data_5LAH # _entry.id 5LAH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5LAH pdb_00005lah 10.2210/pdb5lah/pdb WWPDB D_1200000427 ? ? BMRB 34008 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 34008 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5LAH _pdbx_database_status.recvd_initial_deposition_date 2016-06-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mineev, K.S.' 1 ? 'Arseniev, A.S.' 2 ? 'Andreev, Y.A.' 3 ? 'Kozlov, S.A.' 4 ? 'Logashina, Y.A.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Toxins _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2072-6651 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 154 _citation.page_last ? _citation.title 'New Disulfide-Stabilized Fold Provides Sea Anemone Peptide to Exhibit Both Antimicrobial and TRPA1 Potentiating Properties' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/toxins9050154 _citation.pdbx_database_id_PubMed 28468269 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Logashina, Y.A.' 1 ? primary 'Solstad, R.G.' 2 ? primary 'Mineev, K.S.' 3 ? primary 'Korolkova, Y.V.' 4 ? primary 'Mosharova, I.V.' 5 ? primary 'Dyachenko, I.A.' 6 ? primary 'Palikov, V.A.' 7 ? primary 'Palikova, Y.A.' 8 ? primary 'Murashev, A.N.' 9 ? primary 'Arseniev, A.S.' 10 ? primary 'Kozlov, S.A.' 11 ? primary 'Stensvag, K.' 12 ? primary 'Haug, T.' 13 ? primary 'Andreev, Y.A.' 14 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5LAH _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5LAH _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'tau-AnmTx Ueq 12-1' _entity.formula_weight 4808.258 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CYPGQPGCGHCSRPNYCEGARCESGFHDCGSDHWCDASGDRCCCA _entity_poly.pdbx_seq_one_letter_code_can CYPGQPGCGHCSRPNYCEGARCESGFHDCGSDHWCDASGDRCCCA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 TYR n 1 3 PRO n 1 4 GLY n 1 5 GLN n 1 6 PRO n 1 7 GLY n 1 8 CYS n 1 9 GLY n 1 10 HIS n 1 11 CYS n 1 12 SER n 1 13 ARG n 1 14 PRO n 1 15 ASN n 1 16 TYR n 1 17 CYS n 1 18 GLU n 1 19 GLY n 1 20 ALA n 1 21 ARG n 1 22 CYS n 1 23 GLU n 1 24 SER n 1 25 GLY n 1 26 PHE n 1 27 HIS n 1 28 ASP n 1 29 CYS n 1 30 GLY n 1 31 SER n 1 32 ASP n 1 33 HIS n 1 34 TRP n 1 35 CYS n 1 36 ASP n 1 37 ALA n 1 38 SER n 1 39 GLY n 1 40 ASP n 1 41 ARG n 1 42 CYS n 1 43 CYS n 1 44 CYS n 1 45 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 45 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Urticina eques' _entity_src_nat.pdbx_ncbi_taxonomy_id 417072 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5LAH _struct_ref.pdbx_db_accession 5LAH _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5LAH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5LAH _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 45 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 45 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 NOESY 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 2 '2D 1H-13C HSQC' 1 isotropic 5 1 2 '2D 1H-1H NOESY' 1 isotropic 6 1 2 '2D 1H-1H TOCSY' 1 isotropic 7 1 2 '2D DQF-COSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 3.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.05 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM tau-AnmTx Ueq 12-1, 1 mM sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' 'water sample' solution ? 2 '0.5 mM tau-AnmTx Ueq 12-1, 1 mM sodium azide, 100% D2O' '100% D2O' D2O_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5LAH _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5LAH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5LAH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.0 'Guntert, Mumenthaler and Wuthrich' 2 'chemical shift assignment' CARA 1.9.4 'Keller and Wuthrich' 3 processing TopSpin ? 'Bruker Biospin' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5LAH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5LAH _struct.title 'NMR structure of the sea anemone peptide tau-AnmTx Ueq 12-1 with an uncommon fold' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5LAH _struct_keywords.text 'PROTEIN, sea anemone, antimicrobial peptide, TRPA1 potentiator, membrane protein, toxin' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length TURN_P TURN_P1 T01 CYS A 1 ? GLN A 5 ? CYS A 1 GLN A 5 5 ? ? TURN_P TURN_P2 T02 CYS A 1 ? CYS A 8 ? CYS A 1 CYS A 8 5 ? ? TURN_P TURN_P3 T03 CYS A 1 ? ASN A 15 ? CYS A 1 ASN A 15 5 ? ? TURN_P TURN_P4 T04 CYS A 1 ? PHE A 26 ? CYS A 1 PHE A 26 5 ? ? TURN_P TURN_P5 T05 CYS A 1 ? ASP A 40 ? CYS A 1 ASP A 40 5 ? ? # _struct_conf_type.id TURN_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 8 SG ? ? A CYS 1 A CYS 8 1_555 ? ? ? ? ? ? ? 1.968 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 11 A CYS 42 1_555 ? ? ? ? ? ? ? 2.122 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 17 A CYS 35 1_555 ? ? ? ? ? ? ? 2.118 ? ? disulf4 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 22 A CYS 43 1_555 ? ? ? ? ? ? ? 1.996 ? ? disulf5 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 29 A CYS 44 1_555 ? ? ? ? ? ? ? 1.997 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 1 -0.01 2 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 2 -0.06 3 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 3 0.00 4 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 4 0.05 5 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 5 -0.03 6 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 6 -0.03 7 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 7 0.08 8 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 8 0.03 9 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 9 0.03 10 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 10 -0.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 9 ? HIS A 10 ? GLY A 9 HIS A 10 AA1 2 HIS A 33 ? TRP A 34 ? HIS A 33 TRP A 34 AA2 1 TYR A 16 ? GLU A 18 ? TYR A 16 GLU A 18 AA2 2 ARG A 41 ? CYS A 44 ? ARG A 41 CYS A 44 AA2 3 HIS A 27 ? ASP A 28 ? HIS A 27 ASP A 28 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 9 ? N GLY A 9 O TRP A 34 ? O TRP A 34 AA2 1 2 N TYR A 16 ? N TYR A 16 O CYS A 43 ? O CYS A 43 AA2 2 3 O CYS A 44 ? O CYS A 44 N HIS A 27 ? N HIS A 27 # _database_PDB_matrix.entry_id 5LAH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5LAH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3060 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-10 2 'Structure model' 1 1 2017-05-24 3 'Structure model' 1 2 2018-01-17 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 2 0 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Atomic model' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 4 'Structure model' pdbx_nmr_software 3 5 'Structure model' atom_site 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_database_status 6 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.name' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 5 'Structure model' '_atom_site.auth_atom_id' 4 5 'Structure model' '_atom_site.label_atom_id' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 5 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'tau-AnmTx Ueq 12-1' 0.5 ? mM 'natural abundance' 1 'sodium azide' 1 ? mM 'natural abundance' 2 'tau-AnmTx Ueq 12-1' 0.5 ? mM 'natural abundance' 2 'sodium azide' 1 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -69.80 83.52 2 1 PRO A 6 ? ? -69.78 91.65 3 1 PRO A 14 ? ? -69.76 13.90 4 1 ALA A 20 ? ? -127.20 -81.21 5 1 SER A 24 ? ? -71.19 35.99 6 1 SER A 38 ? ? -58.87 78.71 7 2 PRO A 3 ? ? -69.79 79.59 8 2 PRO A 6 ? ? -69.70 81.64 9 2 PRO A 14 ? ? -69.71 12.92 10 2 ALA A 20 ? ? -140.26 -77.52 11 2 SER A 24 ? ? -71.23 38.26 12 2 SER A 31 ? ? -43.64 -74.54 13 2 SER A 38 ? ? -57.55 79.01 14 3 PRO A 3 ? ? -69.71 82.90 15 3 PRO A 6 ? ? -69.73 91.15 16 3 PRO A 14 ? ? -69.79 13.72 17 3 ALA A 20 ? ? -134.64 -74.45 18 3 SER A 24 ? ? -57.57 88.68 19 3 SER A 31 ? ? -43.80 -73.56 20 3 SER A 38 ? ? -71.72 44.96 21 4 PRO A 3 ? ? -69.77 79.79 22 4 PRO A 14 ? ? -69.75 13.51 23 4 ALA A 20 ? ? -128.54 -158.69 24 4 SER A 24 ? ? -56.82 82.00 25 4 SER A 31 ? ? -44.85 -71.43 26 4 SER A 38 ? ? -59.59 79.08 27 5 PRO A 3 ? ? -69.76 84.27 28 5 PRO A 6 ? ? -69.80 84.53 29 5 ARG A 13 ? ? -39.89 145.84 30 5 PRO A 14 ? ? -69.72 13.77 31 5 ALA A 20 ? ? -126.56 -72.96 32 5 SER A 24 ? ? -56.67 91.37 33 5 SER A 38 ? ? -58.65 78.60 34 6 PRO A 3 ? ? -69.67 81.05 35 6 PRO A 14 ? ? -69.77 13.41 36 6 ALA A 20 ? ? -132.69 -76.50 37 6 SER A 24 ? ? -71.39 39.00 38 6 SER A 31 ? ? -44.87 -70.79 39 6 SER A 38 ? ? -58.05 78.61 40 7 PRO A 3 ? ? -69.72 81.06 41 7 PRO A 6 ? ? -69.78 90.57 42 7 ARG A 13 ? ? -39.76 145.57 43 7 PRO A 14 ? ? -69.82 13.68 44 7 ALA A 20 ? ? -128.63 -72.64 45 7 SER A 24 ? ? -57.53 92.70 46 7 SER A 31 ? ? -43.88 -71.48 47 7 SER A 38 ? ? -59.62 77.69 48 8 PRO A 6 ? ? -69.76 90.35 49 8 ARG A 13 ? ? -39.82 146.04 50 8 PRO A 14 ? ? -69.75 13.98 51 8 ALA A 20 ? ? -124.80 -75.61 52 8 SER A 24 ? ? -56.81 81.10 53 8 SER A 31 ? ? -42.46 -73.55 54 8 SER A 38 ? ? -58.27 78.28 55 9 PRO A 3 ? ? -69.70 80.80 56 9 PRO A 6 ? ? -69.79 91.56 57 9 ARG A 13 ? ? -39.88 146.31 58 9 PRO A 14 ? ? -69.76 14.11 59 9 ALA A 20 ? ? -127.64 -160.92 60 9 SER A 24 ? ? -56.58 80.61 61 9 SER A 31 ? ? -42.19 -74.11 62 9 SER A 38 ? ? -58.89 79.01 63 10 PRO A 3 ? ? -69.69 79.31 64 10 PRO A 6 ? ? -69.72 82.57 65 10 ARG A 13 ? ? -39.68 146.24 66 10 PRO A 14 ? ? -69.77 14.09 67 10 SER A 24 ? ? -55.60 82.83 68 10 SER A 31 ? ? -43.11 -74.49 69 10 SER A 38 ? ? -58.42 79.11 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 16-15-00167 _pdbx_audit_support.ordinal 1 #