data_5LPW # _entry.id 5LPW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5LPW pdb_00005lpw 10.2210/pdb5lpw/pdb WWPDB D_1200001181 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-24 2 'Structure model' 1 1 2024-01-10 3 'Structure model' 1 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2016-08-24 _pdbx_database_PDB_obs_spr.pdb_id 5LPW _pdbx_database_PDB_obs_spr.replace_pdb_id 4OA6 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5LPW _pdbx_database_status.recvd_initial_deposition_date 2016-08-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bojar, D.' 1 'Martinez, J.' 2 'Hothorn, M.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plant J.' _citation.journal_id_ASTM PLJUED _citation.journal_id_CSD 2117 _citation.journal_id_ISSN 1365-313X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 78 _citation.language ? _citation.page_first 31 _citation.page_last 43 _citation.title 'Crystal structures of the phosphorylated BRI1 kinase domain and implications for brassinosteroid signal initiation.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/tpj.12445 _citation.pdbx_database_id_PubMed 24461462 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bojar, D.' 1 ? primary 'Martinez, J.' 2 ? primary 'Santiago, J.' 3 ? primary 'Rybin, V.' 4 ? primary 'Bayliss, R.' 5 ? primary 'Hothorn, M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein BRASSINOSTEROID INSENSITIVE 1' 33442.203 1 2.7.10.1,2.7.11.1 T872A ? ? 2 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AtBRI1,Brassinosteroid LRR receptor kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;EKPLRKLAFADLLQATNGFHNDSLIGSGGFGDVYKAILKDGSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLG YCKVGDERLLVYEFMKYGSLEDVLHDPKKAGVKLNWSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEAR VSDFGMARLMSAMD(TPO)HL(SEP)V(SEP)TLAGTPGYVPPEYYQ(SEP)FRCSTKGDVYSYGVVLLELLTGKRPTDS PDFGDNNLVGWVKQHAKLRISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQA ; _entity_poly.pdbx_seq_one_letter_code_can ;EKPLRKLAFADLLQATNGFHNDSLIGSGGFGDVYKAILKDGSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLG YCKVGDERLLVYEFMKYGSLEDVLHDPKKAGVKLNWSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEAR VSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSPDFGDNNLVGWVKQHA KLRISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LYS n 1 3 PRO n 1 4 LEU n 1 5 ARG n 1 6 LYS n 1 7 LEU n 1 8 ALA n 1 9 PHE n 1 10 ALA n 1 11 ASP n 1 12 LEU n 1 13 LEU n 1 14 GLN n 1 15 ALA n 1 16 THR n 1 17 ASN n 1 18 GLY n 1 19 PHE n 1 20 HIS n 1 21 ASN n 1 22 ASP n 1 23 SER n 1 24 LEU n 1 25 ILE n 1 26 GLY n 1 27 SER n 1 28 GLY n 1 29 GLY n 1 30 PHE n 1 31 GLY n 1 32 ASP n 1 33 VAL n 1 34 TYR n 1 35 LYS n 1 36 ALA n 1 37 ILE n 1 38 LEU n 1 39 LYS n 1 40 ASP n 1 41 GLY n 1 42 SER n 1 43 ALA n 1 44 VAL n 1 45 ALA n 1 46 ILE n 1 47 LYS n 1 48 LYS n 1 49 LEU n 1 50 ILE n 1 51 HIS n 1 52 VAL n 1 53 SER n 1 54 GLY n 1 55 GLN n 1 56 GLY n 1 57 ASP n 1 58 ARG n 1 59 GLU n 1 60 PHE n 1 61 MET n 1 62 ALA n 1 63 GLU n 1 64 MET n 1 65 GLU n 1 66 THR n 1 67 ILE n 1 68 GLY n 1 69 LYS n 1 70 ILE n 1 71 LYS n 1 72 HIS n 1 73 ARG n 1 74 ASN n 1 75 LEU n 1 76 VAL n 1 77 PRO n 1 78 LEU n 1 79 LEU n 1 80 GLY n 1 81 TYR n 1 82 CYS n 1 83 LYS n 1 84 VAL n 1 85 GLY n 1 86 ASP n 1 87 GLU n 1 88 ARG n 1 89 LEU n 1 90 LEU n 1 91 VAL n 1 92 TYR n 1 93 GLU n 1 94 PHE n 1 95 MET n 1 96 LYS n 1 97 TYR n 1 98 GLY n 1 99 SER n 1 100 LEU n 1 101 GLU n 1 102 ASP n 1 103 VAL n 1 104 LEU n 1 105 HIS n 1 106 ASP n 1 107 PRO n 1 108 LYS n 1 109 LYS n 1 110 ALA n 1 111 GLY n 1 112 VAL n 1 113 LYS n 1 114 LEU n 1 115 ASN n 1 116 TRP n 1 117 SER n 1 118 THR n 1 119 ARG n 1 120 ARG n 1 121 LYS n 1 122 ILE n 1 123 ALA n 1 124 ILE n 1 125 GLY n 1 126 SER n 1 127 ALA n 1 128 ARG n 1 129 GLY n 1 130 LEU n 1 131 ALA n 1 132 PHE n 1 133 LEU n 1 134 HIS n 1 135 HIS n 1 136 ASN n 1 137 CYS n 1 138 SER n 1 139 PRO n 1 140 HIS n 1 141 ILE n 1 142 ILE n 1 143 HIS n 1 144 ARG n 1 145 ASP n 1 146 MET n 1 147 LYS n 1 148 SER n 1 149 SER n 1 150 ASN n 1 151 VAL n 1 152 LEU n 1 153 LEU n 1 154 ASP n 1 155 GLU n 1 156 ASN n 1 157 LEU n 1 158 GLU n 1 159 ALA n 1 160 ARG n 1 161 VAL n 1 162 SER n 1 163 ASP n 1 164 PHE n 1 165 GLY n 1 166 MET n 1 167 ALA n 1 168 ARG n 1 169 LEU n 1 170 MET n 1 171 SER n 1 172 ALA n 1 173 MET n 1 174 ASP n 1 175 TPO n 1 176 HIS n 1 177 LEU n 1 178 SEP n 1 179 VAL n 1 180 SEP n 1 181 THR n 1 182 LEU n 1 183 ALA n 1 184 GLY n 1 185 THR n 1 186 PRO n 1 187 GLY n 1 188 TYR n 1 189 VAL n 1 190 PRO n 1 191 PRO n 1 192 GLU n 1 193 TYR n 1 194 TYR n 1 195 GLN n 1 196 SEP n 1 197 PHE n 1 198 ARG n 1 199 CYS n 1 200 SER n 1 201 THR n 1 202 LYS n 1 203 GLY n 1 204 ASP n 1 205 VAL n 1 206 TYR n 1 207 SER n 1 208 TYR n 1 209 GLY n 1 210 VAL n 1 211 VAL n 1 212 LEU n 1 213 LEU n 1 214 GLU n 1 215 LEU n 1 216 LEU n 1 217 THR n 1 218 GLY n 1 219 LYS n 1 220 ARG n 1 221 PRO n 1 222 THR n 1 223 ASP n 1 224 SER n 1 225 PRO n 1 226 ASP n 1 227 PHE n 1 228 GLY n 1 229 ASP n 1 230 ASN n 1 231 ASN n 1 232 LEU n 1 233 VAL n 1 234 GLY n 1 235 TRP n 1 236 VAL n 1 237 LYS n 1 238 GLN n 1 239 HIS n 1 240 ALA n 1 241 LYS n 1 242 LEU n 1 243 ARG n 1 244 ILE n 1 245 SER n 1 246 ASP n 1 247 VAL n 1 248 PHE n 1 249 ASP n 1 250 PRO n 1 251 GLU n 1 252 LEU n 1 253 MET n 1 254 LYS n 1 255 GLU n 1 256 ASP n 1 257 PRO n 1 258 ALA n 1 259 LEU n 1 260 GLU n 1 261 ILE n 1 262 GLU n 1 263 LEU n 1 264 LEU n 1 265 GLN n 1 266 HIS n 1 267 LEU n 1 268 LYS n 1 269 VAL n 1 270 ALA n 1 271 VAL n 1 272 ALA n 1 273 CYS n 1 274 LEU n 1 275 ASP n 1 276 ASP n 1 277 ARG n 1 278 ALA n 1 279 TRP n 1 280 ARG n 1 281 ARG n 1 282 PRO n 1 283 THR n 1 284 MET n 1 285 VAL n 1 286 GLN n 1 287 VAL n 1 288 MET n 1 289 ALA n 1 290 MET n 1 291 PHE n 1 292 LYS n 1 293 GLU n 1 294 ILE n 1 295 GLN n 1 296 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 296 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRI1, At4g39400, F23K16.30' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant RIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMH-HT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 865 ? ? ? A . n A 1 2 LYS 2 866 866 LYS LYS A . n A 1 3 PRO 3 867 867 PRO PRO A . n A 1 4 LEU 4 868 868 LEU LEU A . n A 1 5 ARG 5 869 869 ARG ARG A . n A 1 6 LYS 6 870 870 LYS LYS A . n A 1 7 LEU 7 871 871 LEU LEU A . n A 1 8 ALA 8 872 872 ALA ALA A . n A 1 9 PHE 9 873 873 PHE PHE A . n A 1 10 ALA 10 874 874 ALA ALA A . n A 1 11 ASP 11 875 875 ASP ASP A . n A 1 12 LEU 12 876 876 LEU LEU A . n A 1 13 LEU 13 877 877 LEU LEU A . n A 1 14 GLN 14 878 878 GLN GLN A . n A 1 15 ALA 15 879 879 ALA ALA A . n A 1 16 THR 16 880 880 THR THR A . n A 1 17 ASN 17 881 881 ASN ASN A . n A 1 18 GLY 18 882 882 GLY GLY A . n A 1 19 PHE 19 883 883 PHE PHE A . n A 1 20 HIS 20 884 884 HIS HIS A . n A 1 21 ASN 21 885 885 ASN ASN A . n A 1 22 ASP 22 886 886 ASP ASP A . n A 1 23 SER 23 887 887 SER SER A . n A 1 24 LEU 24 888 888 LEU LEU A . n A 1 25 ILE 25 889 889 ILE ILE A . n A 1 26 GLY 26 890 890 GLY GLY A . n A 1 27 SER 27 891 891 SER SER A . n A 1 28 GLY 28 892 892 GLY GLY A . n A 1 29 GLY 29 893 893 GLY GLY A . n A 1 30 PHE 30 894 894 PHE PHE A . n A 1 31 GLY 31 895 895 GLY GLY A . n A 1 32 ASP 32 896 896 ASP ASP A . n A 1 33 VAL 33 897 897 VAL VAL A . n A 1 34 TYR 34 898 898 TYR TYR A . n A 1 35 LYS 35 899 899 LYS LYS A . n A 1 36 ALA 36 900 900 ALA ALA A . n A 1 37 ILE 37 901 901 ILE ILE A . n A 1 38 LEU 38 902 902 LEU LEU A . n A 1 39 LYS 39 903 903 LYS LYS A . n A 1 40 ASP 40 904 904 ASP ASP A . n A 1 41 GLY 41 905 905 GLY GLY A . n A 1 42 SER 42 906 906 SER SER A . n A 1 43 ALA 43 907 907 ALA ALA A . n A 1 44 VAL 44 908 908 VAL VAL A . n A 1 45 ALA 45 909 909 ALA ALA A . n A 1 46 ILE 46 910 910 ILE ILE A . n A 1 47 LYS 47 911 911 LYS LYS A . n A 1 48 LYS 48 912 912 LYS LYS A . n A 1 49 LEU 49 913 913 LEU LEU A . n A 1 50 ILE 50 914 914 ILE ILE A . n A 1 51 HIS 51 915 915 HIS HIS A . n A 1 52 VAL 52 916 916 VAL VAL A . n A 1 53 SER 53 917 917 SER SER A . n A 1 54 GLY 54 918 918 GLY GLY A . n A 1 55 GLN 55 919 919 GLN GLN A . n A 1 56 GLY 56 920 920 GLY GLY A . n A 1 57 ASP 57 921 921 ASP ASP A . n A 1 58 ARG 58 922 922 ARG ARG A . n A 1 59 GLU 59 923 923 GLU GLU A . n A 1 60 PHE 60 924 924 PHE PHE A . n A 1 61 MET 61 925 925 MET MET A . n A 1 62 ALA 62 926 926 ALA ALA A . n A 1 63 GLU 63 927 927 GLU GLU A . n A 1 64 MET 64 928 928 MET MET A . n A 1 65 GLU 65 929 929 GLU GLU A . n A 1 66 THR 66 930 930 THR THR A . n A 1 67 ILE 67 931 931 ILE ILE A . n A 1 68 GLY 68 932 932 GLY GLY A . n A 1 69 LYS 69 933 933 LYS LYS A . n A 1 70 ILE 70 934 934 ILE ILE A . n A 1 71 LYS 71 935 935 LYS LYS A . n A 1 72 HIS 72 936 936 HIS HIS A . n A 1 73 ARG 73 937 937 ARG ARG A . n A 1 74 ASN 74 938 938 ASN ASN A . n A 1 75 LEU 75 939 939 LEU LEU A . n A 1 76 VAL 76 940 940 VAL VAL A . n A 1 77 PRO 77 941 941 PRO PRO A . n A 1 78 LEU 78 942 942 LEU LEU A . n A 1 79 LEU 79 943 943 LEU LEU A . n A 1 80 GLY 80 944 944 GLY GLY A . n A 1 81 TYR 81 945 945 TYR TYR A . n A 1 82 CYS 82 946 946 CYS CYS A . n A 1 83 LYS 83 947 947 LYS LYS A . n A 1 84 VAL 84 948 948 VAL VAL A . n A 1 85 GLY 85 949 949 GLY GLY A . n A 1 86 ASP 86 950 950 ASP ASP A . n A 1 87 GLU 87 951 951 GLU GLU A . n A 1 88 ARG 88 952 952 ARG ARG A . n A 1 89 LEU 89 953 953 LEU LEU A . n A 1 90 LEU 90 954 954 LEU LEU A . n A 1 91 VAL 91 955 955 VAL VAL A . n A 1 92 TYR 92 956 956 TYR TYR A . n A 1 93 GLU 93 957 957 GLU GLU A . n A 1 94 PHE 94 958 958 PHE PHE A . n A 1 95 MET 95 959 959 MET MET A . n A 1 96 LYS 96 960 960 LYS LYS A . n A 1 97 TYR 97 961 961 TYR TYR A . n A 1 98 GLY 98 962 962 GLY GLY A . n A 1 99 SER 99 963 963 SER SER A . n A 1 100 LEU 100 964 964 LEU LEU A . n A 1 101 GLU 101 965 965 GLU GLU A . n A 1 102 ASP 102 966 966 ASP ASP A . n A 1 103 VAL 103 967 967 VAL VAL A . n A 1 104 LEU 104 968 968 LEU LEU A . n A 1 105 HIS 105 969 969 HIS HIS A . n A 1 106 ASP 106 970 970 ASP ASP A . n A 1 107 PRO 107 971 971 PRO PRO A . n A 1 108 LYS 108 972 ? ? ? A . n A 1 109 LYS 109 973 ? ? ? A . n A 1 110 ALA 110 974 ? ? ? A . n A 1 111 GLY 111 975 975 GLY GLY A . n A 1 112 VAL 112 976 976 VAL VAL A . n A 1 113 LYS 113 977 977 LYS LYS A . n A 1 114 LEU 114 978 978 LEU LEU A . n A 1 115 ASN 115 979 979 ASN ASN A . n A 1 116 TRP 116 980 980 TRP TRP A . n A 1 117 SER 117 981 981 SER SER A . n A 1 118 THR 118 982 982 THR THR A . n A 1 119 ARG 119 983 983 ARG ARG A . n A 1 120 ARG 120 984 984 ARG ARG A . n A 1 121 LYS 121 985 985 LYS LYS A . n A 1 122 ILE 122 986 986 ILE ILE A . n A 1 123 ALA 123 987 987 ALA ALA A . n A 1 124 ILE 124 988 988 ILE ILE A . n A 1 125 GLY 125 989 989 GLY GLY A . n A 1 126 SER 126 990 990 SER SER A . n A 1 127 ALA 127 991 991 ALA ALA A . n A 1 128 ARG 128 992 992 ARG ARG A . n A 1 129 GLY 129 993 993 GLY GLY A . n A 1 130 LEU 130 994 994 LEU LEU A . n A 1 131 ALA 131 995 995 ALA ALA A . n A 1 132 PHE 132 996 996 PHE PHE A . n A 1 133 LEU 133 997 997 LEU LEU A . n A 1 134 HIS 134 998 998 HIS HIS A . n A 1 135 HIS 135 999 999 HIS HIS A . n A 1 136 ASN 136 1000 1000 ASN ASN A . n A 1 137 CYS 137 1001 1001 CYS CYS A . n A 1 138 SER 138 1002 1002 SER SER A . n A 1 139 PRO 139 1003 1003 PRO PRO A . n A 1 140 HIS 140 1004 1004 HIS HIS A . n A 1 141 ILE 141 1005 1005 ILE ILE A . n A 1 142 ILE 142 1006 1006 ILE ILE A . n A 1 143 HIS 143 1007 1007 HIS HIS A . n A 1 144 ARG 144 1008 1008 ARG ARG A . n A 1 145 ASP 145 1009 1009 ASP ASP A . n A 1 146 MET 146 1010 1010 MET MET A . n A 1 147 LYS 147 1011 1011 LYS LYS A . n A 1 148 SER 148 1012 1012 SER SER A . n A 1 149 SER 149 1013 1013 SER SER A . n A 1 150 ASN 150 1014 1014 ASN ASN A . n A 1 151 VAL 151 1015 1015 VAL VAL A . n A 1 152 LEU 152 1016 1016 LEU LEU A . n A 1 153 LEU 153 1017 1017 LEU LEU A . n A 1 154 ASP 154 1018 1018 ASP ASP A . n A 1 155 GLU 155 1019 1019 GLU GLU A . n A 1 156 ASN 156 1020 1020 ASN ASN A . n A 1 157 LEU 157 1021 1021 LEU LEU A . n A 1 158 GLU 158 1022 1022 GLU GLU A . n A 1 159 ALA 159 1023 1023 ALA ALA A . n A 1 160 ARG 160 1024 1024 ARG ARG A . n A 1 161 VAL 161 1025 1025 VAL VAL A . n A 1 162 SER 162 1026 1026 SER SER A . n A 1 163 ASP 163 1027 1027 ASP ASP A . n A 1 164 PHE 164 1028 1028 PHE PHE A . n A 1 165 GLY 165 1029 1029 GLY GLY A . n A 1 166 MET 166 1030 1030 MET MET A . n A 1 167 ALA 167 1031 1031 ALA ALA A . n A 1 168 ARG 168 1032 1032 ARG ARG A . n A 1 169 LEU 169 1033 1033 LEU LEU A . n A 1 170 MET 170 1034 1034 MET MET A . n A 1 171 SER 171 1035 1035 SER SER A . n A 1 172 ALA 172 1036 1036 ALA ALA A . n A 1 173 MET 173 1037 1037 MET MET A . n A 1 174 ASP 174 1038 1038 ASP ASP A . n A 1 175 TPO 175 1039 1039 TPO TPO A . n A 1 176 HIS 176 1040 1040 HIS HIS A . n A 1 177 LEU 177 1041 1041 LEU LEU A . n A 1 178 SEP 178 1042 1042 SEP SEP A . n A 1 179 VAL 179 1043 1043 VAL VAL A . n A 1 180 SEP 180 1044 1044 SEP SEP A . n A 1 181 THR 181 1045 1045 THR THR A . n A 1 182 LEU 182 1046 1046 LEU LEU A . n A 1 183 ALA 183 1047 1047 ALA ALA A . n A 1 184 GLY 184 1048 1048 GLY GLY A . n A 1 185 THR 185 1049 1049 THR THR A . n A 1 186 PRO 186 1050 1050 PRO PRO A . n A 1 187 GLY 187 1051 1051 GLY GLY A . n A 1 188 TYR 188 1052 1052 TYR TYR A . n A 1 189 VAL 189 1053 1053 VAL VAL A . n A 1 190 PRO 190 1054 1054 PRO PRO A . n A 1 191 PRO 191 1055 1055 PRO PRO A . n A 1 192 GLU 192 1056 1056 GLU GLU A . n A 1 193 TYR 193 1057 1057 TYR TYR A . n A 1 194 TYR 194 1058 1058 TYR TYR A . n A 1 195 GLN 195 1059 1059 GLN GLN A . n A 1 196 SEP 196 1060 1060 SEP SEP A . n A 1 197 PHE 197 1061 1061 PHE PHE A . n A 1 198 ARG 198 1062 1062 ARG ARG A . n A 1 199 CYS 199 1063 1063 CYS CYS A . n A 1 200 SER 200 1064 1064 SER SER A . n A 1 201 THR 201 1065 1065 THR THR A . n A 1 202 LYS 202 1066 1066 LYS LYS A . n A 1 203 GLY 203 1067 1067 GLY GLY A . n A 1 204 ASP 204 1068 1068 ASP ASP A . n A 1 205 VAL 205 1069 1069 VAL VAL A . n A 1 206 TYR 206 1070 1070 TYR TYR A . n A 1 207 SER 207 1071 1071 SER SER A . n A 1 208 TYR 208 1072 1072 TYR TYR A . n A 1 209 GLY 209 1073 1073 GLY GLY A . n A 1 210 VAL 210 1074 1074 VAL VAL A . n A 1 211 VAL 211 1075 1075 VAL VAL A . n A 1 212 LEU 212 1076 1076 LEU LEU A . n A 1 213 LEU 213 1077 1077 LEU LEU A . n A 1 214 GLU 214 1078 1078 GLU GLU A . n A 1 215 LEU 215 1079 1079 LEU LEU A . n A 1 216 LEU 216 1080 1080 LEU LEU A . n A 1 217 THR 217 1081 1081 THR THR A . n A 1 218 GLY 218 1082 1082 GLY GLY A . n A 1 219 LYS 219 1083 1083 LYS LYS A . n A 1 220 ARG 220 1084 1084 ARG ARG A . n A 1 221 PRO 221 1085 1085 PRO PRO A . n A 1 222 THR 222 1086 1086 THR THR A . n A 1 223 ASP 223 1087 ? ? ? A . n A 1 224 SER 224 1088 ? ? ? A . n A 1 225 PRO 225 1089 ? ? ? A . n A 1 226 ASP 226 1090 ? ? ? A . n A 1 227 PHE 227 1091 ? ? ? A . n A 1 228 GLY 228 1092 ? ? ? A . n A 1 229 ASP 229 1093 ? ? ? A . n A 1 230 ASN 230 1094 ? ? ? A . n A 1 231 ASN 231 1095 1095 ASN ASN A . n A 1 232 LEU 232 1096 1096 LEU LEU A . n A 1 233 VAL 233 1097 1097 VAL VAL A . n A 1 234 GLY 234 1098 1098 GLY GLY A . n A 1 235 TRP 235 1099 1099 TRP TRP A . n A 1 236 VAL 236 1100 1100 VAL VAL A . n A 1 237 LYS 237 1101 1101 LYS LYS A . n A 1 238 GLN 238 1102 1102 GLN GLN A . n A 1 239 HIS 239 1103 1103 HIS HIS A . n A 1 240 ALA 240 1104 1104 ALA ALA A . n A 1 241 LYS 241 1105 1105 LYS LYS A . n A 1 242 LEU 242 1106 1106 LEU LEU A . n A 1 243 ARG 243 1107 1107 ARG ARG A . n A 1 244 ILE 244 1108 1108 ILE ILE A . n A 1 245 SER 245 1109 1109 SER SER A . n A 1 246 ASP 246 1110 1110 ASP ASP A . n A 1 247 VAL 247 1111 1111 VAL VAL A . n A 1 248 PHE 248 1112 1112 PHE PHE A . n A 1 249 ASP 249 1113 1113 ASP ASP A . n A 1 250 PRO 250 1114 1114 PRO PRO A . n A 1 251 GLU 251 1115 1115 GLU GLU A . n A 1 252 LEU 252 1116 1116 LEU LEU A . n A 1 253 MET 253 1117 1117 MET MET A . n A 1 254 LYS 254 1118 1118 LYS LYS A . n A 1 255 GLU 255 1119 1119 GLU GLU A . n A 1 256 ASP 256 1120 1120 ASP ASP A . n A 1 257 PRO 257 1121 1121 PRO PRO A . n A 1 258 ALA 258 1122 1122 ALA ALA A . n A 1 259 LEU 259 1123 1123 LEU LEU A . n A 1 260 GLU 260 1124 1124 GLU GLU A . n A 1 261 ILE 261 1125 1125 ILE ILE A . n A 1 262 GLU 262 1126 1126 GLU GLU A . n A 1 263 LEU 263 1127 1127 LEU LEU A . n A 1 264 LEU 264 1128 1128 LEU LEU A . n A 1 265 GLN 265 1129 1129 GLN GLN A . n A 1 266 HIS 266 1130 1130 HIS HIS A . n A 1 267 LEU 267 1131 1131 LEU LEU A . n A 1 268 LYS 268 1132 1132 LYS LYS A . n A 1 269 VAL 269 1133 1133 VAL VAL A . n A 1 270 ALA 270 1134 1134 ALA ALA A . n A 1 271 VAL 271 1135 1135 VAL VAL A . n A 1 272 ALA 272 1136 1136 ALA ALA A . n A 1 273 CYS 273 1137 1137 CYS CYS A . n A 1 274 LEU 274 1138 1138 LEU LEU A . n A 1 275 ASP 275 1139 1139 ASP ASP A . n A 1 276 ASP 276 1140 1140 ASP ASP A . n A 1 277 ARG 277 1141 1141 ARG ARG A . n A 1 278 ALA 278 1142 1142 ALA ALA A . n A 1 279 TRP 279 1143 1143 TRP TRP A . n A 1 280 ARG 280 1144 1144 ARG ARG A . n A 1 281 ARG 281 1145 1145 ARG ARG A . n A 1 282 PRO 282 1146 1146 PRO PRO A . n A 1 283 THR 283 1147 1147 THR THR A . n A 1 284 MET 284 1148 1148 MET MET A . n A 1 285 VAL 285 1149 1149 VAL VAL A . n A 1 286 GLN 286 1150 1150 GLN GLN A . n A 1 287 VAL 287 1151 1151 VAL VAL A . n A 1 288 MET 288 1152 1152 MET MET A . n A 1 289 ALA 289 1153 1153 ALA ALA A . n A 1 290 MET 290 1154 1154 MET MET A . n A 1 291 PHE 291 1155 1155 PHE PHE A . n A 1 292 LYS 292 1156 1156 LYS LYS A . n A 1 293 GLU 293 1157 1157 GLU GLU A . n A 1 294 ILE 294 1158 1158 ILE ILE A . n A 1 295 GLN 295 1159 1159 GLN GLN A . n A 1 296 ALA 296 1160 1160 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1201 10 HOH HOH A . B 2 HOH 2 1202 9 HOH HOH A . B 2 HOH 3 1203 3 HOH HOH A . B 2 HOH 4 1204 7 HOH HOH A . B 2 HOH 5 1205 1 HOH HOH A . B 2 HOH 6 1206 4 HOH HOH A . B 2 HOH 7 1207 2 HOH HOH A . B 2 HOH 8 1208 5 HOH HOH A . B 2 HOH 9 1209 8 HOH HOH A . B 2 HOH 10 1210 6 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 866 ? CG ? A LYS 2 CG 2 1 Y 1 A LYS 866 ? CD ? A LYS 2 CD 3 1 Y 1 A LYS 866 ? CE ? A LYS 2 CE 4 1 Y 1 A LYS 866 ? NZ ? A LYS 2 NZ 5 1 Y 1 A PHE 894 ? CG ? A PHE 30 CG 6 1 Y 1 A PHE 894 ? CD1 ? A PHE 30 CD1 7 1 Y 1 A PHE 894 ? CD2 ? A PHE 30 CD2 8 1 Y 1 A PHE 894 ? CE1 ? A PHE 30 CE1 9 1 Y 1 A PHE 894 ? CE2 ? A PHE 30 CE2 10 1 Y 1 A PHE 894 ? CZ ? A PHE 30 CZ 11 1 Y 1 A HIS 915 ? CG ? A HIS 51 CG 12 1 Y 1 A HIS 915 ? ND1 ? A HIS 51 ND1 13 1 Y 1 A HIS 915 ? CD2 ? A HIS 51 CD2 14 1 Y 1 A HIS 915 ? CE1 ? A HIS 51 CE1 15 1 Y 1 A HIS 915 ? NE2 ? A HIS 51 NE2 16 1 Y 1 A GLN 919 ? CG ? A GLN 55 CG 17 1 Y 1 A GLN 919 ? CD ? A GLN 55 CD 18 1 Y 1 A GLN 919 ? OE1 ? A GLN 55 OE1 19 1 Y 1 A GLN 919 ? NE2 ? A GLN 55 NE2 20 1 Y 1 A LYS 947 ? CG ? A LYS 83 CG 21 1 Y 1 A LYS 947 ? CD ? A LYS 83 CD 22 1 Y 1 A LYS 947 ? CE ? A LYS 83 CE 23 1 Y 1 A LYS 947 ? NZ ? A LYS 83 NZ 24 1 Y 1 A ASP 950 ? CG ? A ASP 86 CG 25 1 Y 1 A ASP 950 ? OD1 ? A ASP 86 OD1 26 1 Y 1 A ASP 950 ? OD2 ? A ASP 86 OD2 27 1 Y 1 A LYS 977 ? CG ? A LYS 113 CG 28 1 Y 1 A LYS 977 ? CD ? A LYS 113 CD 29 1 Y 1 A LYS 977 ? CE ? A LYS 113 CE 30 1 Y 1 A LYS 977 ? NZ ? A LYS 113 NZ 31 1 Y 1 A ARG 1084 ? CG ? A ARG 220 CG 32 1 Y 1 A ARG 1084 ? CD ? A ARG 220 CD 33 1 Y 1 A ARG 1084 ? NE ? A ARG 220 NE 34 1 Y 1 A ARG 1084 ? CZ ? A ARG 220 CZ 35 1 Y 1 A ARG 1084 ? NH1 ? A ARG 220 NH1 36 1 Y 1 A ARG 1084 ? NH2 ? A ARG 220 NH2 37 1 Y 1 A LYS 1101 ? CG ? A LYS 237 CG 38 1 Y 1 A LYS 1101 ? CD ? A LYS 237 CD 39 1 Y 1 A LYS 1101 ? CE ? A LYS 237 CE 40 1 Y 1 A LYS 1101 ? NZ ? A LYS 237 NZ 41 1 Y 1 A GLN 1102 ? CG ? A GLN 238 CG 42 1 Y 1 A GLN 1102 ? CD ? A GLN 238 CD 43 1 Y 1 A GLN 1102 ? OE1 ? A GLN 238 OE1 44 1 Y 1 A GLN 1102 ? NE2 ? A GLN 238 NE2 45 1 Y 1 A HIS 1103 ? CG ? A HIS 239 CG 46 1 Y 1 A HIS 1103 ? ND1 ? A HIS 239 ND1 47 1 Y 1 A HIS 1103 ? CD2 ? A HIS 239 CD2 48 1 Y 1 A HIS 1103 ? CE1 ? A HIS 239 CE1 49 1 Y 1 A HIS 1103 ? NE2 ? A HIS 239 NE2 50 1 Y 1 A LYS 1105 ? CG ? A LYS 241 CG 51 1 Y 1 A LYS 1105 ? CD ? A LYS 241 CD 52 1 Y 1 A LYS 1105 ? CE ? A LYS 241 CE 53 1 Y 1 A LYS 1105 ? NZ ? A LYS 241 NZ 54 1 Y 1 A LEU 1106 ? CG ? A LEU 242 CG 55 1 Y 1 A LEU 1106 ? CD1 ? A LEU 242 CD1 56 1 Y 1 A LEU 1106 ? CD2 ? A LEU 242 CD2 57 1 Y 1 A ARG 1107 ? CG ? A ARG 243 CG 58 1 Y 1 A ARG 1107 ? CD ? A ARG 243 CD 59 1 Y 1 A ARG 1107 ? NE ? A ARG 243 NE 60 1 Y 1 A ARG 1107 ? CZ ? A ARG 243 CZ 61 1 Y 1 A ARG 1107 ? NH1 ? A ARG 243 NH1 62 1 Y 1 A ARG 1107 ? NH2 ? A ARG 243 NH2 63 1 Y 1 A ILE 1108 ? CG1 ? A ILE 244 CG1 64 1 Y 1 A ILE 1108 ? CG2 ? A ILE 244 CG2 65 1 Y 1 A ILE 1108 ? CD1 ? A ILE 244 CD1 66 1 Y 1 A SER 1109 ? OG ? A SER 245 OG 67 1 Y 1 A ASP 1110 ? CG ? A ASP 246 CG 68 1 Y 1 A ASP 1110 ? OD1 ? A ASP 246 OD1 69 1 Y 1 A ASP 1110 ? OD2 ? A ASP 246 OD2 70 1 Y 1 A VAL 1111 ? CG1 ? A VAL 247 CG1 71 1 Y 1 A VAL 1111 ? CG2 ? A VAL 247 CG2 72 1 Y 1 A GLU 1119 ? CG ? A GLU 255 CG 73 1 Y 1 A GLU 1119 ? CD ? A GLU 255 CD 74 1 Y 1 A GLU 1119 ? OE1 ? A GLU 255 OE1 75 1 Y 1 A GLU 1119 ? OE2 ? A GLU 255 OE2 76 1 Y 1 A LEU 1128 ? CG ? A LEU 264 CG 77 1 Y 1 A LEU 1128 ? CD1 ? A LEU 264 CD1 78 1 Y 1 A LEU 1128 ? CD2 ? A LEU 264 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5LPW _cell.details ? _cell.formula_units_Z ? _cell.length_a 116.137 _cell.length_a_esd ? _cell.length_b 116.137 _cell.length_b_esd ? _cell.length_c 50.295 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5LPW _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5LPW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '26% PEG 20K/MME 550 morpheus mix, 0.12 M eth glycol mix, 0.1 M Hepes pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-08-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000040 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000040 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 71.2 _reflns.entry_id 5LPW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.43 _reflns.d_resolution_low 19.36 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14560 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F -3.0 _reflns.observed_criterion_sigma_I -3.0 _reflns.percent_possible_obs 98.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.01 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.062 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.56 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.43 _reflns_shell.d_res_low 2.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.99 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 91.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.55 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.783 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5LPW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.431 _refine.ls_d_res_low 19.356 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14555 _refine.ls_number_reflns_R_free 736 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.62 _refine.ls_percent_reflns_R_free 5.06 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2057 _refine.ls_R_factor_R_free 0.2479 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2035 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3UIM _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.30 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.36 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2168 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2178 _refine_hist.d_res_high 2.431 _refine_hist.d_res_low 19.356 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2215 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.661 ? 3003 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.626 ? 806 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.023 ? 339 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 380 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4308 2.6181 . . 154 2563 93.00 . . . 0.3620 . 0.2984 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6181 2.8808 . . 153 2772 100.00 . . . 0.3135 . 0.2629 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8808 3.2959 . . 131 2799 100.00 . . . 0.2997 . 0.2387 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2959 4.1458 . . 148 2822 100.00 . . . 0.2401 . 0.2118 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1458 19.3568 . . 150 2863 100.00 . . . 0.2169 . 0.1710 . . . . . . . . . . # _struct.entry_id 5LPW _struct.title 'Crystal structure of the apo-BRI1 kinase domain (865-1160)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5LPW _struct_keywords.text 'brassinosteroid receptor, kinase domain, dual-specificify kinase, membrane receptor kinase, plasma membrane, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRI1_ARATH _struct_ref.pdbx_db_accession O22476 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EKPLRKLTFADLLQATNGFHNDSLIGSGGFGDVYKAILKDGSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLG YCKVGDERLLVYEFMKYGSLEDVLHDPKKAGVKLNWSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEAR VSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSPDFGDNNLVGWVKQHA KLRISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQA ; _struct_ref.pdbx_align_begin 865 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5LPW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 296 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O22476 _struct_ref_seq.db_align_beg 865 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1160 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 865 _struct_ref_seq.pdbx_auth_seq_align_end 1160 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5LPW _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 8 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O22476 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 872 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 872 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 8 ? THR A 16 ? ALA A 872 THR A 880 1 ? 9 HELX_P HELX_P2 AA2 HIS A 20 ? LEU A 24 ? HIS A 884 LEU A 888 5 ? 5 HELX_P HELX_P3 AA3 GLY A 54 ? THR A 66 ? GLY A 918 THR A 930 1 ? 13 HELX_P HELX_P4 AA4 ILE A 67 ? ILE A 70 ? ILE A 931 ILE A 934 5 ? 4 HELX_P HELX_P5 AA5 SER A 99 ? HIS A 105 ? SER A 963 HIS A 969 1 ? 7 HELX_P HELX_P6 AA6 ASN A 115 ? ASN A 136 ? ASN A 979 ASN A 1000 1 ? 22 HELX_P HELX_P7 AA7 LYS A 147 ? SER A 149 ? LYS A 1011 SER A 1013 5 ? 3 HELX_P HELX_P8 AA8 PRO A 190 ? GLN A 195 ? PRO A 1054 GLN A 1059 5 ? 6 HELX_P HELX_P9 AA9 SER A 200 ? GLY A 218 ? SER A 1064 GLY A 1082 1 ? 19 HELX_P HELX_P10 AB1 LEU A 232 ? ALA A 240 ? LEU A 1096 ALA A 1104 1 ? 9 HELX_P HELX_P11 AB2 ASP A 249 ? ASP A 256 ? ASP A 1113 ASP A 1120 1 ? 8 HELX_P HELX_P12 AB3 LEU A 259 ? LEU A 274 ? LEU A 1123 LEU A 1138 1 ? 16 HELX_P HELX_P13 AB4 THR A 283 ? ALA A 296 ? THR A 1147 ALA A 1160 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 174 C ? ? ? 1_555 A TPO 175 N ? ? A ASP 1038 A TPO 1039 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A TPO 175 C ? ? ? 1_555 A HIS 176 N ? ? A TPO 1039 A HIS 1040 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale both ? A LEU 177 C ? ? ? 1_555 A SEP 178 N ? ? A LEU 1041 A SEP 1042 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A SEP 178 C ? ? ? 1_555 A VAL 179 N ? ? A SEP 1042 A VAL 1043 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? A VAL 179 C ? ? ? 1_555 A SEP 180 N ? ? A VAL 1043 A SEP 1044 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A SEP 180 C ? ? ? 1_555 A THR 181 N ? ? A SEP 1044 A THR 1045 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? A GLN 195 C ? ? ? 1_555 A SEP 196 N ? ? A GLN 1059 A SEP 1060 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A SEP 196 C ? ? ? 1_555 A PHE 197 N ? ? A SEP 1060 A PHE 1061 1_555 ? ? ? ? ? ? ? 1.331 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 TPO A 175 ? . . . . TPO A 1039 ? 1_555 . . . . . . . THR 1 TPO Phosphorylation 'Named protein modification' 2 SEP A 178 ? . . . . SEP A 1042 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 3 SEP A 180 ? . . . . SEP A 1044 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 4 SEP A 196 ? . . . . SEP A 1060 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 138 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 1002 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 139 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1003 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.17 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 5 ? LYS A 6 ? ARG A 869 LYS A 870 AA1 2 LEU A 78 ? VAL A 84 ? LEU A 942 VAL A 948 AA1 3 GLU A 87 ? GLU A 93 ? GLU A 951 GLU A 957 AA1 4 ALA A 43 ? LEU A 49 ? ALA A 907 LEU A 913 AA1 5 GLY A 31 ? ILE A 37 ? GLY A 895 ILE A 901 AA2 1 HIS A 140 ? ILE A 142 ? HIS A 1004 ILE A 1006 AA2 2 ARG A 168 ? MET A 170 ? ARG A 1032 MET A 1034 AA3 1 VAL A 151 ? LEU A 153 ? VAL A 1015 LEU A 1017 AA3 2 ALA A 159 ? VAL A 161 ? ALA A 1023 VAL A 1025 AA4 1 LEU A 177 ? SEP A 178 ? LEU A 1041 SEP A 1042 AA4 2 ARG A 198 ? CYS A 199 ? ARG A 1062 CYS A 1063 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 5 ? N ARG A 869 O LEU A 79 ? O LEU A 943 AA1 2 3 N CYS A 82 ? N CYS A 946 O LEU A 89 ? O LEU A 953 AA1 3 4 O ARG A 88 ? O ARG A 952 N LEU A 49 ? N LEU A 913 AA1 4 5 O LYS A 48 ? O LYS A 912 N ASP A 32 ? N ASP A 896 AA2 1 2 N HIS A 140 ? N HIS A 1004 O MET A 170 ? O MET A 1034 AA3 1 2 N LEU A 152 ? N LEU A 1016 O ARG A 160 ? O ARG A 1024 AA4 1 2 N LEU A 177 ? N LEU A 1041 O CYS A 199 ? O CYS A 1063 # _pdbx_entry_details.entry_id 5LPW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 1208 ? ? O A HOH 1210 ? ? 2.12 2 1 O A HOH 1202 ? ? O A HOH 1205 ? ? 2.12 3 1 OD2 A ASP 904 ? ? OG A SER 906 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 915 ? ? 60.21 63.63 2 1 THR A 930 ? ? -117.68 -88.96 3 1 HIS A 969 ? ? -112.23 77.83 4 1 ASP A 1009 ? ? -154.17 40.13 5 1 ASP A 1018 ? ? -76.63 -164.75 6 1 ASP A 1027 ? ? 60.56 79.85 7 1 LEU A 1106 ? ? -100.72 -118.48 8 1 ASP A 1110 ? ? -157.49 -12.09 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A TPO 175 A TPO 1039 ? THR 'modified residue' 2 A SEP 178 A SEP 1042 ? SER 'modified residue' 3 A SEP 180 A SEP 1044 ? SER 'modified residue' 4 A SEP 196 A SEP 1060 ? SER 'modified residue' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 30.6930 35.3646 18.1791 0.5482 0.6499 0.6367 0.0921 0.0501 -0.0331 7.3422 8.0754 5.3715 -4.1537 -3.5648 4.6157 0.2806 -0.4451 0.9936 -0.4804 0.3464 -0.1636 -0.5610 0.4053 -0.3988 'X-RAY DIFFRACTION' 2 ? refined 42.8141 20.3291 15.5217 0.5858 0.4024 0.4376 0.1105 -0.0296 -0.0659 8.4509 6.9928 4.0066 -0.0516 -0.8425 0.6476 -0.2149 -0.1978 -0.4993 0.3216 0.3487 -0.2598 -0.1550 0.1341 -0.1502 'X-RAY DIFFRACTION' 3 ? refined 53.1144 10.2192 30.3180 1.4016 1.5142 1.4554 0.3000 -0.3070 0.6285 0.1425 5.3940 1.6432 0.8727 0.0246 0.5336 -0.1232 -2.8678 -2.0446 1.2942 -0.1702 -1.8412 0.4380 1.3473 0.8508 'X-RAY DIFFRACTION' 4 ? refined 42.0663 2.5668 36.5397 1.4821 1.7236 1.6009 0.0842 -0.2057 0.9421 3.5651 3.5291 5.1830 0.4001 0.2807 0.4493 -0.2556 -2.1094 -2.0516 0.2448 0.0677 0.4834 1.5165 1.1161 0.2513 'X-RAY DIFFRACTION' 5 ? refined 45.5910 6.2644 16.7338 0.7952 0.6347 1.2440 0.1761 0.0403 0.1871 3.4505 4.4340 3.7848 0.8189 3.4627 1.0552 -0.3692 -1.0583 -2.2363 0.5688 0.2857 -0.5213 0.1845 -0.0365 0.0841 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resseq 866:969)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resseq 970:1086)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain A and resseq 1095:1116)' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain A and resseq 1117:1124)' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? '(chain A and resseq 1125:1160)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 865 ? A GLU 1 2 1 Y 1 A LYS 972 ? A LYS 108 3 1 Y 1 A LYS 973 ? A LYS 109 4 1 Y 1 A ALA 974 ? A ALA 110 5 1 Y 1 A ASP 1087 ? A ASP 223 6 1 Y 1 A SER 1088 ? A SER 224 7 1 Y 1 A PRO 1089 ? A PRO 225 8 1 Y 1 A ASP 1090 ? A ASP 226 9 1 Y 1 A PHE 1091 ? A PHE 227 10 1 Y 1 A GLY 1092 ? A GLY 228 11 1 Y 1 A ASP 1093 ? A ASP 229 12 1 Y 1 A ASN 1094 ? A ASN 230 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SEP N N N N 290 SEP CA C N S 291 SEP CB C N N 292 SEP OG O N N 293 SEP C C N N 294 SEP O O N N 295 SEP OXT O N N 296 SEP P P N N 297 SEP O1P O N N 298 SEP O2P O N N 299 SEP O3P O N N 300 SEP H H N N 301 SEP H2 H N N 302 SEP HA H N N 303 SEP HB2 H N N 304 SEP HB3 H N N 305 SEP HXT H N N 306 SEP HOP2 H N N 307 SEP HOP3 H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TPO N N N N 340 TPO CA C N S 341 TPO CB C N R 342 TPO CG2 C N N 343 TPO OG1 O N N 344 TPO P P N N 345 TPO O1P O N N 346 TPO O2P O N N 347 TPO O3P O N N 348 TPO C C N N 349 TPO O O N N 350 TPO OXT O N N 351 TPO H H N N 352 TPO H2 H N N 353 TPO HA H N N 354 TPO HB H N N 355 TPO HG21 H N N 356 TPO HG22 H N N 357 TPO HG23 H N N 358 TPO HOP2 H N N 359 TPO HOP3 H N N 360 TPO HXT H N N 361 TRP N N N N 362 TRP CA C N S 363 TRP C C N N 364 TRP O O N N 365 TRP CB C N N 366 TRP CG C Y N 367 TRP CD1 C Y N 368 TRP CD2 C Y N 369 TRP NE1 N Y N 370 TRP CE2 C Y N 371 TRP CE3 C Y N 372 TRP CZ2 C Y N 373 TRP CZ3 C Y N 374 TRP CH2 C Y N 375 TRP OXT O N N 376 TRP H H N N 377 TRP H2 H N N 378 TRP HA H N N 379 TRP HB2 H N N 380 TRP HB3 H N N 381 TRP HD1 H N N 382 TRP HE1 H N N 383 TRP HE3 H N N 384 TRP HZ2 H N N 385 TRP HZ3 H N N 386 TRP HH2 H N N 387 TRP HXT H N N 388 TYR N N N N 389 TYR CA C N S 390 TYR C C N N 391 TYR O O N N 392 TYR CB C N N 393 TYR CG C Y N 394 TYR CD1 C Y N 395 TYR CD2 C Y N 396 TYR CE1 C Y N 397 TYR CE2 C Y N 398 TYR CZ C Y N 399 TYR OH O N N 400 TYR OXT O N N 401 TYR H H N N 402 TYR H2 H N N 403 TYR HA H N N 404 TYR HB2 H N N 405 TYR HB3 H N N 406 TYR HD1 H N N 407 TYR HD2 H N N 408 TYR HE1 H N N 409 TYR HE2 H N N 410 TYR HH H N N 411 TYR HXT H N N 412 VAL N N N N 413 VAL CA C N S 414 VAL C C N N 415 VAL O O N N 416 VAL CB C N N 417 VAL CG1 C N N 418 VAL CG2 C N N 419 VAL OXT O N N 420 VAL H H N N 421 VAL H2 H N N 422 VAL HA H N N 423 VAL HB H N N 424 VAL HG11 H N N 425 VAL HG12 H N N 426 VAL HG13 H N N 427 VAL HG21 H N N 428 VAL HG22 H N N 429 VAL HG23 H N N 430 VAL HXT H N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SEP N CA sing N N 277 SEP N H sing N N 278 SEP N H2 sing N N 279 SEP CA CB sing N N 280 SEP CA C sing N N 281 SEP CA HA sing N N 282 SEP CB OG sing N N 283 SEP CB HB2 sing N N 284 SEP CB HB3 sing N N 285 SEP OG P sing N N 286 SEP C O doub N N 287 SEP C OXT sing N N 288 SEP OXT HXT sing N N 289 SEP P O1P doub N N 290 SEP P O2P sing N N 291 SEP P O3P sing N N 292 SEP O2P HOP2 sing N N 293 SEP O3P HOP3 sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TPO N CA sing N N 324 TPO N H sing N N 325 TPO N H2 sing N N 326 TPO CA CB sing N N 327 TPO CA C sing N N 328 TPO CA HA sing N N 329 TPO CB CG2 sing N N 330 TPO CB OG1 sing N N 331 TPO CB HB sing N N 332 TPO CG2 HG21 sing N N 333 TPO CG2 HG22 sing N N 334 TPO CG2 HG23 sing N N 335 TPO OG1 P sing N N 336 TPO P O1P doub N N 337 TPO P O2P sing N N 338 TPO P O3P sing N N 339 TPO O2P HOP2 sing N N 340 TPO O3P HOP3 sing N N 341 TPO C O doub N N 342 TPO C OXT sing N N 343 TPO OXT HXT sing N N 344 TRP N CA sing N N 345 TRP N H sing N N 346 TRP N H2 sing N N 347 TRP CA C sing N N 348 TRP CA CB sing N N 349 TRP CA HA sing N N 350 TRP C O doub N N 351 TRP C OXT sing N N 352 TRP CB CG sing N N 353 TRP CB HB2 sing N N 354 TRP CB HB3 sing N N 355 TRP CG CD1 doub Y N 356 TRP CG CD2 sing Y N 357 TRP CD1 NE1 sing Y N 358 TRP CD1 HD1 sing N N 359 TRP CD2 CE2 doub Y N 360 TRP CD2 CE3 sing Y N 361 TRP NE1 CE2 sing Y N 362 TRP NE1 HE1 sing N N 363 TRP CE2 CZ2 sing Y N 364 TRP CE3 CZ3 doub Y N 365 TRP CE3 HE3 sing N N 366 TRP CZ2 CH2 doub Y N 367 TRP CZ2 HZ2 sing N N 368 TRP CZ3 CH2 sing Y N 369 TRP CZ3 HZ3 sing N N 370 TRP CH2 HH2 sing N N 371 TRP OXT HXT sing N N 372 TYR N CA sing N N 373 TYR N H sing N N 374 TYR N H2 sing N N 375 TYR CA C sing N N 376 TYR CA CB sing N N 377 TYR CA HA sing N N 378 TYR C O doub N N 379 TYR C OXT sing N N 380 TYR CB CG sing N N 381 TYR CB HB2 sing N N 382 TYR CB HB3 sing N N 383 TYR CG CD1 doub Y N 384 TYR CG CD2 sing Y N 385 TYR CD1 CE1 sing Y N 386 TYR CD1 HD1 sing N N 387 TYR CD2 CE2 doub Y N 388 TYR CD2 HD2 sing N N 389 TYR CE1 CZ doub Y N 390 TYR CE1 HE1 sing N N 391 TYR CE2 CZ sing Y N 392 TYR CE2 HE2 sing N N 393 TYR CZ OH sing N N 394 TYR OH HH sing N N 395 TYR OXT HXT sing N N 396 VAL N CA sing N N 397 VAL N H sing N N 398 VAL N H2 sing N N 399 VAL CA C sing N N 400 VAL CA CB sing N N 401 VAL CA HA sing N N 402 VAL C O doub N N 403 VAL C OXT sing N N 404 VAL CB CG1 sing N N 405 VAL CB CG2 sing N N 406 VAL CB HB sing N N 407 VAL CG1 HG11 sing N N 408 VAL CG1 HG12 sing N N 409 VAL CG1 HG13 sing N N 410 VAL CG2 HG21 sing N N 411 VAL CG2 HG22 sing N N 412 VAL CG2 HG23 sing N N 413 VAL OXT HXT sing N N 414 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3UIM _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5LPW _atom_sites.fract_transf_matrix[1][1] 0.008611 _atom_sites.fract_transf_matrix[1][2] 0.004971 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009943 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019883 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_