 'expression tag' 23 22 1 5KT0 ARG A 23 ? UNP Q3MFY8 ? ? 'expression tag' 24 23 1 5KT0 ASP A 24 ? UNP Q3MFY8 ? ? 'expression tag' 25 24 1 5KT0 LEU A 25 ? UNP Q3MFY8 ? ? 'expression tag' 26 25 1 5KT0 TYR A 26 ? UNP Q3MFY8 ? ? 'expression tag' 27 26 1 5KT0 ASP A 27 ? UNP Q3MFY8 ? ? 'expression tag' 28 27 1 5KT0 ASP A 28 ? UNP Q3MFY8 ? ? 'expression tag' 29 28 1 5KT0 ASP A 29 ? UNP Q3MFY8 ? ? 'expression tag' 30 29 1 5KT0 ASP A 30 ? UNP Q3MFY8 ? ? 'expression tag' 31 30 1 5KT0 LYS A 31 ? UNP Q3MFY8 ? ? 'expression tag' 32 31 1 5KT0 ASP A 32 ? UNP Q3MFY8 ? ? 'expression tag' 33 32 1 5KT0 PRO A 33 ? UNP Q3MFY8 ? ? 'expression tag' 34 33 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -6 ? 1 'SSA (A^2)' 13790 ? 2 'ABSA (A^2)' 11990 ? 2 MORE -107 ? 2 'SSA (A^2)' 43580 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2,3,4 A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 72.7280000000 0.0000000000 -1.0000000000 0.0000000000 89.3610000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 72.7280000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 95.9170000000 4 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 89.3610000000 0.0000000000 0.0000000000 -1.0000000000 95.9170000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 48 ? ALA A 61 ? GLY A 49 ALA A 62 1 ? 14 HELX_P HELX_P2 AA2 SER A 73 ? GLN A 77 ? SER A 74 GLN A 78 5 ? 5 HELX_P HELX_P3 AA3 ASP A 80 ? ALA A 85 ? ASP A 81 ALA A 86 1 ? 6 HELX_P HELX_P4 AA4 GLN A 98 ? GLY A 108 ? GLN A 99 GLY A 109 1 ? 11 HELX_P HELX_P5 AA5 HIS A 122 ? TYR A 136 ? HIS A 123 TYR A 137 1 ? 15 HELX_P HELX_P6 AA6 SER A 148 ? SER A 163 ? SER A 149 SER A 164 1 ? 16 HELX_P HELX_P7 AA7 SER A 173 ? GLN A 188 ? SER A 174 GLN A 189 1 ? 16 HELX_P HELX_P8 AA8 SER A 208 ? GLU A 220 ? SER A 209 GLU A 221 1 ? 13 HELX_P HELX_P9 AA9 TYR A 285 ? LEU A 297 ? TYR A 286 LEU A 298 1 ? 13 HELX_P HELX_P10 AB1 LEU A 306 ? ILE A 309 ? LEU A 307 ILE A 310 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 206 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 207 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 207 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 208 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 14.21 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 64 ? ILE A 70 ? LEU A 65 ILE A 71 AA1 2 ILE A 39 ? ASN A 44 ? ILE A 40 ASN A 45 AA1 3 VAL A 116 ? ASP A 119 ? VAL A 117 ASP A 120 AA1 4 ARG A 139 ? GLY A 143 ? ARG A 140 GLY A 144 AA1 5 CYS A 166 ? ILE A 169 ? CYS A 167 ILE A 170 AA1 6 LEU A 302 ? TYR A 304 ? LEU A 303 TYR A 305 AA2 1 SER A 242 ? LEU A 243 ? SER A 243 LEU A 244 AA2 2 ARG A 249 ? ARG A 254 ? ARG A 250 ARG A 255 AA2 3 HIS A 192 ? HIS A 199 ? HIS A 193 HIS A 200 AA2 4 ALA A 260 ? ALA A 268 ? ALA A 261 ALA A 269 AA2 5 GLN A 271 ? THR A 279 ? GLN A 272 THR A 280 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASN A 65 ? O ASN A 66 N ILE A 39 ? N ILE A 40 AA1 2 3 N ILE A 42 ? N ILE A 43 O VAL A 116 ? O VAL A 117 AA1 3 4 N ILE A 117 ? N ILE A 118 O ARG A 139 ? O ARG A 140 AA1 4 5 N PRO A 140 ? N PRO A 141 O LEU A 167 ? O LEU A 168 AA1 5 6 N CYS A 166 ? N CYS A 167 O VAL A 303 ? O VAL A 304 AA2 1 2 N SER A 242 ? N SER A 243 O ILE A 250 ? O ILE A 251 AA2 2 3 O VAL A 253 ? O VAL A 254 N HIS A 199 ? N HIS A 200 AA2 3 4 N ILE A 196 ? N ILE A 197 O GLU A 263 ? O GLU A 264 AA2 4 5 N VAL A 264 ? N VAL A 265 O LEU A 275 ? O LEU A 276 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MG _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue MG A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLY A 209 ? GLY A 210 . ? 1_555 ? 2 AC1 2 THR A 210 ? THR A 211 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 50 ? ? -62.28 -71.57 2 1 SER A 89 ? ? 30.84 -122.86 3 1 LEU A 92 ? ? -66.18 -171.82 4 1 THR A 97 ? ? -67.18 -176.31 5 1 ASN A 98 ? ? -144.29 26.56 6 1 ALA A 108 ? ? -50.52 -6.60 7 1 GLU A 110 ? ? -36.22 113.68 8 1 GLN A 112 ? ? 88.65 -26.36 9 1 ASN A 227 ? ? 71.71 40.75 10 1 ALA A 245 ? ? -142.97 54.00 11 1 GLU A 247 ? ? 49.61 29.01 12 1 ILE A 260 ? ? -126.26 -80.50 13 1 ARG A 283 ? ? -85.17 37.41 14 1 GLU A 308 ? ? -68.53 1.19 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 501 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 2 ? A MET 1 2 1 Y 1 A ARG 3 ? A ARG 2 3 1 Y 1 A GLY 4 ? A GLY 3 4 1 Y 1 A SER 5 ? A SER 4 5 1 Y 1 A HIS 6 ? A HIS 5 6 1 Y 1 A HIS 7 ? A HIS 6 7 1 Y 1 A HIS 8 ? A HIS 7 8 1 Y 1 A HIS 9 ? A HIS 8 9 1 Y 1 A HIS 10 ? A HIS 9 10 1 Y 1 A HIS 11 ? A HIS 10 11 1 Y 1 A GLY 12 ? A GLY 11 12 1 Y 1 A MET 13 ? A MET 12 13 1 Y 1 A ALA 14 ? A ALA 13 14 1 Y 1 A SER 15 ? A SER 14 15 1 Y 1 A MET 16 ? A MET 15 16 1 Y 1 A THR 17 ? A THR 16 17 1 Y 1 A GLY 18 ? A GLY 17 18 1 Y 1 A GLY 19 ? A GLY 18 19 1 Y 1 A GLN 20 ? A GLN 19 20 1 Y 1 A GLN 21 ? A GLN 20 21 1 Y 1 A MET 22 ? A MET 21 22 1 Y 1 A GLY 23 ? A GLY 22 23 1 Y 1 A ARG 24 ? A ARG 23 24 1 Y 1 A ASP 25 ? A ASP 24 25 1 Y 1 A LEU 26 ? A LEU 25 26 1 Y 1 A TYR 27 ? A TYR 26 27 1 Y 1 A ASP 28 ? A ASP 27 28 1 Y 1 A ASP 29 ? A ASP 28 29 1 Y 1 A ASP 30 ? A ASP 29 30 1 Y 1 A ASP 31 ? A ASP 30 31 1 Y 1 A LYS 32 ? A LYS 31 32 1 Y 1 A ASP 33 ? A ASP 32 33 1 Y 1 A PRO 34 ? A PRO 33 34 1 Y 1 A THR 35 ? A THR 34 35 1 Y 1 A ASN 36 ? A ASN 35 36 1 Y 1 A GLN 37 ? A GLN 36 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _atom_sites.entry_id 5KT0 _atom_sites.fract_transf_matrix[1][1] 0.013750 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011191 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010426 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_