data_5LXL # _entry.id 5LXL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5LXL pdb_00005lxl 10.2210/pdb5lxl/pdb WWPDB D_1200001431 ? ? BMRB 34047 ? 10.13018/BMR34047 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-19 2 'Structure model' 1 1 2018-01-31 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_nmr_spectrometer 2 3 'Structure model' pdbx_nmr_software 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_nmr_spectrometer.model' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'SER A 33 HAS WRONG CHIRALITY AT ATOM CA' 2 'VAL A 57 HAS WRONG CHIRALITY AT ATOM CA' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5LXL _pdbx_database_status.recvd_initial_deposition_date 2016-09-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of the N-terminal domain of the Bacteriophage T5 decoration protein pb10' _pdbx_database_related.db_id 34047 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Vernhes, E.' 1 ? 'Gilquin, B.' 2 ? 'Cuniasse, P.' 3 ? 'Boulanger, P.' 4 ? 'Zinn-Justin, S.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 41662 _citation.page_last 41662 _citation.title 'High affinity anchoring of the decoration protein pb10 onto the bacteriophage T5 capsid.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep41662 _citation.pdbx_database_id_PubMed 28165000 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vernhes, E.' 1 ? primary 'Renouard, M.' 2 ? primary 'Gilquin, B.' 3 ? primary 'Cuniasse, P.' 4 ? primary 'Durand, D.' 5 ? primary 'England, P.' 6 ? primary 'Hoos, S.' 7 ? primary 'Huet, A.' 8 ? primary 'Conway, J.F.' 9 ? primary 'Glukhov, A.' 10 ? primary 'Ksenzenko, V.' 11 ? primary 'Jacquet, E.' 12 ? primary 'Nhiri, N.' 13 ? primary 'Zinn-Justin, S.' 14 ? primary 'Boulanger, P.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Decoration protein' _entity.formula_weight 9758.273 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain, UNP residues 2-77' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Capsid protein pb10' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGIDYSGLRTIFGEKLPESHIFFATVAAHKYVPSYAFLRRELGLSSAHTNRKVWKKFVEAYGKAIPPAPPAPPLTLSKLE HHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGIDYSGLRTIFGEKLPESHIFFATVAAHKYVPSYAFLRRELGLSSAHTNRKVWKKFVEAYGKAIPPAPPAPPLTLSKLE HHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ILE n 1 4 ASP n 1 5 TYR n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 ARG n 1 10 THR n 1 11 ILE n 1 12 PHE n 1 13 GLY n 1 14 GLU n 1 15 LYS n 1 16 LEU n 1 17 PRO n 1 18 GLU n 1 19 SER n 1 20 HIS n 1 21 ILE n 1 22 PHE n 1 23 PHE n 1 24 ALA n 1 25 THR n 1 26 VAL n 1 27 ALA n 1 28 ALA n 1 29 HIS n 1 30 LYS n 1 31 TYR n 1 32 VAL n 1 33 PRO n 1 34 SER n 1 35 TYR n 1 36 ALA n 1 37 PHE n 1 38 LEU n 1 39 ARG n 1 40 ARG n 1 41 GLU n 1 42 LEU n 1 43 GLY n 1 44 LEU n 1 45 SER n 1 46 SER n 1 47 ALA n 1 48 HIS n 1 49 THR n 1 50 ASN n 1 51 ARG n 1 52 LYS n 1 53 VAL n 1 54 TRP n 1 55 LYS n 1 56 LYS n 1 57 PHE n 1 58 VAL n 1 59 GLU n 1 60 ALA n 1 61 TYR n 1 62 GLY n 1 63 LYS n 1 64 ALA n 1 65 ILE n 1 66 PRO n 1 67 PRO n 1 68 ALA n 1 69 PRO n 1 70 PRO n 1 71 ALA n 1 72 PRO n 1 73 PRO n 1 74 LEU n 1 75 THR n 1 76 LEU n 1 77 SER n 1 78 LYS n 1 79 LEU n 1 80 GLU n 1 81 HIS n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 86 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'N5, T5.151, T5p147' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia phage T5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10726 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 GLY 2 1 1 GLY GLY A . n A 1 3 ILE 3 2 2 ILE ILE A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 SER 6 5 5 SER SER A . n A 1 7 GLY 7 6 6 GLY GLY A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 ARG 9 8 8 ARG ARG A . n A 1 10 THR 10 9 9 THR THR A . n A 1 11 ILE 11 10 10 ILE ILE A . n A 1 12 PHE 12 11 11 PHE PHE A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 LYS 15 14 14 LYS LYS A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 PRO 17 16 16 PRO PRO A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 HIS 20 19 19 HIS HIS A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 PHE 22 21 21 PHE PHE A . n A 1 23 PHE 23 22 22 PHE PHE A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 THR 25 24 24 THR THR A . n A 1 26 VAL 26 25 25 VAL VAL A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 ALA 28 27 27 ALA ALA A . n A 1 29 HIS 29 28 28 HIS HIS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 TYR 31 30 30 TYR TYR A . n A 1 32 VAL 32 31 31 VAL VAL A . n A 1 33 PRO 33 32 32 PRO PRO A . n A 1 34 SER 34 33 33 SER SER A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 ALA 36 35 35 ALA ALA A . n A 1 37 PHE 37 36 36 PHE PHE A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 ARG 39 38 38 ARG ARG A . n A 1 40 ARG 40 39 39 ARG ARG A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 SER 45 44 44 SER SER A . n A 1 46 SER 46 45 45 SER SER A . n A 1 47 ALA 47 46 46 ALA ALA A . n A 1 48 HIS 48 47 47 HIS HIS A . n A 1 49 THR 49 48 48 THR THR A . n A 1 50 ASN 50 49 49 ASN ASN A . n A 1 51 ARG 51 50 50 ARG ARG A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 TRP 54 53 53 TRP TRP A . n A 1 55 LYS 55 54 54 LYS LYS A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 PHE 57 56 56 PHE PHE A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 TYR 61 60 60 TYR TYR A . n A 1 62 GLY 62 61 61 GLY GLY A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 ALA 64 63 63 ALA ALA A . n A 1 65 ILE 65 64 64 ILE ILE A . n A 1 66 PRO 66 65 65 PRO PRO A . n A 1 67 PRO 67 66 66 PRO PRO A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 PRO 69 68 68 PRO PRO A . n A 1 70 PRO 70 69 69 PRO PRO A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 PRO 72 71 71 PRO PRO A . n A 1 73 PRO 73 72 72 PRO PRO A . n A 1 74 LEU 74 73 73 LEU LEU A . n A 1 75 THR 75 74 74 THR THR A . n A 1 76 LEU 76 75 75 LEU LEU A . n A 1 77 SER 77 76 76 SER SER A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 LEU 79 78 78 LEU LEU A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 HIS 81 80 80 HIS HIS A . n A 1 82 HIS 82 81 ? ? ? A . n A 1 83 HIS 83 82 ? ? ? A . n A 1 84 HIS 84 83 ? ? ? A . n A 1 85 HIS 85 84 ? ? ? A . n A 1 86 HIS 86 85 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5LXL _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5LXL _struct.title 'NMR structure of the N-terminal domain of the Bacteriophage T5 decoration protein pb10' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5LXL _struct_keywords.text 'Bacteriophage T5 Decoration Protein, Viral protein' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DECO_BPT5 _struct_ref.pdbx_db_accession Q6QGD6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code IDYSGLRTIFGEKLPESHIFFATVAAHKYVPSYAFLRRELGLSSAHTNRKVWKKFVEAYGKAIPPAPPAPPLTLSK _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5LXL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6QGD6 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5LXL MET A 1 ? UNP Q6QGD6 ? ? 'initiating methionine' 0 1 1 5LXL GLY A 2 ? UNP Q6QGD6 ? ? 'expression tag' 1 2 1 5LXL LEU A 79 ? UNP Q6QGD6 ? ? 'expression tag' 78 3 1 5LXL GLU A 80 ? UNP Q6QGD6 ? ? 'expression tag' 79 4 1 5LXL HIS A 81 ? UNP Q6QGD6 ? ? 'expression tag' 80 5 1 5LXL HIS A 82 ? UNP Q6QGD6 ? ? 'expression tag' 81 6 1 5LXL HIS A 83 ? UNP Q6QGD6 ? ? 'expression tag' 82 7 1 5LXL HIS A 84 ? UNP Q6QGD6 ? ? 'expression tag' 83 8 1 5LXL HIS A 85 ? UNP Q6QGD6 ? ? 'expression tag' 84 9 1 5LXL HIS A 86 ? UNP Q6QGD6 ? ? 'expression tag' 85 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5220 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 5 ? PHE A 12 ? TYR A 4 PHE A 11 1 ? 8 HELX_P HELX_P2 AA2 GLU A 18 ? THR A 25 ? GLU A 17 THR A 24 1 ? 8 HELX_P HELX_P3 AA3 THR A 25 ? LYS A 30 ? THR A 24 LYS A 29 1 ? 6 HELX_P HELX_P4 AA4 SER A 34 ? LEU A 42 ? SER A 33 LEU A 41 1 ? 9 HELX_P HELX_P5 AA5 SER A 45 ? HIS A 48 ? SER A 44 HIS A 47 5 ? 4 HELX_P HELX_P6 AA6 THR A 49 ? TYR A 61 ? THR A 48 TYR A 60 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.56 2 3 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.56 3 3 O A TRP 53 ? ? H A VAL 57 ? ? 1.59 4 4 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.54 5 4 O A LYS 14 ? ? HH A TYR 60 ? ? 1.59 6 5 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.57 7 6 HG1 A THR 9 ? ? O A ALA 70 ? ? 1.58 8 6 O A TRP 53 ? ? H A VAL 57 ? ? 1.60 9 7 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.55 10 7 O A TRP 53 ? ? H A VAL 57 ? ? 1.58 11 8 O A TRP 53 ? ? H A VAL 57 ? ? 1.57 12 9 HG1 A THR 9 ? ? O A ALA 70 ? ? 1.58 13 9 O A TRP 53 ? ? H A VAL 57 ? ? 1.59 14 10 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.53 15 12 O A TRP 53 ? ? H A VAL 57 ? ? 1.60 16 13 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.58 17 14 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.56 18 15 HG1 A THR 9 ? ? O A ALA 70 ? ? 1.56 19 15 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.56 20 16 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.55 21 17 HZ1 A LYS 62 ? ? H A ALA 63 ? ? 1.30 22 17 O A TRP 53 ? ? H A VAL 57 ? ? 1.58 23 18 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.55 24 19 O A TRP 53 ? ? H A VAL 57 ? ? 1.59 25 20 HH A TYR 34 ? ? OD1 A ASN 49 ? ? 1.53 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 4 ? ? CG A TYR 4 ? ? CD2 A TYR 4 ? ? 115.63 121.00 -5.37 0.60 N 2 1 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.23 110.90 9.33 1.50 N 3 1 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 126.30 110.50 15.80 1.50 N 4 1 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.65 110.10 -13.45 1.50 N 5 2 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.48 110.90 9.58 1.50 N 6 2 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 123.10 110.50 12.60 1.50 N 7 2 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 98.18 110.10 -11.92 1.50 N 8 3 CB A TYR 4 ? ? CG A TYR 4 ? ? CD2 A TYR 4 ? ? 115.50 121.00 -5.50 0.60 N 9 3 CB A LEU 7 ? ? CG A LEU 7 ? ? CD1 A LEU 7 ? ? 122.54 111.00 11.54 1.70 N 10 3 CB A PHE 22 ? ? CG A PHE 22 ? ? CD2 A PHE 22 ? ? 126.31 120.80 5.51 0.70 N 11 3 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 112.89 121.00 -8.11 0.60 N 12 3 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 129.59 121.00 8.59 0.60 N 13 3 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.68 110.90 9.78 1.50 N 14 3 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 122.13 110.50 11.63 1.50 N 15 3 CB A TYR 34 ? ? CG A TYR 34 ? ? CD1 A TYR 34 ? ? 117.37 121.00 -3.63 0.60 N 16 3 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 122.91 111.40 11.51 1.90 N 17 3 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.18 110.10 -13.92 1.50 N 18 4 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 125.71 110.50 15.21 1.50 N 19 4 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.14 111.40 11.74 1.90 N 20 4 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.99 110.10 -13.11 1.50 N 21 5 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 121.10 110.90 10.20 1.50 N 22 5 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 123.96 110.50 13.46 1.50 N 23 5 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 129.60 111.40 18.20 1.90 N 24 5 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 95.50 110.10 -14.60 1.50 N 25 6 CB A PHE 21 ? ? CA A PHE 21 ? ? C A PHE 21 ? ? 124.35 110.40 13.95 2.00 N 26 6 CB A PHE 22 ? ? CG A PHE 22 ? ? CD2 A PHE 22 ? ? 127.31 120.80 6.51 0.70 N 27 6 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 117.03 121.00 -3.97 0.60 N 28 6 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 124.83 121.00 3.83 0.60 N 29 6 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 121.55 110.50 11.05 1.50 N 30 6 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.15 111.40 11.75 1.90 N 31 6 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 97.16 110.10 -12.94 1.50 N 32 7 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 117.26 121.00 -3.74 0.60 N 33 7 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 124.32 110.50 13.82 1.50 N 34 7 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.34 111.40 11.94 1.90 N 35 7 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.33 110.10 -13.77 1.50 N 36 7 C A LEU 78 ? ? N A GLU 79 ? ? CA A GLU 79 ? ? 137.39 121.70 15.69 2.50 Y 37 8 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.91 110.90 10.01 1.50 N 38 8 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 124.20 110.50 13.70 1.50 N 39 8 CB A LEU 37 ? ? CG A LEU 37 ? ? CD2 A LEU 37 ? ? 123.20 111.00 12.20 1.70 N 40 8 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.08 111.40 11.68 1.90 N 41 8 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.85 110.10 -13.25 1.50 N 42 9 CB A LEU 7 ? ? CG A LEU 7 ? ? CD1 A LEU 7 ? ? 123.84 111.00 12.84 1.70 N 43 9 CB A PHE 22 ? ? CG A PHE 22 ? ? CD2 A PHE 22 ? ? 125.58 120.80 4.78 0.70 N 44 9 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 112.18 121.00 -8.82 0.60 N 45 9 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 129.44 121.00 8.44 0.60 N 46 9 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 123.41 110.50 12.91 1.50 N 47 9 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.11 111.40 11.71 1.90 N 48 9 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.27 110.10 -13.83 1.50 N 49 10 CB A LEU 7 ? ? CG A LEU 7 ? ? CD2 A LEU 7 ? ? 123.17 111.00 12.17 1.70 N 50 10 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 125.95 121.00 4.95 0.60 N 51 10 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 116.15 121.00 -4.85 0.60 N 52 10 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 123.76 110.50 13.26 1.50 N 53 10 CB A LEU 37 ? ? CG A LEU 37 ? ? CD2 A LEU 37 ? ? 123.43 111.00 12.43 1.70 N 54 10 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.36 111.40 11.96 1.90 N 55 10 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.83 110.10 -13.27 1.50 N 56 11 CB A TYR 4 ? ? CG A TYR 4 ? ? CD2 A TYR 4 ? ? 116.31 121.00 -4.69 0.60 N 57 11 CB A LEU 7 ? ? CG A LEU 7 ? ? CD1 A LEU 7 ? ? 122.61 111.00 11.61 1.70 N 58 11 CB A PHE 22 ? ? CG A PHE 22 ? ? CD2 A PHE 22 ? ? 126.44 120.80 5.64 0.70 N 59 11 N A ALA 27 ? ? CA A ALA 27 ? ? CB A ALA 27 ? ? 101.12 110.10 -8.98 1.40 N 60 11 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.97 110.90 10.07 1.50 N 61 11 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 123.49 110.50 12.99 1.50 N 62 11 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 131.70 111.40 20.30 1.90 N 63 11 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 97.08 110.10 -13.02 1.50 N 64 12 CB A TYR 4 ? ? CG A TYR 4 ? ? CD1 A TYR 4 ? ? 115.57 121.00 -5.43 0.60 N 65 12 CB A LEU 7 ? ? CG A LEU 7 ? ? CD2 A LEU 7 ? ? 123.02 111.00 12.02 1.70 N 66 12 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 116.59 121.00 -4.41 0.60 N 67 12 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 125.74 121.00 4.74 0.60 N 68 12 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.10 110.90 9.20 1.50 N 69 12 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 125.55 110.50 15.05 1.50 N 70 12 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 122.90 111.40 11.50 1.90 N 71 12 CA A VAL 57 ? ? CB A VAL 57 ? ? CG2 A VAL 57 ? ? 119.92 110.90 9.02 1.50 N 72 12 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.50 110.10 -13.60 1.50 N 73 13 CB A TYR 4 ? ? CG A TYR 4 ? ? CD2 A TYR 4 ? ? 117.25 121.00 -3.75 0.60 N 74 13 N A ALA 27 ? ? CA A ALA 27 ? ? CB A ALA 27 ? ? 101.54 110.10 -8.56 1.40 N 75 13 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 126.26 121.00 5.26 0.60 N 76 13 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 116.08 121.00 -4.92 0.60 N 77 13 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 124.40 110.50 13.90 1.50 N 78 13 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 130.71 111.40 19.31 1.90 N 79 13 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.09 110.10 -14.01 1.50 N 80 14 CB A TYR 4 ? ? CG A TYR 4 ? ? CD2 A TYR 4 ? ? 117.18 121.00 -3.82 0.60 N 81 14 CB A LEU 7 ? ? CG A LEU 7 ? ? CD2 A LEU 7 ? ? 122.22 111.00 11.22 1.70 N 82 14 CB A PHE 22 ? ? CG A PHE 22 ? ? CD2 A PHE 22 ? ? 126.51 120.80 5.71 0.70 N 83 14 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 116.46 121.00 -4.54 0.60 N 84 14 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 125.65 121.00 4.65 0.60 N 85 14 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 126.20 110.50 15.70 1.50 N 86 14 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.20 110.10 -13.90 1.50 N 87 15 CB A TYR 4 ? ? CG A TYR 4 ? ? CD2 A TYR 4 ? ? 116.25 121.00 -4.75 0.60 N 88 15 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 123.31 110.50 12.81 1.50 N 89 15 CB A TYR 34 ? ? CG A TYR 34 ? ? CD1 A TYR 34 ? ? 117.38 121.00 -3.62 0.60 N 90 15 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.42 111.40 12.02 1.90 N 91 15 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.40 110.10 -13.70 1.50 N 92 16 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 116.63 121.00 -4.37 0.60 N 93 16 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 124.82 121.00 3.82 0.60 N 94 16 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.15 110.90 9.25 1.50 N 95 16 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 124.50 110.50 14.00 1.50 N 96 16 CB A LEU 37 ? ? CG A LEU 37 ? ? CD2 A LEU 37 ? ? 122.94 111.00 11.94 1.70 N 97 16 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.58 111.40 12.18 1.90 N 98 16 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.32 110.10 -13.78 1.50 N 99 17 CA A VAL 31 ? ? CB A VAL 31 ? ? CG2 A VAL 31 ? ? 120.88 110.90 9.98 1.50 N 100 17 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 124.79 110.50 14.29 1.50 N 101 17 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 122.88 111.40 11.48 1.90 N 102 17 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.36 110.10 -13.74 1.50 N 103 17 CA A LYS 62 ? ? CB A LYS 62 ? ? CG A LYS 62 ? ? 126.69 113.40 13.29 2.20 N 104 18 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 116.25 121.00 -4.75 0.60 N 105 18 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 126.61 121.00 5.61 0.60 N 106 18 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 122.69 110.50 12.19 1.50 N 107 18 CB A LEU 37 ? ? CG A LEU 37 ? ? CD2 A LEU 37 ? ? 122.24 111.00 11.24 1.70 N 108 18 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.38 110.10 -13.72 1.50 N 109 18 CA A TYR 60 ? ? CB A TYR 60 ? ? CG A TYR 60 ? ? 125.52 113.40 12.12 1.90 N 110 19 CB A TYR 4 ? ? CG A TYR 4 ? ? CD1 A TYR 4 ? ? 116.96 121.00 -4.04 0.60 N 111 19 CB A PHE 21 ? ? CA A PHE 21 ? ? C A PHE 21 ? ? 125.99 110.40 15.59 2.00 N 112 19 CB A PHE 22 ? ? CG A PHE 22 ? ? CD2 A PHE 22 ? ? 126.91 120.80 6.11 0.70 N 113 19 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 119.69 110.50 9.19 1.50 N 114 19 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.55 111.40 12.15 1.90 N 115 19 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.31 110.10 -13.79 1.50 N 116 20 CB A LEU 7 ? ? CG A LEU 7 ? ? CD2 A LEU 7 ? ? 122.23 111.00 11.23 1.70 N 117 20 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 124.71 121.00 3.71 0.60 N 118 20 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 117.11 121.00 -3.89 0.60 N 119 20 N A SER 33 ? ? CA A SER 33 ? ? CB A SER 33 ? ? 125.62 110.50 15.12 1.50 N 120 20 CB A TYR 34 ? ? CG A TYR 34 ? ? CD1 A TYR 34 ? ? 117.24 121.00 -3.76 0.60 N 121 20 CB A LEU 37 ? ? CG A LEU 37 ? ? CD2 A LEU 37 ? ? 123.78 111.00 12.78 1.70 N 122 20 CB A VAL 57 ? ? CA A VAL 57 ? ? C A VAL 57 ? ? 123.66 111.40 12.26 1.90 N 123 20 CB A ALA 59 ? ? CA A ALA 59 ? ? C A ALA 59 ? ? 96.99 110.10 -13.11 1.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 30 ? ? -98.43 -71.42 2 1 SER A 33 ? ? -179.73 -174.51 3 1 TYR A 34 ? ? -43.27 -19.67 4 1 PRO A 66 ? ? -83.14 49.34 5 1 PRO A 69 ? ? -93.37 -114.74 6 1 LEU A 75 ? ? 142.09 71.21 7 1 LYS A 77 ? ? 136.34 -63.59 8 1 GLU A 79 ? ? 83.65 167.83 9 2 LYS A 14 ? ? -154.63 -142.78 10 2 TYR A 30 ? ? -110.17 -70.64 11 2 SER A 33 ? ? 178.08 -175.20 12 2 SER A 44 ? ? -82.39 44.55 13 2 PRO A 65 ? ? -82.31 -86.45 14 2 ALA A 67 ? ? 177.25 168.90 15 2 LEU A 75 ? ? -102.61 49.99 16 2 LEU A 78 ? ? -149.42 34.97 17 2 GLU A 79 ? ? -138.41 -69.82 18 3 TYR A 30 ? ? -111.97 -97.88 19 3 SER A 33 ? ? -179.18 -176.06 20 3 ALA A 67 ? ? -175.03 -175.05 21 3 ALA A 70 ? ? 93.98 150.32 22 3 THR A 74 ? ? -148.40 30.31 23 3 SER A 76 ? ? 62.64 -43.85 24 4 LYS A 14 ? ? -141.17 -157.65 25 4 TYR A 30 ? ? -100.34 -80.49 26 4 SER A 33 ? ? 179.45 -174.95 27 4 ALA A 46 ? ? -68.84 5.08 28 4 ALA A 67 ? ? 88.03 77.63 29 4 THR A 74 ? ? -99.99 -72.56 30 4 SER A 76 ? ? -116.41 -161.56 31 4 LYS A 77 ? ? 73.89 46.99 32 4 LEU A 78 ? ? 82.66 37.38 33 4 GLU A 79 ? ? -119.21 -97.55 34 5 LYS A 14 ? ? -105.81 -138.40 35 5 TYR A 30 ? ? -101.43 -77.97 36 5 SER A 33 ? ? 179.95 -175.86 37 5 SER A 44 ? ? -90.35 52.79 38 5 ALA A 46 ? ? -69.01 5.80 39 5 TYR A 60 ? ? -49.41 -13.77 40 5 ALA A 67 ? ? -119.67 74.19 41 5 LYS A 77 ? ? 83.10 -58.33 42 5 GLU A 79 ? ? -144.45 -84.26 43 6 TYR A 30 ? ? -113.38 -74.81 44 6 SER A 33 ? ? -178.40 -176.61 45 6 ALA A 46 ? ? -69.72 4.19 46 6 ALA A 67 ? ? -173.54 -163.35 47 6 SER A 76 ? ? -112.93 -151.73 48 6 LYS A 77 ? ? 65.16 -77.92 49 6 GLU A 79 ? ? -100.19 -99.34 50 7 SER A 33 ? ? 179.69 -175.74 51 7 SER A 44 ? ? -68.44 51.33 52 7 ALA A 46 ? ? -68.91 6.46 53 7 TYR A 60 ? ? -49.63 -12.87 54 7 PRO A 66 ? ? -94.82 -126.48 55 7 THR A 74 ? ? 86.55 40.68 56 7 LEU A 75 ? ? -106.83 -64.90 57 7 LYS A 77 ? ? 91.01 79.45 58 7 LEU A 78 ? ? 76.56 -42.67 59 8 SER A 33 ? ? 178.81 -175.43 60 8 SER A 44 ? ? -63.68 42.70 61 8 ALA A 46 ? ? -69.38 4.22 62 8 TYR A 60 ? ? -49.33 -13.04 63 8 THR A 74 ? ? -98.12 -87.36 64 8 LEU A 78 ? ? 100.12 -35.74 65 9 TYR A 30 ? ? -112.59 -82.37 66 9 SER A 33 ? ? -179.42 -175.90 67 9 ALA A 46 ? ? -69.79 4.28 68 9 ALA A 70 ? ? 83.11 100.04 69 9 SER A 76 ? ? 47.56 -143.02 70 9 GLU A 79 ? ? 61.66 105.31 71 10 SER A 33 ? ? 179.55 -175.10 72 10 ALA A 46 ? ? -69.66 3.99 73 10 THR A 74 ? ? 82.00 40.95 74 10 SER A 76 ? ? -122.96 -68.66 75 10 LYS A 77 ? ? -36.95 -70.04 76 10 LEU A 78 ? ? -107.53 51.39 77 10 GLU A 79 ? ? -161.97 -134.95 78 11 LYS A 14 ? ? -148.30 -153.61 79 11 TYR A 30 ? ? -106.01 -108.93 80 11 SER A 33 ? ? -178.80 -175.49 81 11 SER A 44 ? ? -96.79 31.18 82 11 ALA A 46 ? ? -68.18 4.60 83 11 PRO A 66 ? ? -78.06 39.02 84 11 ALA A 67 ? ? -170.74 65.33 85 11 THR A 74 ? ? -98.89 -68.20 86 11 LEU A 75 ? ? -142.47 54.02 87 11 SER A 76 ? ? -112.18 -145.76 88 11 LYS A 77 ? ? 68.91 -67.99 89 11 GLU A 79 ? ? -106.77 50.23 90 12 TYR A 30 ? ? -110.54 -78.23 91 12 SER A 33 ? ? 179.27 -175.78 92 12 ALA A 46 ? ? -69.81 3.94 93 12 LEU A 78 ? ? 78.96 -39.49 94 13 LYS A 14 ? ? -143.27 -151.23 95 13 SER A 33 ? ? 179.23 -176.10 96 13 LEU A 78 ? ? 98.64 -24.37 97 14 SER A 33 ? ? 179.54 -175.55 98 14 TYR A 34 ? ? -43.21 -17.86 99 14 SER A 44 ? ? -66.91 59.46 100 14 ALA A 46 ? ? -68.56 5.80 101 14 PRO A 69 ? ? -87.06 42.81 102 14 LEU A 75 ? ? 111.08 -26.63 103 14 SER A 76 ? ? 60.89 -124.95 104 14 LEU A 78 ? ? -172.73 -68.04 105 14 GLU A 79 ? ? -158.73 -48.46 106 15 SER A 33 ? ? 178.81 -175.42 107 15 ALA A 46 ? ? -69.27 5.64 108 15 THR A 74 ? ? -162.81 -52.91 109 15 LYS A 77 ? ? -153.91 -53.48 110 16 PRO A 16 ? ? -67.77 -178.20 111 16 SER A 33 ? ? 178.67 -174.82 112 16 ALA A 46 ? ? -69.22 4.78 113 16 ALA A 67 ? ? -158.78 84.13 114 16 ALA A 70 ? ? -160.45 -57.81 115 16 LEU A 75 ? ? -59.36 45.24 116 16 SER A 76 ? ? -155.45 -24.12 117 16 LEU A 78 ? ? 97.30 -46.13 118 17 TYR A 30 ? ? -96.13 -74.03 119 17 SER A 33 ? ? -179.28 -175.13 120 17 ALA A 46 ? ? -69.09 5.35 121 17 ALA A 70 ? ? 108.29 -69.82 122 17 SER A 76 ? ? 51.83 -105.12 123 18 TYR A 30 ? ? -108.72 -62.92 124 18 SER A 33 ? ? -178.98 -176.03 125 18 ALA A 46 ? ? -67.55 4.18 126 18 PRO A 69 ? ? -64.62 54.82 127 18 GLU A 79 ? ? -157.40 -51.26 128 19 TYR A 30 ? ? -96.07 -75.83 129 19 SER A 33 ? ? -178.06 -177.95 130 19 TYR A 34 ? ? -44.46 -19.65 131 19 ILE A 64 ? ? -104.22 61.63 132 19 PRO A 66 ? ? -82.53 36.83 133 19 PRO A 69 ? ? -68.01 78.41 134 19 THR A 74 ? ? -3.27 101.50 135 19 SER A 76 ? ? 175.69 70.41 136 19 LYS A 77 ? ? 86.16 -70.17 137 19 LEU A 78 ? ? -109.07 -63.11 138 19 GLU A 79 ? ? -153.34 -19.41 139 20 TYR A 30 ? ? -103.20 -66.43 140 20 SER A 33 ? ? 177.23 -173.62 141 20 SER A 44 ? ? -86.08 42.62 142 20 ALA A 46 ? ? -69.18 5.57 143 20 ALA A 67 ? ? -134.72 -57.19 144 20 PRO A 71 ? ? -98.63 -143.52 145 20 THR A 74 ? ? -153.99 30.29 146 20 LEU A 75 ? ? -141.62 -85.86 147 20 SER A 76 ? ? 87.01 -46.24 148 20 GLU A 79 ? ? -151.15 38.62 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASP A 3 ? ? TYR A 4 ? ? 149.42 2 2 ASP A 3 ? ? TYR A 4 ? ? 145.25 3 8 ASP A 3 ? ? TYR A 4 ? ? 147.44 4 9 ASP A 3 ? ? TYR A 4 ? ? 149.50 5 11 ASP A 3 ? ? TYR A 4 ? ? 147.36 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 CA ? A SER 33 ? PLANAR . 2 1 CA ? A VAL 57 ? PLANAR . 3 3 CA ? A VAL 57 ? PLANAR . 4 4 CA ? A VAL 57 ? PLANAR . 5 5 CA ? A VAL 57 ? PLANAR . 6 6 CA ? A VAL 57 ? PLANAR . 7 9 CA ? A VAL 57 ? PLANAR . 8 10 CA ? A VAL 57 ? PLANAR . 9 11 CA ? A VAL 57 ? PLANAR . 10 12 CA ? A VAL 57 ? PLANAR . 11 13 CA ? A VAL 57 ? PLANAR . 12 14 CA ? A VAL 57 ? PLANAR . 13 15 CA ? A VAL 57 ? PLANAR . 14 16 CA ? A VAL 57 ? PLANAR . 15 17 CA ? A VAL 57 ? PLANAR . 16 19 CA ? A VAL 57 ? PLANAR . 17 20 CA ? A VAL 57 ? PLANAR . # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 8 ? ? 0.123 'SIDE CHAIN' 2 1 PHE A 21 ? ? 0.099 'SIDE CHAIN' 3 1 PHE A 22 ? ? 0.089 'SIDE CHAIN' 4 1 TYR A 30 ? ? 0.075 'SIDE CHAIN' 5 1 TYR A 60 ? ? 0.083 'SIDE CHAIN' 6 2 ARG A 8 ? ? 0.130 'SIDE CHAIN' 7 2 TYR A 30 ? ? 0.117 'SIDE CHAIN' 8 2 TYR A 34 ? ? 0.065 'SIDE CHAIN' 9 3 ARG A 8 ? ? 0.100 'SIDE CHAIN' 10 3 PHE A 21 ? ? 0.108 'SIDE CHAIN' 11 3 PHE A 22 ? ? 0.092 'SIDE CHAIN' 12 3 TYR A 30 ? ? 0.120 'SIDE CHAIN' 13 3 TYR A 34 ? ? 0.102 'SIDE CHAIN' 14 3 TYR A 60 ? ? 0.086 'SIDE CHAIN' 15 4 ARG A 8 ? ? 0.084 'SIDE CHAIN' 16 4 PHE A 21 ? ? 0.090 'SIDE CHAIN' 17 4 TYR A 30 ? ? 0.101 'SIDE CHAIN' 18 5 ARG A 8 ? ? 0.111 'SIDE CHAIN' 19 5 PHE A 21 ? ? 0.104 'SIDE CHAIN' 20 5 TYR A 60 ? ? 0.078 'SIDE CHAIN' 21 6 ARG A 8 ? ? 0.128 'SIDE CHAIN' 22 6 PHE A 21 ? ? 0.151 'SIDE CHAIN' 23 6 PHE A 22 ? ? 0.083 'SIDE CHAIN' 24 6 PHE A 56 ? ? 0.080 'SIDE CHAIN' 25 6 TYR A 60 ? ? 0.106 'SIDE CHAIN' 26 7 ARG A 8 ? ? 0.130 'SIDE CHAIN' 27 7 PHE A 21 ? ? 0.109 'SIDE CHAIN' 28 7 TYR A 30 ? ? 0.112 'SIDE CHAIN' 29 7 TYR A 34 ? ? 0.088 'SIDE CHAIN' 30 7 TYR A 60 ? ? 0.101 'SIDE CHAIN' 31 8 ARG A 8 ? ? 0.099 'SIDE CHAIN' 32 8 TYR A 30 ? ? 0.101 'SIDE CHAIN' 33 8 TYR A 60 ? ? 0.077 'SIDE CHAIN' 34 9 ARG A 8 ? ? 0.125 'SIDE CHAIN' 35 9 PHE A 21 ? ? 0.092 'SIDE CHAIN' 36 9 TYR A 30 ? ? 0.102 'SIDE CHAIN' 37 9 TYR A 60 ? ? 0.084 'SIDE CHAIN' 38 10 ARG A 8 ? ? 0.115 'SIDE CHAIN' 39 10 PHE A 21 ? ? 0.083 'SIDE CHAIN' 40 10 TYR A 30 ? ? 0.147 'SIDE CHAIN' 41 10 TYR A 34 ? ? 0.068 'SIDE CHAIN' 42 10 TYR A 60 ? ? 0.083 'SIDE CHAIN' 43 11 ARG A 8 ? ? 0.114 'SIDE CHAIN' 44 11 PHE A 21 ? ? 0.106 'SIDE CHAIN' 45 11 TYR A 34 ? ? 0.071 'SIDE CHAIN' 46 11 TYR A 60 ? ? 0.082 'SIDE CHAIN' 47 12 ARG A 8 ? ? 0.107 'SIDE CHAIN' 48 12 PHE A 21 ? ? 0.089 'SIDE CHAIN' 49 12 TYR A 30 ? ? 0.159 'SIDE CHAIN' 50 12 TYR A 60 ? ? 0.082 'SIDE CHAIN' 51 13 TYR A 4 ? ? 0.086 'SIDE CHAIN' 52 13 ARG A 8 ? ? 0.109 'SIDE CHAIN' 53 13 PHE A 21 ? ? 0.095 'SIDE CHAIN' 54 13 TYR A 34 ? ? 0.106 'SIDE CHAIN' 55 14 ARG A 8 ? ? 0.119 'SIDE CHAIN' 56 14 TYR A 30 ? ? 0.128 'SIDE CHAIN' 57 14 TYR A 60 ? ? 0.082 'SIDE CHAIN' 58 15 ARG A 8 ? ? 0.127 'SIDE CHAIN' 59 15 PHE A 21 ? ? 0.105 'SIDE CHAIN' 60 15 TYR A 30 ? ? 0.104 'SIDE CHAIN' 61 15 TYR A 34 ? ? 0.080 'SIDE CHAIN' 62 15 TYR A 60 ? ? 0.097 'SIDE CHAIN' 63 16 ARG A 8 ? ? 0.109 'SIDE CHAIN' 64 16 PHE A 21 ? ? 0.086 'SIDE CHAIN' 65 16 TYR A 30 ? ? 0.098 'SIDE CHAIN' 66 16 TYR A 60 ? ? 0.122 'SIDE CHAIN' 67 17 TYR A 4 ? ? 0.075 'SIDE CHAIN' 68 17 ARG A 8 ? ? 0.107 'SIDE CHAIN' 69 17 PHE A 21 ? ? 0.097 'SIDE CHAIN' 70 17 TYR A 60 ? ? 0.125 'SIDE CHAIN' 71 18 ARG A 8 ? ? 0.122 'SIDE CHAIN' 72 18 PHE A 21 ? ? 0.117 'SIDE CHAIN' 73 18 PHE A 22 ? ? 0.079 'SIDE CHAIN' 74 18 TYR A 30 ? ? 0.084 'SIDE CHAIN' 75 18 TYR A 60 ? ? 0.092 'SIDE CHAIN' 76 19 ARG A 8 ? ? 0.115 'SIDE CHAIN' 77 19 PHE A 21 ? ? 0.132 'SIDE CHAIN' 78 19 PHE A 22 ? ? 0.100 'SIDE CHAIN' 79 19 TYR A 30 ? ? 0.069 'SIDE CHAIN' 80 19 TYR A 34 ? ? 0.111 'SIDE CHAIN' 81 19 TYR A 60 ? ? 0.090 'SIDE CHAIN' 82 20 ARG A 8 ? ? 0.117 'SIDE CHAIN' 83 20 PHE A 21 ? ? 0.086 'SIDE CHAIN' 84 20 TYR A 30 ? ? 0.112 'SIDE CHAIN' 85 20 TYR A 60 ? ? 0.085 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 5LXL _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5LXL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] n77, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component n77 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D HSQC' 1 isotropic 2 1 1 '3D TOCSY-NOESY' 2 isotropic 3 1 1 '3D HNHA' 2 isotropic 4 1 1 '3D CBCA(CO)NH' 2 isotropic 5 1 1 '3D HNCACB' 2 isotropic 8 1 1 '3D HNCO' 2 isotropic 7 1 1 '3D HN(CA)CO' 2 isotropic 6 1 1 '3D HBHA(CO)NH' 2 isotropic 9 1 1 '3D HN(CO)CA' 2 isotropic 10 1 1 '3D HN(CA)NNH' 2 isotropic # _pdbx_nmr_refine.entry_id 5LXL _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' 'CcpNmr Analysis' ? CCPN 2 'structure calculation' INCA ? 'Savarin P., Zinn-Justin S., Gilquin B., 19,2001, J. Biomol NMR, pp. 49-62' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN 5 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 81 ? A HIS 82 2 1 Y 1 A HIS 82 ? A HIS 83 3 1 Y 1 A HIS 83 ? A HIS 84 4 1 Y 1 A HIS 84 ? A HIS 85 5 1 Y 1 A HIS 85 ? A HIS 86 6 2 Y 1 A HIS 81 ? A HIS 82 7 2 Y 1 A HIS 82 ? A HIS 83 8 2 Y 1 A HIS 83 ? A HIS 84 9 2 Y 1 A HIS 84 ? A HIS 85 10 2 Y 1 A HIS 85 ? A HIS 86 11 3 Y 1 A HIS 81 ? A HIS 82 12 3 Y 1 A HIS 82 ? A HIS 83 13 3 Y 1 A HIS 83 ? A HIS 84 14 3 Y 1 A HIS 84 ? A HIS 85 15 3 Y 1 A HIS 85 ? A HIS 86 16 4 Y 1 A HIS 81 ? A HIS 82 17 4 Y 1 A HIS 82 ? A HIS 83 18 4 Y 1 A HIS 83 ? A HIS 84 19 4 Y 1 A HIS 84 ? A HIS 85 20 4 Y 1 A HIS 85 ? A HIS 86 21 5 Y 1 A HIS 81 ? A HIS 82 22 5 Y 1 A HIS 82 ? A HIS 83 23 5 Y 1 A HIS 83 ? A HIS 84 24 5 Y 1 A HIS 84 ? A HIS 85 25 5 Y 1 A HIS 85 ? A HIS 86 26 6 Y 1 A HIS 81 ? A HIS 82 27 6 Y 1 A HIS 82 ? A HIS 83 28 6 Y 1 A HIS 83 ? A HIS 84 29 6 Y 1 A HIS 84 ? A HIS 85 30 6 Y 1 A HIS 85 ? A HIS 86 31 7 Y 1 A HIS 81 ? A HIS 82 32 7 Y 1 A HIS 82 ? A HIS 83 33 7 Y 1 A HIS 83 ? A HIS 84 34 7 Y 1 A HIS 84 ? A HIS 85 35 7 Y 1 A HIS 85 ? A HIS 86 36 8 Y 1 A HIS 81 ? A HIS 82 37 8 Y 1 A HIS 82 ? A HIS 83 38 8 Y 1 A HIS 83 ? A HIS 84 39 8 Y 1 A HIS 84 ? A HIS 85 40 8 Y 1 A HIS 85 ? A HIS 86 41 9 Y 1 A HIS 81 ? A HIS 82 42 9 Y 1 A HIS 82 ? A HIS 83 43 9 Y 1 A HIS 83 ? A HIS 84 44 9 Y 1 A HIS 84 ? A HIS 85 45 9 Y 1 A HIS 85 ? A HIS 86 46 10 Y 1 A HIS 81 ? A HIS 82 47 10 Y 1 A HIS 82 ? A HIS 83 48 10 Y 1 A HIS 83 ? A HIS 84 49 10 Y 1 A HIS 84 ? A HIS 85 50 10 Y 1 A HIS 85 ? A HIS 86 51 11 Y 1 A HIS 81 ? A HIS 82 52 11 Y 1 A HIS 82 ? A HIS 83 53 11 Y 1 A HIS 83 ? A HIS 84 54 11 Y 1 A HIS 84 ? A HIS 85 55 11 Y 1 A HIS 85 ? A HIS 86 56 12 Y 1 A HIS 81 ? A HIS 82 57 12 Y 1 A HIS 82 ? A HIS 83 58 12 Y 1 A HIS 83 ? A HIS 84 59 12 Y 1 A HIS 84 ? A HIS 85 60 12 Y 1 A HIS 85 ? A HIS 86 61 13 Y 1 A HIS 81 ? A HIS 82 62 13 Y 1 A HIS 82 ? A HIS 83 63 13 Y 1 A HIS 83 ? A HIS 84 64 13 Y 1 A HIS 84 ? A HIS 85 65 13 Y 1 A HIS 85 ? A HIS 86 66 14 Y 1 A HIS 81 ? A HIS 82 67 14 Y 1 A HIS 82 ? A HIS 83 68 14 Y 1 A HIS 83 ? A HIS 84 69 14 Y 1 A HIS 84 ? A HIS 85 70 14 Y 1 A HIS 85 ? A HIS 86 71 15 Y 1 A HIS 81 ? A HIS 82 72 15 Y 1 A HIS 82 ? A HIS 83 73 15 Y 1 A HIS 83 ? A HIS 84 74 15 Y 1 A HIS 84 ? A HIS 85 75 15 Y 1 A HIS 85 ? A HIS 86 76 16 Y 1 A HIS 81 ? A HIS 82 77 16 Y 1 A HIS 82 ? A HIS 83 78 16 Y 1 A HIS 83 ? A HIS 84 79 16 Y 1 A HIS 84 ? A HIS 85 80 16 Y 1 A HIS 85 ? A HIS 86 81 17 Y 1 A HIS 81 ? A HIS 82 82 17 Y 1 A HIS 82 ? A HIS 83 83 17 Y 1 A HIS 83 ? A HIS 84 84 17 Y 1 A HIS 84 ? A HIS 85 85 17 Y 1 A HIS 85 ? A HIS 86 86 18 Y 1 A HIS 81 ? A HIS 82 87 18 Y 1 A HIS 82 ? A HIS 83 88 18 Y 1 A HIS 83 ? A HIS 84 89 18 Y 1 A HIS 84 ? A HIS 85 90 18 Y 1 A HIS 85 ? A HIS 86 91 19 Y 1 A HIS 81 ? A HIS 82 92 19 Y 1 A HIS 82 ? A HIS 83 93 19 Y 1 A HIS 83 ? A HIS 84 94 19 Y 1 A HIS 84 ? A HIS 85 95 19 Y 1 A HIS 85 ? A HIS 86 96 20 Y 1 A HIS 81 ? A HIS 82 97 20 Y 1 A HIS 82 ? A HIS 83 98 20 Y 1 A HIS 83 ? A HIS 84 99 20 Y 1 A HIS 84 ? A HIS 85 100 20 Y 1 A HIS 85 ? A HIS 86 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TRP N CA sing N N 272 TRP N H sing N N 273 TRP N H2 sing N N 274 TRP CA C sing N N 275 TRP CA CB sing N N 276 TRP CA HA sing N N 277 TRP C O doub N N 278 TRP C OXT sing N N 279 TRP CB CG sing N N 280 TRP CB HB2 sing N N 281 TRP CB HB3 sing N N 282 TRP CG CD1 doub Y N 283 TRP CG CD2 sing Y N 284 TRP CD1 NE1 sing Y N 285 TRP CD1 HD1 sing N N 286 TRP CD2 CE2 doub Y N 287 TRP CD2 CE3 sing Y N 288 TRP NE1 CE2 sing Y N 289 TRP NE1 HE1 sing N N 290 TRP CE2 CZ2 sing Y N 291 TRP CE3 CZ3 doub Y N 292 TRP CE3 HE3 sing N N 293 TRP CZ2 CH2 doub Y N 294 TRP CZ2 HZ2 sing N N 295 TRP CZ3 CH2 sing Y N 296 TRP CZ3 HZ3 sing N N 297 TRP CH2 HH2 sing N N 298 TRP OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _pdbx_audit_support.funding_organization FRISBI _pdbx_audit_support.country France _pdbx_audit_support.grant_number ANR-10-INSB-05-01 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 DRX ? Bruker 600 ? 2 DRX ? Bruker 700 ? # _atom_sites.entry_id 5LXL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_