data_5L2S # _entry.id 5L2S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5L2S pdb_00005l2s 10.2210/pdb5l2s/pdb WWPDB D_1000223110 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-24 2 'Structure model' 1 1 2016-10-19 3 'Structure model' 1 2 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' entity 6 3 'Structure model' pdbx_entity_nonpoly 7 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_chem_comp.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_entity.pdbx_description' 5 3 'Structure model' '_pdbx_entity_nonpoly.name' 6 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5L2S _pdbx_database_status.recvd_initial_deposition_date 2016-08-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5L2W PDB . unspecified 5L2T PDB . unspecified 5L2I PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, P.' 1 'Ferre, R.A.' 2 'Deihl, W.' 3 'Yu, X.' 4 'He, Y.-A.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol.Cancer Ther.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1538-8514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 2273 _citation.page_last 2281 _citation.title 'Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1158/1535-7163.MCT-16-0300 _citation.pdbx_database_id_PubMed 27496135 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, P.' 1 ? primary 'Lee, N.V.' 2 ? primary 'Hu, W.' 3 ? primary 'Xu, M.' 4 ? primary 'Ferre, R.A.' 5 ? primary 'Lam, H.' 6 ? primary 'Bergqvist, S.' 7 ? primary 'Solowiej, J.' 8 ? primary 'Diehl, W.' 9 ? primary 'He, Y.A.' 10 ? primary 'Yu, X.' 11 ? primary 'Nagata, A.' 12 ? primary 'VanArsdale, T.' 13 ? primary 'Murray, B.W.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cyclin-dependent kinase 6' 35019.215 1 2.7.11.22 ? 'UNP residues 1-301' ? 2 non-polymer syn ;N-{5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl}-5-fluoro-4-[4-fluoro-2-methyl-1-(propan-2-yl)-1H-benzimidazol-6-yl]py rimidin-2-amine ; 506.593 1 ? ? ? ? 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cell division protein kinase 6,Serine/threonine-protein kinase PLSTIRE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLF DVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIK LADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLF DVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIK LADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-{5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl}-5-fluoro-4-[4-fluoro-2-methyl-1-(propan-2-yl)-1H-benzimidazol-6-yl]py rimidin-2-amine ; 6ZV 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 ASP n 1 5 GLY n 1 6 LEU n 1 7 CYS n 1 8 ARG n 1 9 ALA n 1 10 ASP n 1 11 GLN n 1 12 GLN n 1 13 TYR n 1 14 GLU n 1 15 CYS n 1 16 VAL n 1 17 ALA n 1 18 GLU n 1 19 ILE n 1 20 GLY n 1 21 GLU n 1 22 GLY n 1 23 ALA n 1 24 TYR n 1 25 GLY n 1 26 LYS n 1 27 VAL n 1 28 PHE n 1 29 LYS n 1 30 ALA n 1 31 ARG n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 ASN n 1 36 GLY n 1 37 GLY n 1 38 ARG n 1 39 PHE n 1 40 VAL n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 ARG n 1 45 VAL n 1 46 ARG n 1 47 VAL n 1 48 GLN n 1 49 THR n 1 50 GLY n 1 51 GLU n 1 52 GLU n 1 53 GLY n 1 54 MET n 1 55 PRO n 1 56 LEU n 1 57 SER n 1 58 THR n 1 59 ILE n 1 60 ARG n 1 61 GLU n 1 62 VAL n 1 63 ALA n 1 64 VAL n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 LEU n 1 69 GLU n 1 70 THR n 1 71 PHE n 1 72 GLU n 1 73 HIS n 1 74 PRO n 1 75 ASN n 1 76 VAL n 1 77 VAL n 1 78 ARG n 1 79 LEU n 1 80 PHE n 1 81 ASP n 1 82 VAL n 1 83 CYS n 1 84 THR n 1 85 VAL n 1 86 SER n 1 87 ARG n 1 88 THR n 1 89 ASP n 1 90 ARG n 1 91 GLU n 1 92 THR n 1 93 LYS n 1 94 LEU n 1 95 THR n 1 96 LEU n 1 97 VAL n 1 98 PHE n 1 99 GLU n 1 100 HIS n 1 101 VAL n 1 102 ASP n 1 103 GLN n 1 104 ASP n 1 105 LEU n 1 106 THR n 1 107 THR n 1 108 TYR n 1 109 LEU n 1 110 ASP n 1 111 LYS n 1 112 VAL n 1 113 PRO n 1 114 GLU n 1 115 PRO n 1 116 GLY n 1 117 VAL n 1 118 PRO n 1 119 THR n 1 120 GLU n 1 121 THR n 1 122 ILE n 1 123 LYS n 1 124 ASP n 1 125 MET n 1 126 MET n 1 127 PHE n 1 128 GLN n 1 129 LEU n 1 130 LEU n 1 131 ARG n 1 132 GLY n 1 133 LEU n 1 134 ASP n 1 135 PHE n 1 136 LEU n 1 137 HIS n 1 138 SER n 1 139 HIS n 1 140 ARG n 1 141 VAL n 1 142 VAL n 1 143 HIS n 1 144 ARG n 1 145 ASP n 1 146 LEU n 1 147 LYS n 1 148 PRO n 1 149 GLN n 1 150 ASN n 1 151 ILE n 1 152 LEU n 1 153 VAL n 1 154 THR n 1 155 SER n 1 156 SER n 1 157 GLY n 1 158 GLN n 1 159 ILE n 1 160 LYS n 1 161 LEU n 1 162 ALA n 1 163 ASP n 1 164 PHE n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 ARG n 1 169 ILE n 1 170 TYR n 1 171 SER n 1 172 PHE n 1 173 GLN n 1 174 MET n 1 175 ALA n 1 176 LEU n 1 177 THR n 1 178 SER n 1 179 VAL n 1 180 VAL n 1 181 VAL n 1 182 THR n 1 183 LEU n 1 184 TRP n 1 185 TYR n 1 186 ARG n 1 187 ALA n 1 188 PRO n 1 189 GLU n 1 190 VAL n 1 191 LEU n 1 192 LEU n 1 193 GLN n 1 194 SER n 1 195 SER n 1 196 TYR n 1 197 ALA n 1 198 THR n 1 199 PRO n 1 200 VAL n 1 201 ASP n 1 202 LEU n 1 203 TRP n 1 204 SER n 1 205 VAL n 1 206 GLY n 1 207 CYS n 1 208 ILE n 1 209 PHE n 1 210 ALA n 1 211 GLU n 1 212 MET n 1 213 PHE n 1 214 ARG n 1 215 ARG n 1 216 LYS n 1 217 PRO n 1 218 LEU n 1 219 PHE n 1 220 ARG n 1 221 GLY n 1 222 SER n 1 223 SER n 1 224 ASP n 1 225 VAL n 1 226 ASP n 1 227 GLN n 1 228 LEU n 1 229 GLY n 1 230 LYS n 1 231 ILE n 1 232 LEU n 1 233 ASP n 1 234 VAL n 1 235 ILE n 1 236 GLY n 1 237 LEU n 1 238 PRO n 1 239 GLY n 1 240 GLU n 1 241 GLU n 1 242 ASP n 1 243 TRP n 1 244 PRO n 1 245 ARG n 1 246 ASP n 1 247 VAL n 1 248 ALA n 1 249 LEU n 1 250 PRO n 1 251 ARG n 1 252 GLN n 1 253 ALA n 1 254 PHE n 1 255 HIS n 1 256 SER n 1 257 LYS n 1 258 SER n 1 259 ALA n 1 260 GLN n 1 261 PRO n 1 262 ILE n 1 263 GLU n 1 264 LYS n 1 265 PHE n 1 266 VAL n 1 267 THR n 1 268 ASP n 1 269 ILE n 1 270 ASP n 1 271 GLU n 1 272 LEU n 1 273 GLY n 1 274 LYS n 1 275 ASP n 1 276 LEU n 1 277 LEU n 1 278 LEU n 1 279 LYS n 1 280 CYS n 1 281 LEU n 1 282 THR n 1 283 PHE n 1 284 ASN n 1 285 PRO n 1 286 ALA n 1 287 LYS n 1 288 ARG n 1 289 ILE n 1 290 SER n 1 291 ALA n 1 292 TYR n 1 293 SER n 1 294 ALA n 1 295 LEU n 1 296 SER n 1 297 HIS n 1 298 PRO n 1 299 TYR n 1 300 PHE n 1 301 GLN n 1 302 HIS n 1 303 HIS n 1 304 HIS n 1 305 HIS n 1 306 HIS n 1 307 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 307 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CDK6, CDKN6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6ZV non-polymer . ;N-{5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl}-5-fluoro-4-[4-fluoro-2-methyl-1-(propan-2-yl)-1H-benzimidazol-6-yl]py rimidin-2-amine ; Abemaciclib 'C27 H32 F2 N8' 506.593 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 CYS 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 VAL 45 45 45 VAL ALA A . n A 1 46 ARG 46 46 46 ARG ALA A . n A 1 47 VAL 47 47 47 VAL ALA A . n A 1 48 GLN 48 48 ? ? ? A . n A 1 49 THR 49 49 ? ? ? A . n A 1 50 GLY 50 50 ? ? ? A . n A 1 51 GLU 51 51 ? ? ? A . n A 1 52 GLU 52 52 ? ? ? A . n A 1 53 GLY 53 53 ? ? ? A . n A 1 54 MET 54 54 ? ? ? A . n A 1 55 PRO 55 55 55 PRO ALA A . n A 1 56 LEU 56 56 56 LEU ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 VAL 85 85 ? ? ? A . n A 1 86 SER 86 86 ? ? ? A . n A 1 87 ARG 87 87 ? ? ? A . n A 1 88 THR 88 88 ? ? ? A . n A 1 89 ASP 89 89 ? ? ? A . n A 1 90 ARG 90 90 ? ? ? A . n A 1 91 GLU 91 91 ? ? ? A . n A 1 92 THR 92 92 ? ? ? A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ARG 168 168 ? ? ? A . n A 1 169 ILE 169 169 ? ? ? A . n A 1 170 TYR 170 170 ? ? ? A . n A 1 171 SER 171 171 ? ? ? A . n A 1 172 PHE 172 172 ? ? ? A . n A 1 173 GLN 173 173 ? ? ? A . n A 1 174 MET 174 174 ? ? ? A . n A 1 175 ALA 175 175 ? ? ? A . n A 1 176 LEU 176 176 ? ? ? A . n A 1 177 THR 177 177 ? ? ? A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 VAL 179 179 ? ? ? A . n A 1 180 VAL 180 180 ? ? ? A . n A 1 181 VAL 181 181 181 VAL ALA A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 TRP 203 203 203 TRP TRP A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 CYS 207 207 207 CYS CYS A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 MET 212 212 212 MET MET A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 GLN 227 227 227 GLN GLN A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 ASP 242 242 242 ASP ASP A . n A 1 243 TRP 243 243 243 TRP TRP A . n A 1 244 PRO 244 244 244 PRO PRO A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 SER 256 256 256 SER SER A . n A 1 257 LYS 257 257 257 LYS LYS A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 GLN 260 260 260 GLN GLN A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 THR 267 267 267 THR THR A . n A 1 268 ASP 268 268 268 ASP ASP A . n A 1 269 ILE 269 269 269 ILE ILE A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 ASP 275 275 275 ASP ASP A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 CYS 280 280 280 CYS CYS A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 THR 282 282 282 THR THR A . n A 1 283 PHE 283 283 283 PHE PHE A . n A 1 284 ASN 284 284 284 ASN ASN A . n A 1 285 PRO 285 285 285 PRO PRO A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 SER 290 290 290 SER SER A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 TYR 292 292 292 TYR TYR A . n A 1 293 SER 293 293 293 SER SER A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 SER 296 296 296 SER SER A . n A 1 297 HIS 297 297 297 HIS HIS A . n A 1 298 PRO 298 298 298 PRO PRO A . n A 1 299 TYR 299 299 299 TYR TYR A . n A 1 300 PHE 300 300 300 PHE PHE A . n A 1 301 GLN 301 301 301 GLN GLN A . n A 1 302 HIS 302 302 ? ? ? A . n A 1 303 HIS 303 303 ? ? ? A . n A 1 304 HIS 304 304 ? ? ? A . n A 1 305 HIS 305 305 ? ? ? A . n A 1 306 HIS 306 306 ? ? ? A . n A 1 307 HIS 307 307 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 6ZV 1 900 900 6ZV API A . C 3 HOH 1 1001 4 HOH HOH A . C 3 HOH 2 1002 12 HOH HOH A . C 3 HOH 3 1003 15 HOH HOH A . C 3 HOH 4 1004 3 HOH HOH A . C 3 HOH 5 1005 18 HOH HOH A . C 3 HOH 6 1006 9 HOH HOH A . C 3 HOH 7 1007 14 HOH HOH A . C 3 HOH 8 1008 2 HOH HOH A . C 3 HOH 9 1009 5 HOH HOH A . C 3 HOH 10 1010 10 HOH HOH A . C 3 HOH 11 1011 13 HOH HOH A . C 3 HOH 12 1012 20 HOH HOH A . C 3 HOH 13 1013 21 HOH HOH A . C 3 HOH 14 1014 16 HOH HOH A . C 3 HOH 15 1015 1 HOH HOH A . C 3 HOH 16 1016 8 HOH HOH A . C 3 HOH 17 1017 19 HOH HOH A . C 3 HOH 18 1018 6 HOH HOH A . C 3 HOH 19 1019 11 HOH HOH A . C 3 HOH 20 1020 7 HOH HOH A . C 3 HOH 21 1021 17 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 45 ? CG1 ? A VAL 45 CG1 2 1 Y 1 A VAL 45 ? CG2 ? A VAL 45 CG2 3 1 Y 1 A ARG 46 ? CG ? A ARG 46 CG 4 1 Y 1 A ARG 46 ? CD ? A ARG 46 CD 5 1 Y 1 A ARG 46 ? NE ? A ARG 46 NE 6 1 Y 1 A ARG 46 ? CZ ? A ARG 46 CZ 7 1 Y 1 A ARG 46 ? NH1 ? A ARG 46 NH1 8 1 Y 1 A ARG 46 ? NH2 ? A ARG 46 NH2 9 1 Y 1 A VAL 47 ? CG1 ? A VAL 47 CG1 10 1 Y 1 A VAL 47 ? CG2 ? A VAL 47 CG2 11 1 Y 1 A PRO 55 ? CG ? A PRO 55 CG 12 1 Y 1 A PRO 55 ? CD ? A PRO 55 CD 13 1 Y 1 A LEU 56 ? CG ? A LEU 56 CG 14 1 Y 1 A LEU 56 ? CD1 ? A LEU 56 CD1 15 1 Y 1 A LEU 56 ? CD2 ? A LEU 56 CD2 16 1 Y 1 A VAL 181 ? CG1 ? A VAL 181 CG1 17 1 Y 1 A VAL 181 ? CG2 ? A VAL 181 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.4 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoXDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5L2S _cell.details ? _cell.formula_units_Z ? _cell.length_a 102.170 _cell.length_a_esd ? _cell.length_b 102.170 _cell.length_b_esd ? _cell.length_c 59.830 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5L2S _symmetry.cell_setting ? _symmetry.Int_Tables_number 79 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5L2S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 286.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1:1 (protein to well buffer) with well buffer containing: 0.1 M MES pH 6.0, 70 - 80 mM NH4NO3, 10 - 15% polyethyleneglycol 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 98.15 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-08-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 59.60 _reflns.entry_id 5L2S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.27 _reflns.d_resolution_low 72.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14466 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.24 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -6.6455 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -6.6455 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 13.2909 _refine.B_iso_max ? _refine.B_iso_mean 58.77 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9369 _refine.correlation_coeff_Fo_to_Fc_free 0.9188 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5L2S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.27 _refine.ls_d_res_low 72.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14386 _refine.ls_number_reflns_R_free 1033 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 7.18 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2090 _refine.ls_R_factor_R_free 0.2488 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2060 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.218 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.210 _refine.pdbx_overall_SU_R_Blow_DPI 0.268 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.288 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5L2S _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.317 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2091 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 2149 _refine_hist.d_res_high 2.27 _refine_hist.d_res_low 72.0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2210 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.07 ? 3023 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 756 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 49 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 348 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2210 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.72 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.94 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 272 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2479 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.27 _refine_ls_shell.d_res_low 2.45 _refine_ls_shell.number_reflns_all 2960 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 222 _refine_ls_shell.number_reflns_R_work 2738 _refine_ls_shell.percent_reflns_obs 99.95 _refine_ls_shell.percent_reflns_R_free 7.50 _refine_ls_shell.R_factor_all 0.2271 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2658 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2242 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 7 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5L2S _struct.title 'The X-ray co-crystal structure of human CDK6 and Abemaciclib.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5L2S _struct_keywords.text 'cyclin-dependent kinase, kinase inhibitor, kinase selectivity, Transferase-Transferase Inhibitor complex' _struct_keywords.pdbx_keywords 'Transferase/Transferase Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDK6_HUMAN _struct_ref.pdbx_db_accession Q00534 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLF DVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIK LADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5L2S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 301 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00534 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 301 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 301 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5L2S HIS A 302 ? UNP Q00534 ? ? 'expression tag' 302 1 1 5L2S HIS A 303 ? UNP Q00534 ? ? 'expression tag' 303 2 1 5L2S HIS A 304 ? UNP Q00534 ? ? 'expression tag' 304 3 1 5L2S HIS A 305 ? UNP Q00534 ? ? 'expression tag' 305 4 1 5L2S HIS A 306 ? UNP Q00534 ? ? 'expression tag' 306 5 1 5L2S HIS A 307 ? UNP Q00534 ? ? 'expression tag' 307 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 34 ? GLY A 36 ? LYS A 34 GLY A 36 5 ? 3 HELX_P HELX_P2 AA2 LEU A 56 ? THR A 70 ? LEU A 56 THR A 70 1 ? 15 HELX_P HELX_P3 AA3 LEU A 105 ? VAL A 112 ? LEU A 105 VAL A 112 1 ? 8 HELX_P HELX_P4 AA4 PRO A 118 ? HIS A 139 ? PRO A 118 HIS A 139 1 ? 22 HELX_P HELX_P5 AA5 LYS A 147 ? GLN A 149 ? LYS A 147 GLN A 149 5 ? 3 HELX_P HELX_P6 AA6 ALA A 187 ? LEU A 192 ? ALA A 187 LEU A 192 1 ? 6 HELX_P HELX_P7 AA7 THR A 198 ? ARG A 215 ? THR A 198 ARG A 215 1 ? 18 HELX_P HELX_P8 AA8 SER A 223 ? GLY A 236 ? SER A 223 GLY A 236 1 ? 14 HELX_P HELX_P9 AA9 GLY A 239 ? TRP A 243 ? GLY A 239 TRP A 243 5 ? 5 HELX_P HELX_P10 AB1 PRO A 250 ? PHE A 254 ? PRO A 250 PHE A 254 5 ? 5 HELX_P HELX_P11 AB2 PRO A 261 ? PHE A 265 ? PRO A 261 PHE A 265 5 ? 5 HELX_P HELX_P12 AB3 ASP A 270 ? LEU A 281 ? ASP A 270 LEU A 281 1 ? 12 HELX_P HELX_P13 AB4 SER A 290 ? LEU A 295 ? SER A 290 LEU A 295 1 ? 6 HELX_P HELX_P14 AB5 SER A 296 ? GLN A 301 ? SER A 296 GLN A 301 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 114 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 114 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 115 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 115 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.84 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 13 ? GLY A 22 ? TYR A 13 GLY A 22 AA1 2 GLY A 25 ? ASP A 32 ? GLY A 25 ASP A 32 AA1 3 PHE A 39 ? VAL A 45 ? PHE A 39 VAL A 45 AA1 4 LEU A 94 ? GLU A 99 ? LEU A 94 GLU A 99 AA1 5 LEU A 79 ? CYS A 83 ? LEU A 79 CYS A 83 AA2 1 GLN A 103 ? ASP A 104 ? GLN A 103 ASP A 104 AA2 2 ILE A 151 ? VAL A 153 ? ILE A 151 VAL A 153 AA2 3 ILE A 159 ? LEU A 161 ? ILE A 159 LEU A 161 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 19 ? N ILE A 19 O VAL A 27 ? O VAL A 27 AA1 2 3 N ALA A 30 ? N ALA A 30 O VAL A 40 ? O VAL A 40 AA1 3 4 N ALA A 41 ? N ALA A 41 O PHE A 98 ? O PHE A 98 AA1 4 5 O VAL A 97 ? O VAL A 97 N ASP A 81 ? N ASP A 81 AA2 1 2 N GLN A 103 ? N GLN A 103 O VAL A 153 ? O VAL A 153 AA2 2 3 N LEU A 152 ? N LEU A 152 O LYS A 160 ? O LYS A 160 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 6ZV _struct_site.pdbx_auth_seq_id 900 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'binding site for residue 6ZV A 900' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ILE A 19 ? ILE A 19 . ? 1_555 ? 2 AC1 14 TYR A 24 ? TYR A 24 . ? 1_555 ? 3 AC1 14 ALA A 41 ? ALA A 41 . ? 1_555 ? 4 AC1 14 LYS A 43 ? LYS A 43 . ? 1_555 ? 5 AC1 14 VAL A 77 ? VAL A 77 . ? 1_555 ? 6 AC1 14 PHE A 98 ? PHE A 98 . ? 1_555 ? 7 AC1 14 GLU A 99 ? GLU A 99 . ? 1_555 ? 8 AC1 14 VAL A 101 ? VAL A 101 . ? 1_555 ? 9 AC1 14 ASP A 104 ? ASP A 104 . ? 1_555 ? 10 AC1 14 GLN A 149 ? GLN A 149 . ? 1_555 ? 11 AC1 14 LEU A 152 ? LEU A 152 . ? 1_555 ? 12 AC1 14 ASP A 163 ? ASP A 163 . ? 1_555 ? 13 AC1 14 GLU A 241 ? GLU A 241 . ? 7_554 ? 14 AC1 14 HOH C . ? HOH A 1011 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 24 ? ? -161.90 -32.41 2 1 ASN A 35 ? ? -112.13 54.64 3 1 LEU A 56 ? ? -142.29 -38.24 4 1 ARG A 144 ? ? 76.08 -19.72 5 1 SER A 194 ? ? -105.47 -62.06 6 1 ARG A 220 ? ? -104.04 71.56 7 1 VAL A 234 ? ? -97.65 -60.49 8 1 SER A 256 ? ? -74.18 41.40 9 1 LYS A 257 ? ? 8.78 -101.52 10 1 LEU A 281 ? ? -92.45 44.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A CYS 7 ? A CYS 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A GLN 48 ? A GLN 48 12 1 Y 1 A THR 49 ? A THR 49 13 1 Y 1 A GLY 50 ? A GLY 50 14 1 Y 1 A GLU 51 ? A GLU 51 15 1 Y 1 A GLU 52 ? A GLU 52 16 1 Y 1 A GLY 53 ? A GLY 53 17 1 Y 1 A MET 54 ? A MET 54 18 1 Y 1 A VAL 85 ? A VAL 85 19 1 Y 1 A SER 86 ? A SER 86 20 1 Y 1 A ARG 87 ? A ARG 87 21 1 Y 1 A THR 88 ? A THR 88 22 1 Y 1 A ASP 89 ? A ASP 89 23 1 Y 1 A ARG 90 ? A ARG 90 24 1 Y 1 A GLU 91 ? A GLU 91 25 1 Y 1 A THR 92 ? A THR 92 26 1 Y 1 A ARG 168 ? A ARG 168 27 1 Y 1 A ILE 169 ? A ILE 169 28 1 Y 1 A TYR 170 ? A TYR 170 29 1 Y 1 A SER 171 ? A SER 171 30 1 Y 1 A PHE 172 ? A PHE 172 31 1 Y 1 A GLN 173 ? A GLN 173 32 1 Y 1 A MET 174 ? A MET 174 33 1 Y 1 A ALA 175 ? A ALA 175 34 1 Y 1 A LEU 176 ? A LEU 176 35 1 Y 1 A THR 177 ? A THR 177 36 1 Y 1 A SER 178 ? A SER 178 37 1 Y 1 A VAL 179 ? A VAL 179 38 1 Y 1 A VAL 180 ? A VAL 180 39 1 Y 1 A HIS 302 ? A HIS 302 40 1 Y 1 A HIS 303 ? A HIS 303 41 1 Y 1 A HIS 304 ? A HIS 304 42 1 Y 1 A HIS 305 ? A HIS 305 43 1 Y 1 A HIS 306 ? A HIS 306 44 1 Y 1 A HIS 307 ? A HIS 307 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6ZV C1 C N N 1 6ZV C2 C Y N 2 6ZV C3 C N N 3 6ZV C4 C Y N 4 6ZV C5 C Y N 5 6ZV C6 C Y N 6 6ZV N2 N N N 7 6ZV C10 C Y N 8 6ZV C C Y N 9 6ZV C17 C Y N 10 6ZV C21 C Y N 11 6ZV C12 C Y N 12 6ZV C16 C Y N 13 6ZV C11 C Y N 14 6ZV C19 C Y N 15 6ZV C18 C Y N 16 6ZV C20 C Y N 17 6ZV C8 C Y N 18 6ZV C23 C Y N 19 6ZV C31 C N N 20 6ZV C35 C N N 21 6ZV C32 C N N 22 6ZV C34 C N N 23 6ZV C25 C N N 24 6ZV C27 C N N 25 6ZV C28 C N N 26 6ZV C14 C N N 27 6ZV C26 C N N 28 6ZV N N Y N 29 6ZV N1 N Y N 30 6ZV N24 N Y N 31 6ZV N3 N Y N 32 6ZV N22 N Y N 33 6ZV N30 N N N 34 6ZV N7 N N N 35 6ZV F29 F N N 36 6ZV F15 F N N 37 6ZV H69 H N N 38 6ZV H77 H N N 39 6ZV H78 H N N 40 6ZV H79 H N N 41 6ZV H76 H N N 42 6ZV H42 H N N 43 6ZV H41 H N N 44 6ZV H68 H N N 45 6ZV H39 H N N 46 6ZV H40 H N N 47 6ZV H38 H N N 48 6ZV H44 H N N 49 6ZV H43 H N N 50 6ZV H65 H N N 51 6ZV H66 H N N 52 6ZV H71 H N N 53 6ZV H72 H N N 54 6ZV H74 H N N 55 6ZV H73 H N N 56 6ZV H51 H N N 57 6ZV H52 H N N 58 6ZV H53 H N N 59 6ZV H57 H N N 60 6ZV H58 H N N 61 6ZV H59 H N N 62 6ZV H62 H N N 63 6ZV H60 H N N 64 6ZV H61 H N N 65 6ZV H63 H N N 66 6ZV H64 H N N 67 6ZV H67 H N N 68 6ZV H70 H N N 69 ALA N N N N 70 ALA CA C N S 71 ALA C C N N 72 ALA O O N N 73 ALA CB C N N 74 ALA OXT O N N 75 ALA H H N N 76 ALA H2 H N N 77 ALA HA H N N 78 ALA HB1 H N N 79 ALA HB2 H N N 80 ALA HB3 H N N 81 ALA HXT H N N 82 ARG N N N N 83 ARG CA C N S 84 ARG C C N N 85 ARG O O N N 86 ARG CB C N N 87 ARG CG C N N 88 ARG CD C N N 89 ARG NE N N N 90 ARG CZ C N N 91 ARG NH1 N N N 92 ARG NH2 N N N 93 ARG OXT O N N 94 ARG H H N N 95 ARG H2 H N N 96 ARG HA H N N 97 ARG HB2 H N N 98 ARG HB3 H N N 99 ARG HG2 H N N 100 ARG HG3 H N N 101 ARG HD2 H N N 102 ARG HD3 H N N 103 ARG HE H N N 104 ARG HH11 H N N 105 ARG HH12 H N N 106 ARG HH21 H N N 107 ARG HH22 H N N 108 ARG HXT H N N 109 ASN N N N N 110 ASN CA C N S 111 ASN C C N N 112 ASN O O N N 113 ASN CB C N N 114 ASN CG C N N 115 ASN OD1 O N N 116 ASN ND2 N N N 117 ASN OXT O N N 118 ASN H H N N 119 ASN H2 H N N 120 ASN HA H N N 121 ASN HB2 H N N 122 ASN HB3 H N N 123 ASN HD21 H N N 124 ASN HD22 H N N 125 ASN HXT H N N 126 ASP N N N N 127 ASP CA C N S 128 ASP C C N N 129 ASP O O N N 130 ASP CB C N N 131 ASP CG C N N 132 ASP OD1 O N N 133 ASP OD2 O N N 134 ASP OXT O N N 135 ASP H H N N 136 ASP H2 H N N 137 ASP HA H N N 138 ASP HB2 H N N 139 ASP HB3 H N N 140 ASP HD2 H N N 141 ASP HXT H N N 142 CYS N N N N 143 CYS CA C N R 144 CYS C C N N 145 CYS O O N N 146 CYS CB C N N 147 CYS SG S N N 148 CYS OXT O N N 149 CYS H H N N 150 CYS H2 H N N 151 CYS HA H N N 152 CYS HB2 H N N 153 CYS HB3 H N N 154 CYS HG H N N 155 CYS HXT H N N 156 GLN N N N N 157 GLN CA C N S 158 GLN C C N N 159 GLN O O N N 160 GLN CB C N N 161 GLN CG C N N 162 GLN CD C N N 163 GLN OE1 O N N 164 GLN NE2 N N N 165 GLN OXT O N N 166 GLN H H N N 167 GLN H2 H N N 168 GLN HA H N N 169 GLN HB2 H N N 170 GLN HB3 H N N 171 GLN HG2 H N N 172 GLN HG3 H N N 173 GLN HE21 H N N 174 GLN HE22 H N N 175 GLN HXT H N N 176 GLU N N N N 177 GLU CA C N S 178 GLU C C N N 179 GLU O O N N 180 GLU CB C N N 181 GLU CG C N N 182 GLU CD C N N 183 GLU OE1 O N N 184 GLU OE2 O N N 185 GLU OXT O N N 186 GLU H H N N 187 GLU H2 H N N 188 GLU HA H N N 189 GLU HB2 H N N 190 GLU HB3 H N N 191 GLU HG2 H N N 192 GLU HG3 H N N 193 GLU HE2 H N N 194 GLU HXT H N N 195 GLY N N N N 196 GLY CA C N N 197 GLY C C N N 198 GLY O O N N 199 GLY OXT O N N 200 GLY H H N N 201 GLY H2 H N N 202 GLY HA2 H N N 203 GLY HA3 H N N 204 GLY HXT H N N 205 HIS N N N N 206 HIS CA C N S 207 HIS C C N N 208 HIS O O N N 209 HIS CB C N N 210 HIS CG C Y N 211 HIS ND1 N Y N 212 HIS CD2 C Y N 213 HIS CE1 C Y N 214 HIS NE2 N Y N 215 HIS OXT O N N 216 HIS H H N N 217 HIS H2 H N N 218 HIS HA H N N 219 HIS HB2 H N N 220 HIS HB3 H N N 221 HIS HD1 H N N 222 HIS HD2 H N N 223 HIS HE1 H N N 224 HIS HE2 H N N 225 HIS HXT H N N 226 HOH O O N N 227 HOH H1 H N N 228 HOH H2 H N N 229 ILE N N N N 230 ILE CA C N S 231 ILE C C N N 232 ILE O O N N 233 ILE CB C N S 234 ILE CG1 C N N 235 ILE CG2 C N N 236 ILE CD1 C N N 237 ILE OXT O N N 238 ILE H H N N 239 ILE H2 H N N 240 ILE HA H N N 241 ILE HB H N N 242 ILE HG12 H N N 243 ILE HG13 H N N 244 ILE HG21 H N N 245 ILE HG22 H N N 246 ILE HG23 H N N 247 ILE HD11 H N N 248 ILE HD12 H N N 249 ILE HD13 H N N 250 ILE HXT H N N 251 LEU N N N N 252 LEU CA C N S 253 LEU C C N N 254 LEU O O N N 255 LEU CB C N N 256 LEU CG C N N 257 LEU CD1 C N N 258 LEU CD2 C N N 259 LEU OXT O N N 260 LEU H H N N 261 LEU H2 H N N 262 LEU HA H N N 263 LEU HB2 H N N 264 LEU HB3 H N N 265 LEU HG H N N 266 LEU HD11 H N N 267 LEU HD12 H N N 268 LEU HD13 H N N 269 LEU HD21 H N N 270 LEU HD22 H N N 271 LEU HD23 H N N 272 LEU HXT H N N 273 LYS N N N N 274 LYS CA C N S 275 LYS C C N N 276 LYS O O N N 277 LYS CB C N N 278 LYS CG C N N 279 LYS CD C N N 280 LYS CE C N N 281 LYS NZ N N N 282 LYS OXT O N N 283 LYS H H N N 284 LYS H2 H N N 285 LYS HA H N N 286 LYS HB2 H N N 287 LYS HB3 H N N 288 LYS HG2 H N N 289 LYS HG3 H N N 290 LYS HD2 H N N 291 LYS HD3 H N N 292 LYS HE2 H N N 293 LYS HE3 H N N 294 LYS HZ1 H N N 295 LYS HZ2 H N N 296 LYS HZ3 H N N 297 LYS HXT H N N 298 MET N N N N 299 MET CA C N S 300 MET C C N N 301 MET O O N N 302 MET CB C N N 303 MET CG C N N 304 MET SD S N N 305 MET CE C N N 306 MET OXT O N N 307 MET H H N N 308 MET H2 H N N 309 MET HA H N N 310 MET HB2 H N N 311 MET HB3 H N N 312 MET HG2 H N N 313 MET HG3 H N N 314 MET HE1 H N N 315 MET HE2 H N N 316 MET HE3 H N N 317 MET HXT H N N 318 PHE N N N N 319 PHE CA C N S 320 PHE C C N N 321 PHE O O N N 322 PHE CB C N N 323 PHE CG C Y N 324 PHE CD1 C Y N 325 PHE CD2 C Y N 326 PHE CE1 C Y N 327 PHE CE2 C Y N 328 PHE CZ C Y N 329 PHE OXT O N N 330 PHE H H N N 331 PHE H2 H N N 332 PHE HA H N N 333 PHE HB2 H N N 334 PHE HB3 H N N 335 PHE HD1 H N N 336 PHE HD2 H N N 337 PHE HE1 H N N 338 PHE HE2 H N N 339 PHE HZ H N N 340 PHE HXT H N N 341 PRO N N N N 342 PRO CA C N S 343 PRO C C N N 344 PRO O O N N 345 PRO CB C N N 346 PRO CG C N N 347 PRO CD C N N 348 PRO OXT O N N 349 PRO H H N N 350 PRO HA H N N 351 PRO HB2 H N N 352 PRO HB3 H N N 353 PRO HG2 H N N 354 PRO HG3 H N N 355 PRO HD2 H N N 356 PRO HD3 H N N 357 PRO HXT H N N 358 SER N N N N 359 SER CA C N S 360 SER C C N N 361 SER O O N N 362 SER CB C N N 363 SER OG O N N 364 SER OXT O N N 365 SER H H N N 366 SER H2 H N N 367 SER HA H N N 368 SER HB2 H N N 369 SER HB3 H N N 370 SER HG H N N 371 SER HXT H N N 372 THR N N N N 373 THR CA C N S 374 THR C C N N 375 THR O O N N 376 THR CB C N R 377 THR OG1 O N N 378 THR CG2 C N N 379 THR OXT O N N 380 THR H H N N 381 THR H2 H N N 382 THR HA H N N 383 THR HB H N N 384 THR HG1 H N N 385 THR HG21 H N N 386 THR HG22 H N N 387 THR HG23 H N N 388 THR HXT H N N 389 TRP N N N N 390 TRP CA C N S 391 TRP C C N N 392 TRP O O N N 393 TRP CB C N N 394 TRP CG C Y N 395 TRP CD1 C Y N 396 TRP CD2 C Y N 397 TRP NE1 N Y N 398 TRP CE2 C Y N 399 TRP CE3 C Y N 400 TRP CZ2 C Y N 401 TRP CZ3 C Y N 402 TRP CH2 C Y N 403 TRP OXT O N N 404 TRP H H N N 405 TRP H2 H N N 406 TRP HA H N N 407 TRP HB2 H N N 408 TRP HB3 H N N 409 TRP HD1 H N N 410 TRP HE1 H N N 411 TRP HE3 H N N 412 TRP HZ2 H N N 413 TRP HZ3 H N N 414 TRP HH2 H N N 415 TRP HXT H N N 416 TYR N N N N 417 TYR CA C N S 418 TYR C C N N 419 TYR O O N N 420 TYR CB C N N 421 TYR CG C Y N 422 TYR CD1 C Y N 423 TYR CD2 C Y N 424 TYR CE1 C Y N 425 TYR CE2 C Y N 426 TYR CZ C Y N 427 TYR OH O N N 428 TYR OXT O N N 429 TYR H H N N 430 TYR H2 H N N 431 TYR HA H N N 432 TYR HB2 H N N 433 TYR HB3 H N N 434 TYR HD1 H N N 435 TYR HD2 H N N 436 TYR HE1 H N N 437 TYR HE2 H N N 438 TYR HH H N N 439 TYR HXT H N N 440 VAL N N N N 441 VAL CA C N S 442 VAL C C N N 443 VAL O O N N 444 VAL CB C N N 445 VAL CG1 C N N 446 VAL CG2 C N N 447 VAL OXT O N N 448 VAL H H N N 449 VAL H2 H N N 450 VAL HA H N N 451 VAL HB H N N 452 VAL HG11 H N N 453 VAL HG12 H N N 454 VAL HG13 H N N 455 VAL HG21 H N N 456 VAL HG22 H N N 457 VAL HG23 H N N 458 VAL HXT H N N 459 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6ZV C32 N2 sing N N 1 6ZV C32 C31 sing N N 2 6ZV N2 C34 sing N N 3 6ZV N2 C1 sing N N 4 6ZV C31 N30 sing N N 5 6ZV C34 C35 sing N N 6 6ZV N30 C35 sing N N 7 6ZV N30 C14 sing N N 8 6ZV C1 C3 sing N N 9 6ZV C12 N doub Y N 10 6ZV C12 C11 sing Y N 11 6ZV N C8 sing Y N 12 6ZV C14 C11 sing N N 13 6ZV C11 C10 doub Y N 14 6ZV C8 N7 sing N N 15 6ZV C8 C doub Y N 16 6ZV N7 C2 sing N N 17 6ZV C10 C sing Y N 18 6ZV N1 C2 doub Y N 19 6ZV N1 C6 sing Y N 20 6ZV C2 N3 sing Y N 21 6ZV C6 C5 doub Y N 22 6ZV N3 C4 doub Y N 23 6ZV C4 C5 sing Y N 24 6ZV C4 C16 sing N N 25 6ZV C5 F15 sing N N 26 6ZV C28 C26 sing N N 27 6ZV C27 C26 sing N N 28 6ZV C17 C16 doub Y N 29 6ZV C17 C18 sing Y N 30 6ZV C16 C21 sing Y N 31 6ZV C26 N22 sing N N 32 6ZV C18 N22 sing Y N 33 6ZV C18 C19 doub Y N 34 6ZV C21 C20 doub Y N 35 6ZV N22 C23 sing Y N 36 6ZV C20 C19 sing Y N 37 6ZV C20 F29 sing N N 38 6ZV C19 N24 sing Y N 39 6ZV C23 N24 doub Y N 40 6ZV C23 C25 sing N N 41 6ZV C1 H69 sing N N 42 6ZV C1 H77 sing N N 43 6ZV C3 H78 sing N N 44 6ZV C3 H79 sing N N 45 6ZV C3 H76 sing N N 46 6ZV C6 H42 sing N N 47 6ZV C10 H41 sing N N 48 6ZV C H68 sing N N 49 6ZV C17 H39 sing N N 50 6ZV C21 H40 sing N N 51 6ZV C12 H38 sing N N 52 6ZV C31 H44 sing N N 53 6ZV C31 H43 sing N N 54 6ZV C35 H65 sing N N 55 6ZV C35 H66 sing N N 56 6ZV C32 H71 sing N N 57 6ZV C32 H72 sing N N 58 6ZV C34 H74 sing N N 59 6ZV C34 H73 sing N N 60 6ZV C25 H51 sing N N 61 6ZV C25 H52 sing N N 62 6ZV C25 H53 sing N N 63 6ZV C27 H57 sing N N 64 6ZV C27 H58 sing N N 65 6ZV C27 H59 sing N N 66 6ZV C28 H62 sing N N 67 6ZV C28 H60 sing N N 68 6ZV C28 H61 sing N N 69 6ZV C14 H63 sing N N 70 6ZV C14 H64 sing N N 71 6ZV C26 H67 sing N N 72 6ZV N7 H70 sing N N 73 ALA N CA sing N N 74 ALA N H sing N N 75 ALA N H2 sing N N 76 ALA CA C sing N N 77 ALA CA CB sing N N 78 ALA CA HA sing N N 79 ALA C O doub N N 80 ALA C OXT sing N N 81 ALA CB HB1 sing N N 82 ALA CB HB2 sing N N 83 ALA CB HB3 sing N N 84 ALA OXT HXT sing N N 85 ARG N CA sing N N 86 ARG N H sing N N 87 ARG N H2 sing N N 88 ARG CA C sing N N 89 ARG CA CB sing N N 90 ARG CA HA sing N N 91 ARG C O doub N N 92 ARG C OXT sing N N 93 ARG CB CG sing N N 94 ARG CB HB2 sing N N 95 ARG CB HB3 sing N N 96 ARG CG CD sing N N 97 ARG CG HG2 sing N N 98 ARG CG HG3 sing N N 99 ARG CD NE sing N N 100 ARG CD HD2 sing N N 101 ARG CD HD3 sing N N 102 ARG NE CZ sing N N 103 ARG NE HE sing N N 104 ARG CZ NH1 sing N N 105 ARG CZ NH2 doub N N 106 ARG NH1 HH11 sing N N 107 ARG NH1 HH12 sing N N 108 ARG NH2 HH21 sing N N 109 ARG NH2 HH22 sing N N 110 ARG OXT HXT sing N N 111 ASN N CA sing N N 112 ASN N H sing N N 113 ASN N H2 sing N N 114 ASN CA C sing N N 115 ASN CA CB sing N N 116 ASN CA HA sing N N 117 ASN C O doub N N 118 ASN C OXT sing N N 119 ASN CB CG sing N N 120 ASN CB HB2 sing N N 121 ASN CB HB3 sing N N 122 ASN CG OD1 doub N N 123 ASN CG ND2 sing N N 124 ASN ND2 HD21 sing N N 125 ASN ND2 HD22 sing N N 126 ASN OXT HXT sing N N 127 ASP N CA sing N N 128 ASP N H sing N N 129 ASP N H2 sing N N 130 ASP CA C sing N N 131 ASP CA CB sing N N 132 ASP CA HA sing N N 133 ASP C O doub N N 134 ASP C OXT sing N N 135 ASP CB CG sing N N 136 ASP CB HB2 sing N N 137 ASP CB HB3 sing N N 138 ASP CG OD1 doub N N 139 ASP CG OD2 sing N N 140 ASP OD2 HD2 sing N N 141 ASP OXT HXT sing N N 142 CYS N CA sing N N 143 CYS N H sing N N 144 CYS N H2 sing N N 145 CYS CA C sing N N 146 CYS CA CB sing N N 147 CYS CA HA sing N N 148 CYS C O doub N N 149 CYS C OXT sing N N 150 CYS CB SG sing N N 151 CYS CB HB2 sing N N 152 CYS CB HB3 sing N N 153 CYS SG HG sing N N 154 CYS OXT HXT sing N N 155 GLN N CA sing N N 156 GLN N H sing N N 157 GLN N H2 sing N N 158 GLN CA C sing N N 159 GLN CA CB sing N N 160 GLN CA HA sing N N 161 GLN C O doub N N 162 GLN C OXT sing N N 163 GLN CB CG sing N N 164 GLN CB HB2 sing N N 165 GLN CB HB3 sing N N 166 GLN CG CD sing N N 167 GLN CG HG2 sing N N 168 GLN CG HG3 sing N N 169 GLN CD OE1 doub N N 170 GLN CD NE2 sing N N 171 GLN NE2 HE21 sing N N 172 GLN NE2 HE22 sing N N 173 GLN OXT HXT sing N N 174 GLU N CA sing N N 175 GLU N H sing N N 176 GLU N H2 sing N N 177 GLU CA C sing N N 178 GLU CA CB sing N N 179 GLU CA HA sing N N 180 GLU C O doub N N 181 GLU C OXT sing N N 182 GLU CB CG sing N N 183 GLU CB HB2 sing N N 184 GLU CB HB3 sing N N 185 GLU CG CD sing N N 186 GLU CG HG2 sing N N 187 GLU CG HG3 sing N N 188 GLU CD OE1 doub N N 189 GLU CD OE2 sing N N 190 GLU OE2 HE2 sing N N 191 GLU OXT HXT sing N N 192 GLY N CA sing N N 193 GLY N H sing N N 194 GLY N H2 sing N N 195 GLY CA C sing N N 196 GLY CA HA2 sing N N 197 GLY CA HA3 sing N N 198 GLY C O doub N N 199 GLY C OXT sing N N 200 GLY OXT HXT sing N N 201 HIS N CA sing N N 202 HIS N H sing N N 203 HIS N H2 sing N N 204 HIS CA C sing N N 205 HIS CA CB sing N N 206 HIS CA HA sing N N 207 HIS C O doub N N 208 HIS C OXT sing N N 209 HIS CB CG sing N N 210 HIS CB HB2 sing N N 211 HIS CB HB3 sing N N 212 HIS CG ND1 sing Y N 213 HIS CG CD2 doub Y N 214 HIS ND1 CE1 doub Y N 215 HIS ND1 HD1 sing N N 216 HIS CD2 NE2 sing Y N 217 HIS CD2 HD2 sing N N 218 HIS CE1 NE2 sing Y N 219 HIS CE1 HE1 sing N N 220 HIS NE2 HE2 sing N N 221 HIS OXT HXT sing N N 222 HOH O H1 sing N N 223 HOH O H2 sing N N 224 ILE N CA sing N N 225 ILE N H sing N N 226 ILE N H2 sing N N 227 ILE CA C sing N N 228 ILE CA CB sing N N 229 ILE CA HA sing N N 230 ILE C O doub N N 231 ILE C OXT sing N N 232 ILE CB CG1 sing N N 233 ILE CB CG2 sing N N 234 ILE CB HB sing N N 235 ILE CG1 CD1 sing N N 236 ILE CG1 HG12 sing N N 237 ILE CG1 HG13 sing N N 238 ILE CG2 HG21 sing N N 239 ILE CG2 HG22 sing N N 240 ILE CG2 HG23 sing N N 241 ILE CD1 HD11 sing N N 242 ILE CD1 HD12 sing N N 243 ILE CD1 HD13 sing N N 244 ILE OXT HXT sing N N 245 LEU N CA sing N N 246 LEU N H sing N N 247 LEU N H2 sing N N 248 LEU CA C sing N N 249 LEU CA CB sing N N 250 LEU CA HA sing N N 251 LEU C O doub N N 252 LEU C OXT sing N N 253 LEU CB CG sing N N 254 LEU CB HB2 sing N N 255 LEU CB HB3 sing N N 256 LEU CG CD1 sing N N 257 LEU CG CD2 sing N N 258 LEU CG HG sing N N 259 LEU CD1 HD11 sing N N 260 LEU CD1 HD12 sing N N 261 LEU CD1 HD13 sing N N 262 LEU CD2 HD21 sing N N 263 LEU CD2 HD22 sing N N 264 LEU CD2 HD23 sing N N 265 LEU OXT HXT sing N N 266 LYS N CA sing N N 267 LYS N H sing N N 268 LYS N H2 sing N N 269 LYS CA C sing N N 270 LYS CA CB sing N N 271 LYS CA HA sing N N 272 LYS C O doub N N 273 LYS C OXT sing N N 274 LYS CB CG sing N N 275 LYS CB HB2 sing N N 276 LYS CB HB3 sing N N 277 LYS CG CD sing N N 278 LYS CG HG2 sing N N 279 LYS CG HG3 sing N N 280 LYS CD CE sing N N 281 LYS CD HD2 sing N N 282 LYS CD HD3 sing N N 283 LYS CE NZ sing N N 284 LYS CE HE2 sing N N 285 LYS CE HE3 sing N N 286 LYS NZ HZ1 sing N N 287 LYS NZ HZ2 sing N N 288 LYS NZ HZ3 sing N N 289 LYS OXT HXT sing N N 290 MET N CA sing N N 291 MET N H sing N N 292 MET N H2 sing N N 293 MET CA C sing N N 294 MET CA CB sing N N 295 MET CA HA sing N N 296 MET C O doub N N 297 MET C OXT sing N N 298 MET CB CG sing N N 299 MET CB HB2 sing N N 300 MET CB HB3 sing N N 301 MET CG SD sing N N 302 MET CG HG2 sing N N 303 MET CG HG3 sing N N 304 MET SD CE sing N N 305 MET CE HE1 sing N N 306 MET CE HE2 sing N N 307 MET CE HE3 sing N N 308 MET OXT HXT sing N N 309 PHE N CA sing N N 310 PHE N H sing N N 311 PHE N H2 sing N N 312 PHE CA C sing N N 313 PHE CA CB sing N N 314 PHE CA HA sing N N 315 PHE C O doub N N 316 PHE C OXT sing N N 317 PHE CB CG sing N N 318 PHE CB HB2 sing N N 319 PHE CB HB3 sing N N 320 PHE CG CD1 doub Y N 321 PHE CG CD2 sing Y N 322 PHE CD1 CE1 sing Y N 323 PHE CD1 HD1 sing N N 324 PHE CD2 CE2 doub Y N 325 PHE CD2 HD2 sing N N 326 PHE CE1 CZ doub Y N 327 PHE CE1 HE1 sing N N 328 PHE CE2 CZ sing Y N 329 PHE CE2 HE2 sing N N 330 PHE CZ HZ sing N N 331 PHE OXT HXT sing N N 332 PRO N CA sing N N 333 PRO N CD sing N N 334 PRO N H sing N N 335 PRO CA C sing N N 336 PRO CA CB sing N N 337 PRO CA HA sing N N 338 PRO C O doub N N 339 PRO C OXT sing N N 340 PRO CB CG sing N N 341 PRO CB HB2 sing N N 342 PRO CB HB3 sing N N 343 PRO CG CD sing N N 344 PRO CG HG2 sing N N 345 PRO CG HG3 sing N N 346 PRO CD HD2 sing N N 347 PRO CD HD3 sing N N 348 PRO OXT HXT sing N N 349 SER N CA sing N N 350 SER N H sing N N 351 SER N H2 sing N N 352 SER CA C sing N N 353 SER CA CB sing N N 354 SER CA HA sing N N 355 SER C O doub N N 356 SER C OXT sing N N 357 SER CB OG sing N N 358 SER CB HB2 sing N N 359 SER CB HB3 sing N N 360 SER OG HG sing N N 361 SER OXT HXT sing N N 362 THR N CA sing N N 363 THR N H sing N N 364 THR N H2 sing N N 365 THR CA C sing N N 366 THR CA CB sing N N 367 THR CA HA sing N N 368 THR C O doub N N 369 THR C OXT sing N N 370 THR CB OG1 sing N N 371 THR CB CG2 sing N N 372 THR CB HB sing N N 373 THR OG1 HG1 sing N N 374 THR CG2 HG21 sing N N 375 THR CG2 HG22 sing N N 376 THR CG2 HG23 sing N N 377 THR OXT HXT sing N N 378 TRP N CA sing N N 379 TRP N H sing N N 380 TRP N H2 sing N N 381 TRP CA C sing N N 382 TRP CA CB sing N N 383 TRP CA HA sing N N 384 TRP C O doub N N 385 TRP C OXT sing N N 386 TRP CB CG sing N N 387 TRP CB HB2 sing N N 388 TRP CB HB3 sing N N 389 TRP CG CD1 doub Y N 390 TRP CG CD2 sing Y N 391 TRP CD1 NE1 sing Y N 392 TRP CD1 HD1 sing N N 393 TRP CD2 CE2 doub Y N 394 TRP CD2 CE3 sing Y N 395 TRP NE1 CE2 sing Y N 396 TRP NE1 HE1 sing N N 397 TRP CE2 CZ2 sing Y N 398 TRP CE3 CZ3 doub Y N 399 TRP CE3 HE3 sing N N 400 TRP CZ2 CH2 doub Y N 401 TRP CZ2 HZ2 sing N N 402 TRP CZ3 CH2 sing Y N 403 TRP CZ3 HZ3 sing N N 404 TRP CH2 HH2 sing N N 405 TRP OXT HXT sing N N 406 TYR N CA sing N N 407 TYR N H sing N N 408 TYR N H2 sing N N 409 TYR CA C sing N N 410 TYR CA CB sing N N 411 TYR CA HA sing N N 412 TYR C O doub N N 413 TYR C OXT sing N N 414 TYR CB CG sing N N 415 TYR CB HB2 sing N N 416 TYR CB HB3 sing N N 417 TYR CG CD1 doub Y N 418 TYR CG CD2 sing Y N 419 TYR CD1 CE1 sing Y N 420 TYR CD1 HD1 sing N N 421 TYR CD2 CE2 doub Y N 422 TYR CD2 HD2 sing N N 423 TYR CE1 CZ doub Y N 424 TYR CE1 HE1 sing N N 425 TYR CE2 CZ sing Y N 426 TYR CE2 HE2 sing N N 427 TYR CZ OH sing N N 428 TYR OH HH sing N N 429 TYR OXT HXT sing N N 430 VAL N CA sing N N 431 VAL N H sing N N 432 VAL N H2 sing N N 433 VAL CA C sing N N 434 VAL CA CB sing N N 435 VAL CA HA sing N N 436 VAL C O doub N N 437 VAL C OXT sing N N 438 VAL CB CG1 sing N N 439 VAL CB CG2 sing N N 440 VAL CB HB sing N N 441 VAL CG1 HG11 sing N N 442 VAL CG1 HG12 sing N N 443 VAL CG1 HG13 sing N N 444 VAL CG2 HG21 sing N N 445 VAL CG2 HG22 sing N N 446 VAL CG2 HG23 sing N N 447 VAL OXT HXT sing N N 448 # _atom_sites.entry_id 5L2S _atom_sites.fract_transf_matrix[1][1] 0.009788 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009788 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016714 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O S # loop_ #