data_5L3L # _entry.id 5L3L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5L3L pdb_00005l3l 10.2210/pdb5l3l/pdb WWPDB D_1200000058 ? ? BMRB 34000 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 34000 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5L3L _pdbx_database_status.recvd_initial_deposition_date 2016-05-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _audit_author.name 'Hexnerova, R.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 291 _citation.language ? _citation.page_first 21234 _citation.page_last 21245 _citation.title 'Probing Receptor Specificity by Sampling the Conformational Space of the Insulin-like Growth Factor II C-domain.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M116.741041 _citation.pdbx_database_id_PubMed 27510031 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hexnerova, R.' 1 ? primary 'Krizkova, K.' 2 ? primary 'Fabry, M.' 3 ? primary 'Sieglova, I.' 4 ? primary 'Kedrova, K.' 5 ? primary 'Collinsova, M.' 6 ? primary 'Ullrichova, P.' 7 ? primary 'Srb, P.' 8 ? primary 'Williams, C.' 9 ? primary 'Crump, M.P.' 10 ? primary 'Tosner, Z.' 11 ? primary 'Jiracek, J.' 12 ? primary 'Veverka, V.' 13 ? primary 'Zakova, L.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Insulin-like growth factor II' _entity.formula_weight 7484.472 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IGF-II,Somatomedin-A,T3M-11-derived growth factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE _entity_poly.pdbx_seq_one_letter_code_can AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 TYR n 1 3 ARG n 1 4 PRO n 1 5 SER n 1 6 GLU n 1 7 THR n 1 8 LEU n 1 9 CYS n 1 10 GLY n 1 11 GLY n 1 12 GLU n 1 13 LEU n 1 14 VAL n 1 15 ASP n 1 16 THR n 1 17 LEU n 1 18 GLN n 1 19 PHE n 1 20 VAL n 1 21 CYS n 1 22 GLY n 1 23 ASP n 1 24 ARG n 1 25 GLY n 1 26 PHE n 1 27 TYR n 1 28 PHE n 1 29 SER n 1 30 ARG n 1 31 PRO n 1 32 ALA n 1 33 SER n 1 34 ARG n 1 35 VAL n 1 36 SER n 1 37 ARG n 1 38 ARG n 1 39 SER n 1 40 ARG n 1 41 GLY n 1 42 ILE n 1 43 VAL n 1 44 GLU n 1 45 GLU n 1 46 CYS n 1 47 CYS n 1 48 PHE n 1 49 ARG n 1 50 SER n 1 51 CYS n 1 52 ASP n 1 53 LEU n 1 54 ALA n 1 55 LEU n 1 56 LEU n 1 57 GLU n 1 58 THR n 1 59 TYR n 1 60 CYS n 1 61 ALA n 1 62 THR n 1 63 PRO n 1 64 ALA n 1 65 LYS n 1 66 SER n 1 67 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 67 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'IGF2, PP1446' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IGF2_HUMAN _struct_ref.pdbx_db_accession P01344 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5L3L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01344 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D CBCA(CO)NH' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(CA)CO' 1 isotropic 6 1 1 '3D HCCH-TOCSY' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 2 isotropic 8 1 1 '3D 1H-13C NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 uM d4 acetic acid, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '13C, 15N' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 850 ? # _pdbx_nmr_refine.entry_id 5L3L _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 5L3L _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5L3L _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 'chemical shift assignment' Sparky ? Goddard 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 refinement YASARA ? 'Hoegenauer, Koraimann, Kungl, Vriend' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5L3L _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5L3L _struct.title 'D11 bound IGF-II' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5L3L _struct_keywords.text 'IGF-II, cell cycle' _struct_keywords.pdbx_keywords 'CELL CYCLE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 10 ? GLY A 22 ? GLY A 10 GLY A 22 1 ? 13 HELX_P HELX_P2 AA2 ASP A 23 ? GLY A 25 ? ASP A 23 GLY A 25 5 ? 3 HELX_P HELX_P3 AA3 GLY A 41 ? CYS A 47 ? GLY A 41 CYS A 47 1 ? 7 HELX_P HELX_P4 AA4 ASP A 52 ? GLU A 57 ? ASP A 52 GLU A 57 1 ? 6 HELX_P HELX_P5 AA5 THR A 58 ? CYS A 60 ? THR A 58 CYS A 60 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 9 A CYS 47 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 21 A CYS 60 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 46 A CYS 51 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 5L3L _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5970 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-10 2 'Structure model' 1 1 2016-08-24 3 'Structure model' 1 2 2016-10-19 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_nmr_software 2 5 'Structure model' database_2 3 5 'Structure model' pdbx_database_status 4 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_nmr_software.name' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 5 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'acetic acid' _pdbx_nmr_exptl_sample.concentration 20 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling d4 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 3 CD A GLU 45 ? ? OE1 A GLU 45 ? ? 1.164 1.252 -0.088 0.011 N 2 7 CD A GLU 45 ? ? OE1 A GLU 45 ? ? 1.181 1.252 -0.071 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 5 CB A ASP 52 ? ? CG A ASP 52 ? ? OD1 A ASP 52 ? ? 123.79 118.30 5.49 0.90 N 2 11 CB A ASP 52 ? ? CG A ASP 52 ? ? OD1 A ASP 52 ? ? 123.73 118.30 5.43 0.90 N 3 12 CB A ASP 15 ? ? CG A ASP 15 ? ? OD1 A ASP 15 ? ? 123.80 118.30 5.50 0.90 N 4 12 CB A ASP 52 ? ? CG A ASP 52 ? ? OD1 A ASP 52 ? ? 123.82 118.30 5.52 0.90 N 5 15 CB A ASP 52 ? ? CG A ASP 52 ? ? OD1 A ASP 52 ? ? 123.86 118.30 5.56 0.90 N 6 16 CB A ASP 15 ? ? CG A ASP 15 ? ? OD1 A ASP 15 ? ? 123.79 118.30 5.49 0.90 N 7 17 CB A ASP 15 ? ? CG A ASP 15 ? ? OD1 A ASP 15 ? ? 124.03 118.30 5.73 0.90 N 8 18 CB A ASP 52 ? ? CG A ASP 52 ? ? OD1 A ASP 52 ? ? 123.74 118.30 5.44 0.90 N 9 20 CB A ASP 15 ? ? CG A ASP 15 ? ? OD1 A ASP 15 ? ? 123.84 118.30 5.54 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -97.45 35.29 2 1 THR A 7 ? ? 54.78 173.60 3 1 ALA A 32 ? ? -149.12 26.00 4 1 SER A 36 ? ? -67.19 90.50 5 2 SER A 5 ? ? -82.38 46.62 6 2 SER A 29 ? ? 58.05 -137.07 7 2 ARG A 37 ? ? -113.55 77.42 8 3 SER A 5 ? ? -89.11 40.84 9 3 THR A 7 ? ? 58.36 174.60 10 3 ASP A 23 ? ? -68.76 0.55 11 5 SER A 33 ? ? 60.24 163.28 12 5 ARG A 40 ? ? 48.01 -161.41 13 6 SER A 5 ? ? 75.29 114.52 14 6 ALA A 32 ? ? 72.78 -123.18 15 6 SER A 36 ? ? -87.89 33.70 16 7 SER A 5 ? ? -116.00 60.09 17 7 SER A 36 ? ? -67.37 27.46 18 8 SER A 5 ? ? -145.77 38.48 19 8 CYS A 9 ? ? -132.39 -156.82 20 8 ALA A 32 ? ? -151.12 16.67 21 8 ARG A 34 ? ? 68.32 -30.07 22 8 SER A 66 ? ? -162.53 80.56 23 9 LEU A 8 ? ? -132.19 -100.37 24 9 CYS A 9 ? ? 68.22 178.56 25 9 CYS A 21 ? ? -148.98 34.62 26 9 CYS A 47 ? ? -133.09 -56.72 27 9 THR A 62 ? ? 70.09 149.20 28 10 ARG A 30 ? ? 62.27 150.72 29 10 ARG A 38 ? ? -82.72 47.34 30 10 THR A 62 ? ? 67.95 153.99 31 11 SER A 36 ? ? -104.69 46.52 32 12 SER A 33 ? ? -77.99 -83.79 33 12 ARG A 34 ? ? -67.08 1.04 34 12 ARG A 40 ? ? 66.02 127.05 35 12 THR A 62 ? ? 70.07 152.40 36 13 ARG A 38 ? ? 38.17 46.71 37 13 CYS A 51 ? ? 64.25 -173.17 38 13 THR A 62 ? ? 67.30 156.17 39 14 THR A 7 ? ? 36.10 68.33 40 14 CYS A 21 ? ? -140.65 -4.87 41 14 ARG A 30 ? ? 64.18 131.90 42 14 ARG A 34 ? ? 67.01 -4.09 43 14 ARG A 49 ? ? -118.53 -164.76 44 14 THR A 62 ? ? 67.71 135.45 45 15 LEU A 8 ? ? -127.01 -94.26 46 15 CYS A 9 ? ? 69.51 -165.84 47 15 SER A 29 ? ? 56.20 -100.55 48 15 SER A 39 ? ? -144.85 25.21 49 15 CYS A 47 ? ? -132.49 -53.90 50 15 THR A 62 ? ? 67.60 150.15 51 15 SER A 66 ? ? 69.27 138.43 52 16 CYS A 51 ? ? 46.96 -173.69 53 16 THR A 62 ? ? 67.68 147.62 54 17 CYS A 9 ? ? -127.20 -60.46 55 17 SER A 36 ? ? -73.11 -135.51 56 17 ARG A 40 ? ? 57.91 175.84 57 18 CYS A 9 ? ? -145.91 -46.83 58 18 ASP A 23 ? ? -67.84 3.59 59 18 SER A 33 ? ? 58.53 175.02 60 18 SER A 36 ? ? -70.65 -135.16 61 18 ALA A 64 ? ? -79.86 48.38 62 19 THR A 7 ? ? 37.85 84.95 63 19 CYS A 9 ? ? -161.94 -168.84 64 19 ARG A 30 ? ? -139.69 -52.33 65 19 SER A 36 ? ? -75.15 -165.40 66 19 SER A 39 ? ? 63.71 178.58 67 19 THR A 62 ? ? 62.00 154.55 68 20 ASP A 23 ? ? -69.79 0.53 69 20 SER A 36 ? ? -65.54 -160.83 70 20 THR A 62 ? ? 66.11 159.46 #