data_5KZB # _entry.id 5KZB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5KZB pdb_00005kzb 10.2210/pdb5kzb/pdb WWPDB D_1000222952 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-26 2 'Structure model' 1 1 2019-02-06 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_audit_support.funding_organization' 14 4 'Structure model' '_database_2.pdbx_DOI' 15 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5KZB _pdbx_database_status.recvd_initial_deposition_date 2016-07-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5KZ9 PDB . unspecified 5KZA PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kingston, R.L.' 1 'Chan, J.' 2 'Vogt, V.M.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biophys. J.' _citation.journal_id_ASTM BIOJAU _citation.journal_id_CSD 0030 _citation.journal_id_ISSN 1542-0086 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 2004 _citation.page_last 2015 _citation.title 'Cholesterol Promotes Protein Binding by Affecting Membrane Electrostatics and Solvation Properties.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bpj.2017.08.055 _citation.pdbx_database_id_PubMed 29117524 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Doktorova, M.' 1 ? primary 'Heberle, F.A.' 2 ? primary 'Kingston, R.L.' 3 ? primary 'Khelashvili, G.' 4 ? primary 'Cuendet, M.A.' 5 ? primary 'Wen, Y.' 6 ? primary 'Katsaras, J.' 7 ? primary 'Feigenson, G.W.' 8 ? primary 'Vogt, V.M.' 9 ? primary 'Dick, R.A.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Virus Matrix Protein' 11089.856 1 ? ? 'UNP residues 2-102' ? 2 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SEFEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVL GALKAAREEQVTSEQAKFWLGLGG ; _entity_poly.pdbx_seq_one_letter_code_can ;SEFEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVL GALKAAREEQVTSEQAKFWLGLGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 PHE n 1 4 GLU n 1 5 ALA n 1 6 VAL n 1 7 ILE n 1 8 LYS n 1 9 VAL n 1 10 ILE n 1 11 SER n 1 12 SER n 1 13 ALA n 1 14 CYS n 1 15 LYS n 1 16 THR n 1 17 TYR n 1 18 CYS n 1 19 GLY n 1 20 LYS n 1 21 THR n 1 22 SER n 1 23 PRO n 1 24 SER n 1 25 LYS n 1 26 LYS n 1 27 GLU n 1 28 ILE n 1 29 GLY n 1 30 ALA n 1 31 MET n 1 32 LEU n 1 33 SER n 1 34 LEU n 1 35 LEU n 1 36 GLN n 1 37 LYS n 1 38 GLU n 1 39 GLY n 1 40 LEU n 1 41 LEU n 1 42 MET n 1 43 SER n 1 44 PRO n 1 45 SER n 1 46 ASP n 1 47 LEU n 1 48 TYR n 1 49 SER n 1 50 PRO n 1 51 GLY n 1 52 SER n 1 53 TRP n 1 54 ASP n 1 55 PRO n 1 56 ILE n 1 57 THR n 1 58 ALA n 1 59 ALA n 1 60 LEU n 1 61 SER n 1 62 GLN n 1 63 ARG n 1 64 ALA n 1 65 MET n 1 66 ILE n 1 67 LEU n 1 68 GLY n 1 69 LYS n 1 70 SER n 1 71 GLY n 1 72 GLU n 1 73 LEU n 1 74 LYS n 1 75 THR n 1 76 TRP n 1 77 GLY n 1 78 LEU n 1 79 VAL n 1 80 LEU n 1 81 GLY n 1 82 ALA n 1 83 LEU n 1 84 LYS n 1 85 ALA n 1 86 ALA n 1 87 ARG n 1 88 GLU n 1 89 GLU n 1 90 GLN n 1 91 VAL n 1 92 THR n 1 93 SER n 1 94 GLU n 1 95 GLN n 1 96 ALA n 1 97 LYS n 1 98 PHE n 1 99 TRP n 1 100 LEU n 1 101 GLY n 1 102 LEU n 1 103 GLY n 1 104 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name RSV-PrC _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gag-pro-pol _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Prague C' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rous sarcoma virus (strain Prague C)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11888 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -1 -1 SER SER A . n A 1 2 GLU 2 0 0 GLU GLU A . n A 1 3 PHE 3 1 1 PHE PHE A . n A 1 4 GLU 4 2 2 GLU GLU A . n A 1 5 ALA 5 3 3 ALA ALA A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 ILE 7 5 5 ILE ILE A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 VAL 9 7 7 VAL VAL A . n A 1 10 ILE 10 8 8 ILE ILE A . n A 1 11 SER 11 9 9 SER SER A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 CYS 14 12 12 CYS CYS A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 THR 16 14 14 THR THR A . n A 1 17 TYR 17 15 15 TYR TYR A . n A 1 18 CYS 18 16 16 CYS CYS A . n A 1 19 GLY 19 17 17 GLY GLY A . n A 1 20 LYS 20 18 18 LYS LYS A . n A 1 21 THR 21 19 19 THR THR A . n A 1 22 SER 22 20 20 SER SER A . n A 1 23 PRO 23 21 21 PRO PRO A . n A 1 24 SER 24 22 22 SER SER A . n A 1 25 LYS 25 23 23 LYS LYS A . n A 1 26 LYS 26 24 24 LYS LYS A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 ALA 30 28 28 ALA ALA A . n A 1 31 MET 31 29 29 MET MET A . n A 1 32 LEU 32 30 30 LEU LEU A . n A 1 33 SER 33 31 31 SER SER A . n A 1 34 LEU 34 32 32 LEU LEU A . n A 1 35 LEU 35 33 33 LEU LEU A . n A 1 36 GLN 36 34 34 GLN GLN A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 GLU 38 36 36 GLU GLU A . n A 1 39 GLY 39 37 37 GLY GLY A . n A 1 40 LEU 40 38 38 LEU LEU A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 MET 42 40 40 MET MET A . n A 1 43 SER 43 41 41 SER SER A . n A 1 44 PRO 44 42 42 PRO PRO A . n A 1 45 SER 45 43 43 SER SER A . n A 1 46 ASP 46 44 44 ASP ASP A . n A 1 47 LEU 47 45 45 LEU LEU A . n A 1 48 TYR 48 46 46 TYR TYR A . n A 1 49 SER 49 47 47 SER SER A . n A 1 50 PRO 50 48 48 PRO PRO A . n A 1 51 GLY 51 49 49 GLY GLY A . n A 1 52 SER 52 50 50 SER SER A . n A 1 53 TRP 53 51 51 TRP TRP A . n A 1 54 ASP 54 52 52 ASP ASP A . n A 1 55 PRO 55 53 53 PRO PRO A . n A 1 56 ILE 56 54 54 ILE ILE A . n A 1 57 THR 57 55 55 THR THR A . n A 1 58 ALA 58 56 56 ALA ALA A . n A 1 59 ALA 59 57 57 ALA ALA A . n A 1 60 LEU 60 58 58 LEU LEU A . n A 1 61 SER 61 59 59 SER SER A . n A 1 62 GLN 62 60 60 GLN GLN A . n A 1 63 ARG 63 61 61 ARG ARG A . n A 1 64 ALA 64 62 62 ALA ALA A . n A 1 65 MET 65 63 63 MET MET A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 GLY 68 66 66 GLY GLY A . n A 1 69 LYS 69 67 67 LYS LYS A . n A 1 70 SER 70 68 68 SER SER A . n A 1 71 GLY 71 69 69 GLY GLY A . n A 1 72 GLU 72 70 70 GLU GLU A . n A 1 73 LEU 73 71 71 LEU LEU A . n A 1 74 LYS 74 72 72 LYS LYS A . n A 1 75 THR 75 73 73 THR THR A . n A 1 76 TRP 76 74 74 TRP TRP A . n A 1 77 GLY 77 75 75 GLY GLY A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 VAL 79 77 77 VAL VAL A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 GLY 81 79 79 GLY GLY A . n A 1 82 ALA 82 80 80 ALA ALA A . n A 1 83 LEU 83 81 81 LEU LEU A . n A 1 84 LYS 84 82 82 LYS LYS A . n A 1 85 ALA 85 83 83 ALA ALA A . n A 1 86 ALA 86 84 84 ALA ALA A . n A 1 87 ARG 87 85 85 ARG ARG A . n A 1 88 GLU 88 86 86 GLU GLU A . n A 1 89 GLU 89 87 87 GLU GLU A . n A 1 90 GLN 90 88 88 GLN GLN A . n A 1 91 VAL 91 89 89 VAL VAL A . n A 1 92 THR 92 90 90 THR THR A . n A 1 93 SER 93 91 91 SER SER A . n A 1 94 GLU 94 92 92 GLU GLU A . n A 1 95 GLN 95 93 93 GLN GLN A . n A 1 96 ALA 96 94 94 ALA ALA A . n A 1 97 LYS 97 95 95 LYS LYS A . n A 1 98 PHE 98 96 96 PHE PHE A . n A 1 99 TRP 99 97 97 TRP TRP A . n A 1 100 LEU 100 98 98 LEU LEU A . n A 1 101 GLY 101 99 99 GLY GLY A . n A 1 102 LEU 102 100 100 LEU LEU A . n A 1 103 GLY 103 101 101 GLY GLY A . n A 1 104 GLY 104 102 102 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 2 HOH HOH A . B 2 HOH 2 202 1 HOH HOH A . B 2 HOH 3 203 3 HOH HOH A . B 2 HOH 4 204 6 HOH HOH A . B 2 HOH 5 205 4 HOH HOH A . B 2 HOH 6 206 5 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5KZB _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.392 _cell.length_a_esd ? _cell.length_b 67.392 _cell.length_b_esd ? _cell.length_c 220.769 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5KZB _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5KZB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 78.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.6 M Malonic acid /KOH pH 9.1, 0.1 M Boric acid /KOH pH 9.1' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2007-10-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54179 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54179 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5KZB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.20 _reflns.d_resolution_low 49.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4535 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.1 _reflns.pdbx_Rmerge_I_obs 0.132 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 4.94 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 4.94 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -9.87 _refine.B_iso_max ? _refine.B_iso_mean 74.738 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.945 _refine.correlation_coeff_Fo_to_Fc_free 0.906 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5KZB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.20 _refine.ls_d_res_low 49.7 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4279 _refine.ls_number_reflns_R_free 231 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.73 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20424 _refine.ls_R_factor_R_free 0.24851 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20193 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.563 _refine.pdbx_overall_ESU_R_Free 0.350 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.917 _refine.overall_SU_ML 0.267 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 776 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 782 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 49.7 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.020 806 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 798 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.695 1.996 1088 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.964 3.000 1857 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.574 5.000 107 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.183 25.600 25 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.327 15.000 154 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 29.180 15.000 2 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.069 0.200 123 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 896 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 158 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.573 7.238 422 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.560 7.229 421 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.390 10.838 528 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.391 10.842 529 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.099 7.593 384 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.089 7.590 384 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.944 11.102 559 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.437 67.445 3348 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 12.431 67.394 3341 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.203 _refine_ls_shell.d_res_low 3.286 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 18 _refine_ls_shell.number_reflns_R_work 301 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.354 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.359 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5KZB _struct.title 'Crystal structure of the Rous sarcoma virus matrix protein (aa 2-102). Space group I4122' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5KZB _struct_keywords.text 'Viral Protein; Matrix Protein; Membrane Associated Protein, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_RSVP _struct_ref.pdbx_db_accession P03354 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGAL KAAREEQVTSEQAKFWLGLGG ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5KZB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03354 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 102 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5KZB SER A 1 ? UNP P03354 ? ? 'expression tag' -1 1 1 5KZB GLU A 2 ? UNP P03354 ? ? 'expression tag' 0 2 1 5KZB PHE A 3 ? UNP P03354 ? ? 'expression tag' 1 3 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 8750 ? 2 MORE -74 ? 2 'SSA (A^2)' 18110 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2,3,4 A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? CYS A 18 ? SER A -1 CYS A 16 1 ? 18 HELX_P HELX_P2 AA2 SER A 24 ? GLU A 38 ? SER A 22 GLU A 36 1 ? 15 HELX_P HELX_P3 AA3 SER A 43 ? TYR A 48 ? SER A 41 TYR A 46 5 ? 6 HELX_P HELX_P4 AA4 SER A 49 ? GLY A 51 ? SER A 47 GLY A 49 5 ? 3 HELX_P HELX_P5 AA5 SER A 52 ? LEU A 67 ? SER A 50 LEU A 65 1 ? 16 HELX_P HELX_P6 AA6 SER A 70 ? GLN A 90 ? SER A 68 GLN A 88 1 ? 21 HELX_P HELX_P7 AA7 VAL A 91 ? GLY A 103 ? VAL A 89 GLY A 101 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER -1 ? ? OE1 A GLU 2 ? B 2.12 2 1 O A CYS 12 ? ? CB A CYS 16 ? ? 2.19 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 87 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 87 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.349 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.097 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 85 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 85 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 85 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.39 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 4.09 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 18 ? ? 54.07 -132.54 2 1 THR A 19 ? ? -38.63 146.71 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HOH O O N N 120 HOH H1 H N N 121 HOH H2 H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TRP N N N N 283 TRP CA C N S 284 TRP C C N N 285 TRP O O N N 286 TRP CB C N N 287 TRP CG C Y N 288 TRP CD1 C Y N 289 TRP CD2 C Y N 290 TRP NE1 N Y N 291 TRP CE2 C Y N 292 TRP CE3 C Y N 293 TRP CZ2 C Y N 294 TRP CZ3 C Y N 295 TRP CH2 C Y N 296 TRP OXT O N N 297 TRP H H N N 298 TRP H2 H N N 299 TRP HA H N N 300 TRP HB2 H N N 301 TRP HB3 H N N 302 TRP HD1 H N N 303 TRP HE1 H N N 304 TRP HE3 H N N 305 TRP HZ2 H N N 306 TRP HZ3 H N N 307 TRP HH2 H N N 308 TRP HXT H N N 309 TYR N N N N 310 TYR CA C N S 311 TYR C C N N 312 TYR O O N N 313 TYR CB C N N 314 TYR CG C Y N 315 TYR CD1 C Y N 316 TYR CD2 C Y N 317 TYR CE1 C Y N 318 TYR CE2 C Y N 319 TYR CZ C Y N 320 TYR OH O N N 321 TYR OXT O N N 322 TYR H H N N 323 TYR H2 H N N 324 TYR HA H N N 325 TYR HB2 H N N 326 TYR HB3 H N N 327 TYR HD1 H N N 328 TYR HD2 H N N 329 TYR HE1 H N N 330 TYR HE2 H N N 331 TYR HH H N N 332 TYR HXT H N N 333 VAL N N N N 334 VAL CA C N S 335 VAL C C N N 336 VAL O O N N 337 VAL CB C N N 338 VAL CG1 C N N 339 VAL CG2 C N N 340 VAL OXT O N N 341 VAL H H N N 342 VAL H2 H N N 343 VAL HA H N N 344 VAL HB H N N 345 VAL HG11 H N N 346 VAL HG12 H N N 347 VAL HG13 H N N 348 VAL HG21 H N N 349 VAL HG22 H N N 350 VAL HG23 H N N 351 VAL HXT H N N 352 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HOH O H1 sing N N 113 HOH O H2 sing N N 114 ILE N CA sing N N 115 ILE N H sing N N 116 ILE N H2 sing N N 117 ILE CA C sing N N 118 ILE CA CB sing N N 119 ILE CA HA sing N N 120 ILE C O doub N N 121 ILE C OXT sing N N 122 ILE CB CG1 sing N N 123 ILE CB CG2 sing N N 124 ILE CB HB sing N N 125 ILE CG1 CD1 sing N N 126 ILE CG1 HG12 sing N N 127 ILE CG1 HG13 sing N N 128 ILE CG2 HG21 sing N N 129 ILE CG2 HG22 sing N N 130 ILE CG2 HG23 sing N N 131 ILE CD1 HD11 sing N N 132 ILE CD1 HD12 sing N N 133 ILE CD1 HD13 sing N N 134 ILE OXT HXT sing N N 135 LEU N CA sing N N 136 LEU N H sing N N 137 LEU N H2 sing N N 138 LEU CA C sing N N 139 LEU CA CB sing N N 140 LEU CA HA sing N N 141 LEU C O doub N N 142 LEU C OXT sing N N 143 LEU CB CG sing N N 144 LEU CB HB2 sing N N 145 LEU CB HB3 sing N N 146 LEU CG CD1 sing N N 147 LEU CG CD2 sing N N 148 LEU CG HG sing N N 149 LEU CD1 HD11 sing N N 150 LEU CD1 HD12 sing N N 151 LEU CD1 HD13 sing N N 152 LEU CD2 HD21 sing N N 153 LEU CD2 HD22 sing N N 154 LEU CD2 HD23 sing N N 155 LEU OXT HXT sing N N 156 LYS N CA sing N N 157 LYS N H sing N N 158 LYS N H2 sing N N 159 LYS CA C sing N N 160 LYS CA CB sing N N 161 LYS CA HA sing N N 162 LYS C O doub N N 163 LYS C OXT sing N N 164 LYS CB CG sing N N 165 LYS CB HB2 sing N N 166 LYS CB HB3 sing N N 167 LYS CG CD sing N N 168 LYS CG HG2 sing N N 169 LYS CG HG3 sing N N 170 LYS CD CE sing N N 171 LYS CD HD2 sing N N 172 LYS CD HD3 sing N N 173 LYS CE NZ sing N N 174 LYS CE HE2 sing N N 175 LYS CE HE3 sing N N 176 LYS NZ HZ1 sing N N 177 LYS NZ HZ2 sing N N 178 LYS NZ HZ3 sing N N 179 LYS OXT HXT sing N N 180 MET N CA sing N N 181 MET N H sing N N 182 MET N H2 sing N N 183 MET CA C sing N N 184 MET CA CB sing N N 185 MET CA HA sing N N 186 MET C O doub N N 187 MET C OXT sing N N 188 MET CB CG sing N N 189 MET CB HB2 sing N N 190 MET CB HB3 sing N N 191 MET CG SD sing N N 192 MET CG HG2 sing N N 193 MET CG HG3 sing N N 194 MET SD CE sing N N 195 MET CE HE1 sing N N 196 MET CE HE2 sing N N 197 MET CE HE3 sing N N 198 MET OXT HXT sing N N 199 PHE N CA sing N N 200 PHE N H sing N N 201 PHE N H2 sing N N 202 PHE CA C sing N N 203 PHE CA CB sing N N 204 PHE CA HA sing N N 205 PHE C O doub N N 206 PHE C OXT sing N N 207 PHE CB CG sing N N 208 PHE CB HB2 sing N N 209 PHE CB HB3 sing N N 210 PHE CG CD1 doub Y N 211 PHE CG CD2 sing Y N 212 PHE CD1 CE1 sing Y N 213 PHE CD1 HD1 sing N N 214 PHE CD2 CE2 doub Y N 215 PHE CD2 HD2 sing N N 216 PHE CE1 CZ doub Y N 217 PHE CE1 HE1 sing N N 218 PHE CE2 CZ sing Y N 219 PHE CE2 HE2 sing N N 220 PHE CZ HZ sing N N 221 PHE OXT HXT sing N N 222 PRO N CA sing N N 223 PRO N CD sing N N 224 PRO N H sing N N 225 PRO CA C sing N N 226 PRO CA CB sing N N 227 PRO CA HA sing N N 228 PRO C O doub N N 229 PRO C OXT sing N N 230 PRO CB CG sing N N 231 PRO CB HB2 sing N N 232 PRO CB HB3 sing N N 233 PRO CG CD sing N N 234 PRO CG HG2 sing N N 235 PRO CG HG3 sing N N 236 PRO CD HD2 sing N N 237 PRO CD HD3 sing N N 238 PRO OXT HXT sing N N 239 SER N CA sing N N 240 SER N H sing N N 241 SER N H2 sing N N 242 SER CA C sing N N 243 SER CA CB sing N N 244 SER CA HA sing N N 245 SER C O doub N N 246 SER C OXT sing N N 247 SER CB OG sing N N 248 SER CB HB2 sing N N 249 SER CB HB3 sing N N 250 SER OG HG sing N N 251 SER OXT HXT sing N N 252 THR N CA sing N N 253 THR N H sing N N 254 THR N H2 sing N N 255 THR CA C sing N N 256 THR CA CB sing N N 257 THR CA HA sing N N 258 THR C O doub N N 259 THR C OXT sing N N 260 THR CB OG1 sing N N 261 THR CB CG2 sing N N 262 THR CB HB sing N N 263 THR OG1 HG1 sing N N 264 THR CG2 HG21 sing N N 265 THR CG2 HG22 sing N N 266 THR CG2 HG23 sing N N 267 THR OXT HXT sing N N 268 TRP N CA sing N N 269 TRP N H sing N N 270 TRP N H2 sing N N 271 TRP CA C sing N N 272 TRP CA CB sing N N 273 TRP CA HA sing N N 274 TRP C O doub N N 275 TRP C OXT sing N N 276 TRP CB CG sing N N 277 TRP CB HB2 sing N N 278 TRP CB HB3 sing N N 279 TRP CG CD1 doub Y N 280 TRP CG CD2 sing Y N 281 TRP CD1 NE1 sing Y N 282 TRP CD1 HD1 sing N N 283 TRP CD2 CE2 doub Y N 284 TRP CD2 CE3 sing Y N 285 TRP NE1 CE2 sing Y N 286 TRP NE1 HE1 sing N N 287 TRP CE2 CZ2 sing Y N 288 TRP CE3 CZ3 doub Y N 289 TRP CE3 HE3 sing N N 290 TRP CZ2 CH2 doub Y N 291 TRP CZ2 HZ2 sing N N 292 TRP CZ3 CH2 sing Y N 293 TRP CZ3 HZ3 sing N N 294 TRP CH2 HH2 sing N N 295 TRP OXT HXT sing N N 296 TYR N CA sing N N 297 TYR N H sing N N 298 TYR N H2 sing N N 299 TYR CA C sing N N 300 TYR CA CB sing N N 301 TYR CA HA sing N N 302 TYR C O doub N N 303 TYR C OXT sing N N 304 TYR CB CG sing N N 305 TYR CB HB2 sing N N 306 TYR CB HB3 sing N N 307 TYR CG CD1 doub Y N 308 TYR CG CD2 sing Y N 309 TYR CD1 CE1 sing Y N 310 TYR CD1 HD1 sing N N 311 TYR CD2 CE2 doub Y N 312 TYR CD2 HD2 sing N N 313 TYR CE1 CZ doub Y N 314 TYR CE1 HE1 sing N N 315 TYR CE2 CZ sing Y N 316 TYR CE2 HE2 sing N N 317 TYR CZ OH sing N N 318 TYR OH HH sing N N 319 TYR OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # _pdbx_audit_support.funding_organization 'Health Research Council (HRC)' _pdbx_audit_support.country 'New Zealand' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5KZB _atom_sites.fract_transf_matrix[1][1] 0.014839 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014839 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004530 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_