data_5LO1 # _entry.id 5LO1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.294 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5LO1 WWPDB D_1200001085 # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 4EEH _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5LO1 _pdbx_database_status.recvd_initial_deposition_date 2016-08-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Graedler, U.' 1 'Amaral, M.' 2 'Schuetz, D.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Med. Chem.' _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 1520-4804 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 4397 _citation.page_last 4411 _citation.title 'Ligand Desolvation Steers On-Rate and Impacts Drug Residence Time of Heat Shock Protein 90 (Hsp90) Inhibitors.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.8b00080 _citation.pdbx_database_id_PubMed 29701469 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Schuetz, D.A.' 1 primary 'Richter, L.' 2 primary 'Amaral, M.' 3 primary 'Grandits, M.' 4 primary 'Gradler, U.' 5 primary 'Musil, D.' 6 primary 'Buchstaller, H.P.' 7 primary 'Eggenweiler, H.M.' 8 primary 'Frech, M.' 9 primary 'Ecker, G.F.' 10 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5LO1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 65.860 _cell.length_a_esd ? _cell.length_b 92.360 _cell.length_b_esd ? _cell.length_c 97.110 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5LO1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Heat shock protein HSP 90-alpha' 25713.822 1 ? ? ? ? 2 non-polymer syn '1-[2-Amino-4-(1,3-dihydro-isoindole-2-carbonyl)-quinazolin-6-yl]-cyclobutanecarboxylic acid ethylamide' 415.488 1 ? ? ? ? 3 water nat water 18.015 17 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Heat shock 86 kDa,HSP86,Lipopolysaccharide-associated protein 2,LPS-associated protein 2,Renal carcinoma antigen NY-REN-38' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDR TLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAG GSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE ; _entity_poly.pdbx_seq_one_letter_code_can ;GDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDR TLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAG GSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 GLN n 1 4 PRO n 1 5 MET n 1 6 GLU n 1 7 GLU n 1 8 GLU n 1 9 GLU n 1 10 VAL n 1 11 GLU n 1 12 THR n 1 13 PHE n 1 14 ALA n 1 15 PHE n 1 16 GLN n 1 17 ALA n 1 18 GLU n 1 19 ILE n 1 20 ALA n 1 21 GLN n 1 22 LEU n 1 23 MET n 1 24 SER n 1 25 LEU n 1 26 ILE n 1 27 ILE n 1 28 ASN n 1 29 THR n 1 30 PHE n 1 31 TYR n 1 32 SER n 1 33 ASN n 1 34 LYS n 1 35 GLU n 1 36 ILE n 1 37 PHE n 1 38 LEU n 1 39 ARG n 1 40 GLU n 1 41 LEU n 1 42 ILE n 1 43 SER n 1 44 ASN n 1 45 SER n 1 46 SER n 1 47 ASP n 1 48 ALA n 1 49 LEU n 1 50 ASP n 1 51 LYS n 1 52 ILE n 1 53 ARG n 1 54 TYR n 1 55 GLU n 1 56 SER n 1 57 LEU n 1 58 THR n 1 59 ASP n 1 60 PRO n 1 61 SER n 1 62 LYS n 1 63 LEU n 1 64 ASP n 1 65 SER n 1 66 GLY n 1 67 LYS n 1 68 GLU n 1 69 LEU n 1 70 HIS n 1 71 ILE n 1 72 ASN n 1 73 LEU n 1 74 ILE n 1 75 PRO n 1 76 ASN n 1 77 LYS n 1 78 GLN n 1 79 ASP n 1 80 ARG n 1 81 THR n 1 82 LEU n 1 83 THR n 1 84 ILE n 1 85 VAL n 1 86 ASP n 1 87 THR n 1 88 GLY n 1 89 ILE n 1 90 GLY n 1 91 MET n 1 92 THR n 1 93 LYS n 1 94 ALA n 1 95 ASP n 1 96 LEU n 1 97 ILE n 1 98 ASN n 1 99 ASN n 1 100 LEU n 1 101 GLY n 1 102 THR n 1 103 ILE n 1 104 ALA n 1 105 LYS n 1 106 SER n 1 107 GLY n 1 108 THR n 1 109 LYS n 1 110 ALA n 1 111 PHE n 1 112 MET n 1 113 GLU n 1 114 ALA n 1 115 LEU n 1 116 GLN n 1 117 ALA n 1 118 GLY n 1 119 ALA n 1 120 ASP n 1 121 ILE n 1 122 SER n 1 123 MET n 1 124 ILE n 1 125 GLY n 1 126 GLN n 1 127 PHE n 1 128 GLY n 1 129 VAL n 1 130 GLY n 1 131 PHE n 1 132 TYR n 1 133 SER n 1 134 ALA n 1 135 TYR n 1 136 LEU n 1 137 VAL n 1 138 ALA n 1 139 GLU n 1 140 LYS n 1 141 VAL n 1 142 THR n 1 143 VAL n 1 144 ILE n 1 145 THR n 1 146 LYS n 1 147 HIS n 1 148 ASN n 1 149 ASP n 1 150 ASP n 1 151 GLU n 1 152 GLN n 1 153 TYR n 1 154 ALA n 1 155 TRP n 1 156 GLU n 1 157 SER n 1 158 SER n 1 159 ALA n 1 160 GLY n 1 161 GLY n 1 162 SER n 1 163 PHE n 1 164 THR n 1 165 VAL n 1 166 ARG n 1 167 THR n 1 168 ASP n 1 169 THR n 1 170 GLY n 1 171 GLU n 1 172 PRO n 1 173 MET n 1 174 GLY n 1 175 ARG n 1 176 GLY n 1 177 THR n 1 178 LYS n 1 179 VAL n 1 180 ILE n 1 181 LEU n 1 182 HIS n 1 183 LEU n 1 184 LYS n 1 185 GLU n 1 186 ASP n 1 187 GLN n 1 188 THR n 1 189 GLU n 1 190 TYR n 1 191 LEU n 1 192 GLU n 1 193 GLU n 1 194 ARG n 1 195 ARG n 1 196 ILE n 1 197 LYS n 1 198 GLU n 1 199 ILE n 1 200 VAL n 1 201 LYS n 1 202 LYS n 1 203 HIS n 1 204 SER n 1 205 GLN n 1 206 PHE n 1 207 ILE n 1 208 GLY n 1 209 TYR n 1 210 PRO n 1 211 ILE n 1 212 THR n 1 213 LEU n 1 214 PHE n 1 215 VAL n 1 216 GLU n 1 217 LYS n 1 218 GLU n 1 219 ARG n 1 220 ASP n 1 221 LYS n 1 222 GLU n 1 223 VAL n 1 224 SER n 1 225 ASP n 1 226 ASP n 1 227 GLU n 1 228 ALA n 1 229 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 229 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HSP90AA1, HSP90A, HSPC1, HSPCA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HS90A_HUMAN _struct_ref.pdbx_db_accession P07900 _struct_ref.pdbx_db_isoform P07900-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRT LTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGG SFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE ; _struct_ref.pdbx_align_begin 131 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5LO1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07900 _struct_ref_seq.db_align_beg 131 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 358 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 9 _struct_ref_seq.pdbx_auth_seq_align_end 236 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5LO1 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P07900 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 8 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 70L non-polymer . '1-[2-Amino-4-(1,3-dihydro-isoindole-2-carbonyl)-quinazolin-6-yl]-cyclobutanecarboxylic acid ethylamide' ? 'C24 H25 N5 O2' 415.488 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5LO1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Bis-Tris Propan, pH 6.5 22% PEG 3350 0,2M NaF ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-12-17 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X1A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X1A _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate 98.17 _reflns.entry_id 5LO1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.67 _reflns.d_resolution_low 48.55 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8553 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.67 _reflns_shell.d_res_low 2.76 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 77.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 8.01970 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] -9.87300 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 1.85330 _refine.B_iso_max ? _refine.B_iso_mean 88.99 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.930 _refine.correlation_coeff_Fo_to_Fc_free 0.938 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5LO1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 48.55 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8411 _refine.ls_number_reflns_R_free 388 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5 _refine.ls_percent_reflns_R_free 4.610 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.234 _refine.ls_R_factor_R_free 0.246 _refine.ls_R_factor_R_free_error 0.01 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.233 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.287 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.284 _refine.pdbx_overall_SU_R_Blow_DPI 0.547 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.541 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5LO1 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.39 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1465 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 17 _refine_hist.number_atoms_total 1513 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 48.55 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1582 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.19 ? 2135 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 559 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 42 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 223 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1582 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.94 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 20.51 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 215 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1807 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 3.02 _refine_ls_shell.number_reflns_all 2326 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 110 _refine_ls_shell.number_reflns_R_work 2216 _refine_ls_shell.percent_reflns_obs 98.94 _refine_ls_shell.percent_reflns_R_free 4.73 _refine_ls_shell.R_factor_all 0.266 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.304 _refine_ls_shell.R_factor_R_free_error 0.000 _refine_ls_shell.R_factor_R_work 0.264 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5LO1 _struct.title 'HSP90 WITH indazole derivative' _struct.pdbx_descriptor 'Heat shock protein HSP 90-alpha' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5LO1 _struct_keywords.text CHAPERONE _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 16 ? THR A 29 ? GLN A 23 THR A 36 1 ? 14 HELX_P HELX_P2 AA2 GLU A 35 ? THR A 58 ? GLU A 42 THR A 65 1 ? 24 HELX_P HELX_P3 AA3 THR A 92 ? ILE A 97 ? THR A 99 ILE A 104 1 ? 6 HELX_P HELX_P4 AA4 ASN A 99 ? ALA A 114 ? ASN A 106 ALA A 121 1 ? 16 HELX_P HELX_P5 AA5 MET A 123 ? GLY A 128 ? MET A 130 GLY A 135 5 ? 6 HELX_P HELX_P6 AA6 VAL A 129 ? LEU A 136 ? VAL A 136 LEU A 143 5 ? 8 HELX_P HELX_P7 AA7 GLN A 187 ? LEU A 191 ? GLN A 194 LEU A 198 5 ? 5 HELX_P HELX_P8 AA8 GLU A 192 ? SER A 204 ? GLU A 199 SER A 211 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 11 ? ALA A 14 ? GLU A 18 ALA A 21 AA1 2 SER A 162 ? THR A 167 ? SER A 169 THR A 174 AA1 3 GLN A 152 ? SER A 157 ? GLN A 159 SER A 164 AA1 4 ALA A 138 ? LYS A 146 ? ALA A 145 LYS A 153 AA1 5 GLY A 176 ? LEU A 183 ? GLY A 183 LEU A 190 AA1 6 THR A 81 ? ASP A 86 ? THR A 88 ASP A 93 AA1 7 ILE A 71 ? ASN A 76 ? ILE A 78 ASN A 83 AA1 8 ILE A 211 ? LEU A 213 ? ILE A 218 LEU A 220 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 13 ? N PHE A 20 O PHE A 163 ? O PHE A 170 AA1 2 3 O ARG A 166 ? O ARG A 173 N ALA A 154 ? N ALA A 161 AA1 3 4 O TRP A 155 ? O TRP A 162 N VAL A 143 ? N VAL A 150 AA1 4 5 N THR A 142 ? N THR A 149 O ILE A 180 ? O ILE A 187 AA1 5 6 O LEU A 181 ? O LEU A 188 N LEU A 82 ? N LEU A 89 AA1 6 7 O THR A 83 ? O THR A 90 N ILE A 74 ? N ILE A 81 AA1 7 8 N LEU A 73 ? N LEU A 80 O THR A 212 ? O THR A 219 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 70L _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'binding site for residue 70L A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 ASN A 44 ? ASN A 51 . ? 1_555 ? 2 AC1 15 ASP A 47 ? ASP A 54 . ? 1_555 ? 3 AC1 15 ALA A 48 ? ALA A 55 . ? 1_555 ? 4 AC1 15 ASP A 86 ? ASP A 93 . ? 1_555 ? 5 AC1 15 ILE A 89 ? ILE A 96 . ? 1_555 ? 6 AC1 15 GLY A 90 ? GLY A 97 . ? 1_555 ? 7 AC1 15 MET A 91 ? MET A 98 . ? 1_555 ? 8 AC1 15 ASP A 95 ? ASP A 102 . ? 1_555 ? 9 AC1 15 LEU A 100 ? LEU A 107 . ? 1_555 ? 10 AC1 15 PHE A 131 ? PHE A 138 . ? 1_555 ? 11 AC1 15 TYR A 132 ? TYR A 139 . ? 1_555 ? 12 AC1 15 TRP A 155 ? TRP A 162 . ? 1_555 ? 13 AC1 15 THR A 177 ? THR A 184 . ? 1_555 ? 14 AC1 15 HOH C . ? HOH A 403 . ? 1_555 ? 15 AC1 15 HOH C . ? HOH A 404 . ? 1_555 ? # _atom_sites.entry_id 5LO1 _atom_sites.fract_transf_matrix[1][1] 0.015184 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010827 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010298 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 8 ? ? ? A . n A 1 2 ASP 2 9 ? ? ? A . n A 1 3 GLN 3 10 ? ? ? A . n A 1 4 PRO 4 11 ? ? ? A . n A 1 5 MET 5 12 ? ? ? A . n A 1 6 GLU 6 13 ? ? ? A . n A 1 7 GLU 7 14 ? ? ? A . n A 1 8 GLU 8 15 ? ? ? A . n A 1 9 GLU 9 16 ? ? ? A . n A 1 10 VAL 10 17 17 VAL VAL A . n A 1 11 GLU 11 18 18 GLU GLU A . n A 1 12 THR 12 19 19 THR THR A . n A 1 13 PHE 13 20 20 PHE PHE A . n A 1 14 ALA 14 21 21 ALA ALA A . n A 1 15 PHE 15 22 22 PHE PHE A . n A 1 16 GLN 16 23 23 GLN GLN A . n A 1 17 ALA 17 24 24 ALA ALA A . n A 1 18 GLU 18 25 25 GLU GLU A . n A 1 19 ILE 19 26 26 ILE ILE A . n A 1 20 ALA 20 27 27 ALA ALA A . n A 1 21 GLN 21 28 28 GLN GLN A . n A 1 22 LEU 22 29 29 LEU LEU A . n A 1 23 MET 23 30 30 MET MET A . n A 1 24 SER 24 31 31 SER SER A . n A 1 25 LEU 25 32 32 LEU LEU A . n A 1 26 ILE 26 33 33 ILE ILE A . n A 1 27 ILE 27 34 34 ILE ILE A . n A 1 28 ASN 28 35 35 ASN ASN A . n A 1 29 THR 29 36 36 THR THR A . n A 1 30 PHE 30 37 37 PHE PHE A . n A 1 31 TYR 31 38 38 TYR TYR A . n A 1 32 SER 32 39 39 SER SER A . n A 1 33 ASN 33 40 40 ASN ASN A . n A 1 34 LYS 34 41 41 LYS LYS A . n A 1 35 GLU 35 42 42 GLU GLU A . n A 1 36 ILE 36 43 43 ILE ILE A . n A 1 37 PHE 37 44 44 PHE PHE A . n A 1 38 LEU 38 45 45 LEU LEU A . n A 1 39 ARG 39 46 46 ARG ARG A . n A 1 40 GLU 40 47 47 GLU GLU A . n A 1 41 LEU 41 48 48 LEU LEU A . n A 1 42 ILE 42 49 49 ILE ILE A . n A 1 43 SER 43 50 50 SER SER A . n A 1 44 ASN 44 51 51 ASN ASN A . n A 1 45 SER 45 52 52 SER SER A . n A 1 46 SER 46 53 53 SER SER A . n A 1 47 ASP 47 54 54 ASP ASP A . n A 1 48 ALA 48 55 55 ALA ALA A . n A 1 49 LEU 49 56 56 LEU LEU A . n A 1 50 ASP 50 57 57 ASP ASP A . n A 1 51 LYS 51 58 58 LYS LYS A . n A 1 52 ILE 52 59 59 ILE ILE A . n A 1 53 ARG 53 60 60 ARG ARG A . n A 1 54 TYR 54 61 61 TYR TYR A . n A 1 55 GLU 55 62 62 GLU GLU A . n A 1 56 SER 56 63 63 SER SER A . n A 1 57 LEU 57 64 64 LEU LEU A . n A 1 58 THR 58 65 65 THR THR A . n A 1 59 ASP 59 66 ? ? ? A . n A 1 60 PRO 60 67 ? ? ? A . n A 1 61 SER 61 68 ? ? ? A . n A 1 62 LYS 62 69 ? ? ? A . n A 1 63 LEU 63 70 ? ? ? A . n A 1 64 ASP 64 71 ? ? ? A . n A 1 65 SER 65 72 ? ? ? A . n A 1 66 GLY 66 73 ? ? ? A . n A 1 67 LYS 67 74 74 LYS LYS A . n A 1 68 GLU 68 75 75 GLU GLU A . n A 1 69 LEU 69 76 76 LEU LEU A . n A 1 70 HIS 70 77 77 HIS HIS A . n A 1 71 ILE 71 78 78 ILE ILE A . n A 1 72 ASN 72 79 79 ASN ASN A . n A 1 73 LEU 73 80 80 LEU LEU A . n A 1 74 ILE 74 81 81 ILE ILE A . n A 1 75 PRO 75 82 82 PRO PRO A . n A 1 76 ASN 76 83 83 ASN ASN A . n A 1 77 LYS 77 84 84 LYS LYS A . n A 1 78 GLN 78 85 85 GLN GLN A . n A 1 79 ASP 79 86 86 ASP ASP A . n A 1 80 ARG 80 87 87 ARG ARG A . n A 1 81 THR 81 88 88 THR THR A . n A 1 82 LEU 82 89 89 LEU LEU A . n A 1 83 THR 83 90 90 THR THR A . n A 1 84 ILE 84 91 91 ILE ILE A . n A 1 85 VAL 85 92 92 VAL VAL A . n A 1 86 ASP 86 93 93 ASP ASP A . n A 1 87 THR 87 94 94 THR THR A . n A 1 88 GLY 88 95 95 GLY GLY A . n A 1 89 ILE 89 96 96 ILE ILE A . n A 1 90 GLY 90 97 97 GLY GLY A . n A 1 91 MET 91 98 98 MET MET A . n A 1 92 THR 92 99 99 THR THR A . n A 1 93 LYS 93 100 100 LYS LYS A . n A 1 94 ALA 94 101 101 ALA ALA A . n A 1 95 ASP 95 102 102 ASP ASP A . n A 1 96 LEU 96 103 103 LEU LEU A . n A 1 97 ILE 97 104 104 ILE ILE A . n A 1 98 ASN 98 105 105 ASN ASN A . n A 1 99 ASN 99 106 106 ASN ASN A . n A 1 100 LEU 100 107 107 LEU LEU A . n A 1 101 GLY 101 108 108 GLY GLY A . n A 1 102 THR 102 109 109 THR THR A . n A 1 103 ILE 103 110 110 ILE ILE A . n A 1 104 ALA 104 111 111 ALA ALA A . n A 1 105 LYS 105 112 112 LYS LYS A . n A 1 106 SER 106 113 113 SER SER A . n A 1 107 GLY 107 114 114 GLY GLY A . n A 1 108 THR 108 115 115 THR THR A . n A 1 109 LYS 109 116 116 LYS LYS A . n A 1 110 ALA 110 117 117 ALA ALA A . n A 1 111 PHE 111 118 118 PHE PHE A . n A 1 112 MET 112 119 119 MET MET A . n A 1 113 GLU 113 120 120 GLU GLU A . n A 1 114 ALA 114 121 121 ALA ALA A . n A 1 115 LEU 115 122 ? ? ? A . n A 1 116 GLN 116 123 ? ? ? A . n A 1 117 ALA 117 124 ? ? ? A . n A 1 118 GLY 118 125 ? ? ? A . n A 1 119 ALA 119 126 ? ? ? A . n A 1 120 ASP 120 127 ? ? ? A . n A 1 121 ILE 121 128 ? ? ? A . n A 1 122 SER 122 129 129 SER SER A . n A 1 123 MET 123 130 130 MET MET A . n A 1 124 ILE 124 131 131 ILE ILE A . n A 1 125 GLY 125 132 132 GLY GLY A . n A 1 126 GLN 126 133 133 GLN GLN A . n A 1 127 PHE 127 134 134 PHE PHE A . n A 1 128 GLY 128 135 135 GLY GLY A . n A 1 129 VAL 129 136 136 VAL VAL A . n A 1 130 GLY 130 137 137 GLY GLY A . n A 1 131 PHE 131 138 138 PHE PHE A . n A 1 132 TYR 132 139 139 TYR TYR A . n A 1 133 SER 133 140 140 SER SER A . n A 1 134 ALA 134 141 141 ALA ALA A . n A 1 135 TYR 135 142 142 TYR TYR A . n A 1 136 LEU 136 143 143 LEU LEU A . n A 1 137 VAL 137 144 144 VAL VAL A . n A 1 138 ALA 138 145 145 ALA ALA A . n A 1 139 GLU 139 146 146 GLU GLU A . n A 1 140 LYS 140 147 147 LYS LYS A . n A 1 141 VAL 141 148 148 VAL VAL A . n A 1 142 THR 142 149 149 THR THR A . n A 1 143 VAL 143 150 150 VAL VAL A . n A 1 144 ILE 144 151 151 ILE ILE A . n A 1 145 THR 145 152 152 THR THR A . n A 1 146 LYS 146 153 153 LYS LYS A . n A 1 147 HIS 147 154 154 HIS HIS A . n A 1 148 ASN 148 155 155 ASN ASN A . n A 1 149 ASP 149 156 156 ASP ASP A . n A 1 150 ASP 150 157 157 ASP ASP A . n A 1 151 GLU 151 158 158 GLU GLU A . n A 1 152 GLN 152 159 159 GLN GLN A . n A 1 153 TYR 153 160 160 TYR TYR A . n A 1 154 ALA 154 161 161 ALA ALA A . n A 1 155 TRP 155 162 162 TRP TRP A . n A 1 156 GLU 156 163 163 GLU GLU A . n A 1 157 SER 157 164 164 SER SER A . n A 1 158 SER 158 165 165 SER SER A . n A 1 159 ALA 159 166 166 ALA ALA A . n A 1 160 GLY 160 167 167 GLY GLY A . n A 1 161 GLY 161 168 168 GLY GLY A . n A 1 162 SER 162 169 169 SER SER A . n A 1 163 PHE 163 170 170 PHE PHE A . n A 1 164 THR 164 171 171 THR THR A . n A 1 165 VAL 165 172 172 VAL VAL A . n A 1 166 ARG 166 173 173 ARG ARG A . n A 1 167 THR 167 174 174 THR THR A . n A 1 168 ASP 168 175 175 ASP ASP A . n A 1 169 THR 169 176 176 THR THR A . n A 1 170 GLY 170 177 177 GLY GLY A . n A 1 171 GLU 171 178 178 GLU GLU A . n A 1 172 PRO 172 179 179 PRO PRO A . n A 1 173 MET 173 180 180 MET MET A . n A 1 174 GLY 174 181 181 GLY GLY A . n A 1 175 ARG 175 182 182 ARG ARG A . n A 1 176 GLY 176 183 183 GLY GLY A . n A 1 177 THR 177 184 184 THR THR A . n A 1 178 LYS 178 185 185 LYS LYS A . n A 1 179 VAL 179 186 186 VAL VAL A . n A 1 180 ILE 180 187 187 ILE ILE A . n A 1 181 LEU 181 188 188 LEU LEU A . n A 1 182 HIS 182 189 189 HIS HIS A . n A 1 183 LEU 183 190 190 LEU LEU A . n A 1 184 LYS 184 191 191 LYS LYS A . n A 1 185 GLU 185 192 192 GLU GLU A . n A 1 186 ASP 186 193 193 ASP ASP A . n A 1 187 GLN 187 194 194 GLN GLN A . n A 1 188 THR 188 195 195 THR THR A . n A 1 189 GLU 189 196 196 GLU GLU A . n A 1 190 TYR 190 197 197 TYR TYR A . n A 1 191 LEU 191 198 198 LEU LEU A . n A 1 192 GLU 192 199 199 GLU GLU A . n A 1 193 GLU 193 200 200 GLU GLU A . n A 1 194 ARG 194 201 201 ARG ARG A . n A 1 195 ARG 195 202 202 ARG ARG A . n A 1 196 ILE 196 203 203 ILE ILE A . n A 1 197 LYS 197 204 204 LYS LYS A . n A 1 198 GLU 198 205 205 GLU GLU A . n A 1 199 ILE 199 206 206 ILE ILE A . n A 1 200 VAL 200 207 207 VAL VAL A . n A 1 201 LYS 201 208 208 LYS LYS A . n A 1 202 LYS 202 209 209 LYS LYS A . n A 1 203 HIS 203 210 210 HIS HIS A . n A 1 204 SER 204 211 211 SER SER A . n A 1 205 GLN 205 212 212 GLN GLN A . n A 1 206 PHE 206 213 213 PHE PHE A . n A 1 207 ILE 207 214 214 ILE ILE A . n A 1 208 GLY 208 215 215 GLY GLY A . n A 1 209 TYR 209 216 216 TYR TYR A . n A 1 210 PRO 210 217 217 PRO PRO A . n A 1 211 ILE 211 218 218 ILE ILE A . n A 1 212 THR 212 219 219 THR THR A . n A 1 213 LEU 213 220 220 LEU LEU A . n A 1 214 PHE 214 221 221 PHE PHE A . n A 1 215 VAL 215 222 222 VAL VAL A . n A 1 216 GLU 216 223 223 GLU GLU A . n A 1 217 LYS 217 224 ? ? ? A . n A 1 218 GLU 218 225 ? ? ? A . n A 1 219 ARG 219 226 ? ? ? A . n A 1 220 ASP 220 227 ? ? ? A . n A 1 221 LYS 221 228 ? ? ? A . n A 1 222 GLU 222 229 ? ? ? A . n A 1 223 VAL 223 230 ? ? ? A . n A 1 224 SER 224 231 ? ? ? A . n A 1 225 ASP 225 232 ? ? ? A . n A 1 226 ASP 226 233 ? ? ? A . n A 1 227 GLU 227 234 ? ? ? A . n A 1 228 ALA 228 235 ? ? ? A . n A 1 229 GLU 229 236 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 70L 1 301 1 70L INH A . C 3 HOH 1 401 11 HOH HOH A . C 3 HOH 2 402 5 HOH HOH A . C 3 HOH 3 403 3 HOH HOH A . C 3 HOH 4 404 1 HOH HOH A . C 3 HOH 5 405 4 HOH HOH A . C 3 HOH 6 406 8 HOH HOH A . C 3 HOH 7 407 2 HOH HOH A . C 3 HOH 8 408 6 HOH HOH A . C 3 HOH 9 409 13 HOH HOH A . C 3 HOH 10 410 16 HOH HOH A . C 3 HOH 11 411 17 HOH HOH A . C 3 HOH 12 412 10 HOH HOH A . C 3 HOH 13 413 12 HOH HOH A . C 3 HOH 14 414 15 HOH HOH A . C 3 HOH 15 415 14 HOH HOH A . C 3 HOH 16 416 9 HOH HOH A . C 3 HOH 17 417 7 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10150 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-29 2 'Structure model' 1 1 2018-05-23 3 'Structure model' 1 2 2018-06-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -33.1940 _pdbx_refine_tls.origin_y -15.5513 _pdbx_refine_tls.origin_z -20.1070 _pdbx_refine_tls.T[1][1] -0.2302 _pdbx_refine_tls.T[2][2] -0.1564 _pdbx_refine_tls.T[3][3] -0.2087 _pdbx_refine_tls.T[1][2] 0.0202 _pdbx_refine_tls.T[1][3] -0.0440 _pdbx_refine_tls.T[2][3] -0.0318 _pdbx_refine_tls.L[1][1] 6.6086 _pdbx_refine_tls.L[2][2] 3.0913 _pdbx_refine_tls.L[3][3] 4.6908 _pdbx_refine_tls.L[1][2] -0.9241 _pdbx_refine_tls.L[1][3] -0.9352 _pdbx_refine_tls.L[2][3] 1.6363 _pdbx_refine_tls.S[1][1] 0.1078 _pdbx_refine_tls.S[1][2] -0.0876 _pdbx_refine_tls.S[1][3] 0.2368 _pdbx_refine_tls.S[2][1] -0.0806 _pdbx_refine_tls.S[2][2] -0.0248 _pdbx_refine_tls.S[2][3] -0.0804 _pdbx_refine_tls.S[3][1] -0.2191 _pdbx_refine_tls.S[3][2] -0.0031 _pdbx_refine_tls.S[3][3] -0.0830 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.6 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 40 ? ? -77.30 48.82 2 1 ILE A 104 ? ? -73.24 -79.35 3 1 ASN A 106 ? ? 86.58 -66.74 4 1 ALA A 166 ? ? 64.16 -133.74 5 1 ARG A 182 ? ? -35.51 128.22 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 8 ? A GLY 1 2 1 Y 1 A ASP 9 ? A ASP 2 3 1 Y 1 A GLN 10 ? A GLN 3 4 1 Y 1 A PRO 11 ? A PRO 4 5 1 Y 1 A MET 12 ? A MET 5 6 1 Y 1 A GLU 13 ? A GLU 6 7 1 Y 1 A GLU 14 ? A GLU 7 8 1 Y 1 A GLU 15 ? A GLU 8 9 1 Y 1 A GLU 16 ? A GLU 9 10 1 Y 1 A ASP 66 ? A ASP 59 11 1 Y 1 A PRO 67 ? A PRO 60 12 1 Y 1 A SER 68 ? A SER 61 13 1 Y 1 A LYS 69 ? A LYS 62 14 1 Y 1 A LEU 70 ? A LEU 63 15 1 Y 1 A ASP 71 ? A ASP 64 16 1 Y 1 A SER 72 ? A SER 65 17 1 Y 1 A GLY 73 ? A GLY 66 18 1 Y 1 A LEU 122 ? A LEU 115 19 1 Y 1 A GLN 123 ? A GLN 116 20 1 Y 1 A ALA 124 ? A ALA 117 21 1 Y 1 A GLY 125 ? A GLY 118 22 1 Y 1 A ALA 126 ? A ALA 119 23 1 Y 1 A ASP 127 ? A ASP 120 24 1 Y 1 A ILE 128 ? A ILE 121 25 1 Y 1 A LYS 224 ? A LYS 217 26 1 Y 1 A GLU 225 ? A GLU 218 27 1 Y 1 A ARG 226 ? A ARG 219 28 1 Y 1 A ASP 227 ? A ASP 220 29 1 Y 1 A LYS 228 ? A LYS 221 30 1 Y 1 A GLU 229 ? A GLU 222 31 1 Y 1 A VAL 230 ? A VAL 223 32 1 Y 1 A SER 231 ? A SER 224 33 1 Y 1 A ASP 232 ? A ASP 225 34 1 Y 1 A ASP 233 ? A ASP 226 35 1 Y 1 A GLU 234 ? A GLU 227 36 1 Y 1 A ALA 235 ? A ALA 228 37 1 Y 1 A GLU 236 ? A GLU 229 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[2-Amino-4-(1,3-dihydro-isoindole-2-carbonyl)-quinazolin-6-yl]-cyclobutanecarboxylic acid ethylamide' 70L 3 water HOH #