data_5KX4 # _entry.id 5KX4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5KX4 WWPDB D_1000222378 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2016-07-27 _pdbx_database_PDB_obs_spr.pdb_id 5KX4 _pdbx_database_PDB_obs_spr.replace_pdb_id 4LU2 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KX4 _pdbx_database_status.recvd_initial_deposition_date 2016-07-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Asojo, O.A.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'PLoS Negl Trop Dis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1935-2735 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first e0005374 _citation.page_last e0005374 _citation.title 'Structure of SALO, a leishmaniasis vaccine candidate from the sand fly Lutzomyia longipalpis.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pntd.0005374 _citation.pdbx_database_id_PubMed 28278244 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Asojo, O.A.' 1 primary 'Kelleher, A.' 2 primary 'Liu, Z.' 3 primary 'Pollet, J.' 4 primary 'Hudspeth, E.M.' 5 primary 'Rezende, W.C.' 6 primary 'Groen, M.J.' 7 primary 'Seid, C.A.' 8 primary 'Abdeladhim, M.' 9 primary 'Townsend, S.' 10 primary 'de Castro, W.' 11 primary 'Mendes-Sousa, A.' 12 primary 'Bartholomeu, D.C.' 13 primary 'Fujiwara, R.T.' 14 primary 'Bottazzi, M.E.' 15 primary 'Hotez, P.J.' 16 primary 'Zhan, B.' 17 primary 'Oliveira, F.' 18 primary 'Kamhawi, S.' 19 primary 'Valenzuela, J.G.' 20 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5KX4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.280 _cell.length_a_esd ? _cell.length_b 65.280 _cell.length_b_esd ? _cell.length_c 39.310 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KX4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 77 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '10.7 kDa salivary protein' 11924.151 2 ? ? ? ? 2 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EFSEDCENIFHDNAYLLKLDCEAGRVDPVEYDDISDEEIYEITVDVGVSSEDQEKVAKIIRECIAQVSTQDCTKFSEIYD CYMKKKICNYYPENMHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;EFSEDCENIFHDNAYLLKLDCEAGRVDPVEYDDISDEEIYEITVDVGVSSEDQEKVAKIIRECIAQVSTQDCTKFSEIYD CYMKKKICNYYPENMHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PHE n 1 3 SER n 1 4 GLU n 1 5 ASP n 1 6 CYS n 1 7 GLU n 1 8 ASN n 1 9 ILE n 1 10 PHE n 1 11 HIS n 1 12 ASP n 1 13 ASN n 1 14 ALA n 1 15 TYR n 1 16 LEU n 1 17 LEU n 1 18 LYS n 1 19 LEU n 1 20 ASP n 1 21 CYS n 1 22 GLU n 1 23 ALA n 1 24 GLY n 1 25 ARG n 1 26 VAL n 1 27 ASP n 1 28 PRO n 1 29 VAL n 1 30 GLU n 1 31 TYR n 1 32 ASP n 1 33 ASP n 1 34 ILE n 1 35 SER n 1 36 ASP n 1 37 GLU n 1 38 GLU n 1 39 ILE n 1 40 TYR n 1 41 GLU n 1 42 ILE n 1 43 THR n 1 44 VAL n 1 45 ASP n 1 46 VAL n 1 47 GLY n 1 48 VAL n 1 49 SER n 1 50 SER n 1 51 GLU n 1 52 ASP n 1 53 GLN n 1 54 GLU n 1 55 LYS n 1 56 VAL n 1 57 ALA n 1 58 LYS n 1 59 ILE n 1 60 ILE n 1 61 ARG n 1 62 GLU n 1 63 CYS n 1 64 ILE n 1 65 ALA n 1 66 GLN n 1 67 VAL n 1 68 SER n 1 69 THR n 1 70 GLN n 1 71 ASP n 1 72 CYS n 1 73 THR n 1 74 LYS n 1 75 PHE n 1 76 SER n 1 77 GLU n 1 78 ILE n 1 79 TYR n 1 80 ASP n 1 81 CYS n 1 82 TYR n 1 83 MET n 1 84 LYS n 1 85 LYS n 1 86 LYS n 1 87 ILE n 1 88 CYS n 1 89 ASN n 1 90 TYR n 1 91 TYR n 1 92 PRO n 1 93 GLU n 1 94 ASN n 1 95 MET n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 101 _entity_src_gen.gene_src_common_name 'Sand fly' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lutzomyia longipalpis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7200 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris GS115' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 644223 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5WPZ4_LUTLO _struct_ref.pdbx_db_accession Q5WPZ4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SEDCENIFHDNAYLLKLDCEAGRVDPVEYDDISDEEIYEITVDVGVSSEDQEKVAKIIRECIAQVSTQDCTKFSEIYDCY MKKKICNYYPENM ; _struct_ref.pdbx_align_begin 23 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5KX4 A 3 ? 95 ? Q5WPZ4 23 ? 115 ? 3 95 2 1 5KX4 B 3 ? 95 ? Q5WPZ4 23 ? 115 ? 3 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KX4 GLU A 1 ? UNP Q5WPZ4 ? ? 'expression tag' 1 1 1 5KX4 PHE A 2 ? UNP Q5WPZ4 ? ? 'expression tag' 2 2 1 5KX4 HIS A 96 ? UNP Q5WPZ4 ? ? 'expression tag' 96 3 1 5KX4 HIS A 97 ? UNP Q5WPZ4 ? ? 'expression tag' 97 4 1 5KX4 HIS A 98 ? UNP Q5WPZ4 ? ? 'expression tag' 98 5 1 5KX4 HIS A 99 ? UNP Q5WPZ4 ? ? 'expression tag' 99 6 1 5KX4 HIS A 100 ? UNP Q5WPZ4 ? ? 'expression tag' 100 7 1 5KX4 HIS A 101 ? UNP Q5WPZ4 ? ? 'expression tag' 101 8 2 5KX4 GLU B 1 ? UNP Q5WPZ4 ? ? 'expression tag' 1 9 2 5KX4 PHE B 2 ? UNP Q5WPZ4 ? ? 'expression tag' 2 10 2 5KX4 HIS B 96 ? UNP Q5WPZ4 ? ? 'expression tag' 96 11 2 5KX4 HIS B 97 ? UNP Q5WPZ4 ? ? 'expression tag' 97 12 2 5KX4 HIS B 98 ? UNP Q5WPZ4 ? ? 'expression tag' 98 13 2 5KX4 HIS B 99 ? UNP Q5WPZ4 ? ? 'expression tag' 99 14 2 5KX4 HIS B 100 ? UNP Q5WPZ4 ? ? 'expression tag' 100 15 2 5KX4 HIS B 101 ? UNP Q5WPZ4 ? ? 'expression tag' 101 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KX4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.02M calcium chloride, 30% v/v MPD and 0.1 M sodium acetate pH 4.6.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS HTC' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-12-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.514 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.514 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 29.4 _reflns.entry_id 5KX4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.94 _reflns.d_resolution_low 46.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12748 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.44 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 2.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.521 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5KX4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.940 _refine.ls_d_res_low 23.438 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12404 _refine.ls_number_reflns_R_free 684 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.50 _refine.ls_percent_reflns_R_free 5.51 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1665 _refine.ls_R_factor_R_free 0.1885 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1652 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.86 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.18 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1528 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1546 _refine_hist.d_res_high 1.940 _refine_hist.d_res_low 23.438 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1585 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.074 ? 2143 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.591 ? 989 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.057 ? 231 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 282 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9400 2.0897 . . 142 2327 100.00 . . . . . . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0897 2.2998 . . 147 2301 100.00 . . . 0.1743 . 0.1392 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2998 2.6322 . . 145 2337 100.00 . . . 0.2572 . 0.1799 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6322 3.3149 . . 114 2369 100.00 . . . 0.2096 . 0.1907 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3149 23.438 . . 136 2386 99.00 . . . 0.1666 . 0.1565 . . . . . . . . . . # _struct.entry_id 5KX4 _struct.title 'Structure of SALO' _struct.pdbx_descriptor '10.7 kDa salivary protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KX4 _struct_keywords.text 'Insect protein, odorant-binding protein' _struct_keywords.pdbx_keywords 'odorant-binding protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? ALA A 23 ? SER A 3 ALA A 23 1 ? 21 HELX_P HELX_P2 AA2 ASP A 27 ? ASP A 32 ? ASP A 27 ASP A 32 5 ? 6 HELX_P HELX_P3 AA3 SER A 35 ? THR A 43 ? SER A 35 THR A 43 1 ? 9 HELX_P HELX_P4 AA4 VAL A 44 ? GLY A 47 ? VAL A 44 GLY A 47 5 ? 4 HELX_P HELX_P5 AA5 ASP A 52 ? VAL A 67 ? ASP A 52 VAL A 67 1 ? 16 HELX_P HELX_P6 AA6 THR A 73 ? LYS A 85 ? THR A 73 LYS A 85 1 ? 13 HELX_P HELX_P7 AA7 LYS A 86 ? TYR A 91 ? LYS A 86 TYR A 91 5 ? 6 HELX_P HELX_P8 AA8 SER B 3 ? ALA B 23 ? SER B 3 ALA B 23 1 ? 21 HELX_P HELX_P9 AA9 ASP B 27 ? ASP B 32 ? ASP B 27 ASP B 32 5 ? 6 HELX_P HELX_P10 AB1 SER B 35 ? THR B 43 ? SER B 35 THR B 43 1 ? 9 HELX_P HELX_P11 AB2 VAL B 44 ? GLY B 47 ? VAL B 44 GLY B 47 5 ? 4 HELX_P HELX_P12 AB3 SER B 49 ? GLU B 51 ? SER B 49 GLU B 51 5 ? 3 HELX_P HELX_P13 AB4 ASP B 52 ? VAL B 67 ? ASP B 52 VAL B 67 1 ? 16 HELX_P HELX_P14 AB5 THR B 73 ? LYS B 85 ? THR B 73 LYS B 85 1 ? 13 HELX_P HELX_P15 AB6 LYS B 86 ? TYR B 91 ? LYS B 86 TYR B 91 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 6 A CYS 88 1_555 ? ? ? ? ? ? ? 1.856 ? disulf2 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 21 A CYS 72 1_555 ? ? ? ? ? ? ? 2.119 ? disulf3 disulf ? ? B CYS 21 SG ? ? ? 1_555 B CYS 72 SG ? ? B CYS 21 B CYS 72 1_555 ? ? ? ? ? ? ? 2.178 ? disulf4 disulf ? ? B CYS 63 SG ? ? ? 1_555 B CYS 81 SG ? ? B CYS 63 B CYS 81 1_555 ? ? ? ? ? ? ? 1.956 ? disulf5 disulf ? ? A CYS 63 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 63 A CYS 81 1_555 ? ? ? ? ? ? ? 1.547 sing disulf6 disulf ? ? B CYS 6 SG ? ? ? 1_555 B CYS 88 SG ? ? B CYS 6 B CYS 88 1_555 ? ? ? ? ? ? ? 1.783 sing # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 5KX4 _atom_sites.fract_transf_matrix[1][1] 0.015319 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015319 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025439 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n B 1 1 GLU 1 1 1 GLU GLU B . n B 1 2 PHE 2 2 2 PHE PHE B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 GLU 4 4 4 GLU GLU B . n B 1 5 ASP 5 5 5 ASP ASP B . n B 1 6 CYS 6 6 6 CYS CYS B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 ASN 8 8 8 ASN ASN B . n B 1 9 ILE 9 9 9 ILE ILE B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 HIS 11 11 11 HIS HIS B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 ASN 13 13 13 ASN ASN B . n B 1 14 ALA 14 14 14 ALA ALA B . n B 1 15 TYR 15 15 15 TYR TYR B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 ASP 20 20 20 ASP ASP B . n B 1 21 CYS 21 21 21 CYS CYS B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 GLY 24 24 24 GLY GLY B . n B 1 25 ARG 25 25 25 ARG ARG B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 TYR 31 31 31 TYR TYR B . n B 1 32 ASP 32 32 32 ASP ASP B . n B 1 33 ASP 33 33 33 ASP ASP B . n B 1 34 ILE 34 34 34 ILE ILE B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 ILE 39 39 39 ILE ILE B . n B 1 40 TYR 40 40 40 TYR TYR B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 THR 43 43 43 THR THR B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 VAL 46 46 46 VAL VAL B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 VAL 48 48 48 VAL VAL B . n B 1 49 SER 49 49 49 SER SER B . n B 1 50 SER 50 50 50 SER SER B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 ASP 52 52 52 ASP ASP B . n B 1 53 GLN 53 53 53 GLN GLN B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 ARG 61 61 61 ARG ARG B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 CYS 63 63 63 CYS CYS B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 ALA 65 65 65 ALA ALA B . n B 1 66 GLN 66 66 66 GLN GLN B . n B 1 67 VAL 67 67 67 VAL VAL B . n B 1 68 SER 68 68 68 SER SER B . n B 1 69 THR 69 69 69 THR THR B . n B 1 70 GLN 70 70 70 GLN GLN B . n B 1 71 ASP 71 71 71 ASP ASP B . n B 1 72 CYS 72 72 72 CYS CYS B . n B 1 73 THR 73 73 73 THR THR B . n B 1 74 LYS 74 74 74 LYS LYS B . n B 1 75 PHE 75 75 75 PHE PHE B . n B 1 76 SER 76 76 76 SER SER B . n B 1 77 GLU 77 77 77 GLU GLU B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 TYR 79 79 79 TYR TYR B . n B 1 80 ASP 80 80 80 ASP ASP B . n B 1 81 CYS 81 81 81 CYS CYS B . n B 1 82 TYR 82 82 82 TYR TYR B . n B 1 83 MET 83 83 83 MET MET B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 LYS 85 85 85 LYS LYS B . n B 1 86 LYS 86 86 86 LYS LYS B . n B 1 87 ILE 87 87 87 ILE ILE B . n B 1 88 CYS 88 88 88 CYS CYS B . n B 1 89 ASN 89 89 89 ASN ASN B . n B 1 90 TYR 90 90 90 TYR TYR B . n B 1 91 TYR 91 91 91 TYR TYR B . n B 1 92 PRO 92 92 92 PRO PRO B . n B 1 93 GLU 93 93 93 GLU GLU B . n B 1 94 ASN 94 94 ? ? ? B . n B 1 95 MET 95 95 ? ? ? B . n B 1 96 HIS 96 96 ? ? ? B . n B 1 97 HIS 97 97 ? ? ? B . n B 1 98 HIS 98 98 ? ? ? B . n B 1 99 HIS 99 99 ? ? ? B . n B 1 100 HIS 100 100 ? ? ? B . n B 1 101 HIS 101 101 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 201 5 HOH HOH A . C 2 HOH 2 202 28 HOH HOH A . C 2 HOH 3 203 15 HOH HOH A . C 2 HOH 4 204 3 HOH HOH A . C 2 HOH 5 205 1 HOH HOH A . C 2 HOH 6 206 29 HOH HOH A . C 2 HOH 7 207 2 HOH HOH A . C 2 HOH 8 208 16 HOH HOH A . C 2 HOH 9 209 9 HOH HOH A . C 2 HOH 10 210 13 HOH HOH A . C 2 HOH 11 211 12 HOH HOH A . C 2 HOH 12 212 4 HOH HOH A . D 2 HOH 1 201 20 HOH HOH B . D 2 HOH 2 202 7 HOH HOH B . D 2 HOH 3 203 10 HOH HOH B . D 2 HOH 4 204 14 HOH HOH B . D 2 HOH 5 205 6 HOH HOH B . D 2 HOH 6 206 18 HOH HOH B . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D 3 1 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 3 'ABSA (A^2)' 1730 ? 3 MORE -4 ? 3 'SSA (A^2)' 9750 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-27 2 'Structure model' 1 1 2016-08-10 3 'Structure model' 1 2 2017-07-05 4 'Structure model' 1 3 2017-11-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author 3 4 'Structure model' software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_abbrev' 2 3 'Structure model' '_citation.journal_id_CSD' 3 3 'Structure model' '_citation.journal_id_ISSN' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' 7 3 'Structure model' '_citation.pdbx_database_id_DOI' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation.year' 11 4 'Structure model' '_software.classification' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_2405: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? SHELXE ? ? ? . 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 93 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 93 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.180 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation -0.072 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 20 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 20 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 20 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.10 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.80 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 43 ? ? -115.49 -85.22 2 1 THR B 43 ? ? -123.05 -79.95 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 96 ? A HIS 96 2 1 Y 1 A HIS 97 ? A HIS 97 3 1 Y 1 A HIS 98 ? A HIS 98 4 1 Y 1 A HIS 99 ? A HIS 99 5 1 Y 1 A HIS 100 ? A HIS 100 6 1 Y 1 A HIS 101 ? A HIS 101 7 1 Y 1 B ASN 94 ? B ASN 94 8 1 Y 1 B MET 95 ? B MET 95 9 1 Y 1 B HIS 96 ? B HIS 96 10 1 Y 1 B HIS 97 ? B HIS 97 11 1 Y 1 B HIS 98 ? B HIS 98 12 1 Y 1 B HIS 99 ? B HIS 99 13 1 Y 1 B HIS 100 ? B HIS 100 14 1 Y 1 B HIS 101 ? B HIS 101 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #