data_5M3T # _entry.id 5M3T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5M3T WWPDB D_1200001814 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'same pubblication' 5M2C unspecified PDB 'same pubblication' 5M3D unspecified PDB 'same pubblication' 5M33 unspecified PDB 'same pubblication' 5M4R unspecified PDB ;previous pubblication: Kitadokoro et al., 2001 ; 1G8Q unspecified PDB ;previous pubblication: Kitadokoro et al., 2002 ; 1IV5 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5M3T _pdbx_database_status.recvd_initial_deposition_date 2016-10-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cunha, E.S.' 1 ? 'Sfriso, P.' 2 ? 'Rojas, A.L.' 3 ? 'Roversi, P.' 4 ? 'Hospital, A.' 5 ? 'Orozco, M.' 6 ? 'Abrescia, N.G.' 7 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary Structure STRUE6 2005 1878-4186 ? ? 25 ? 53 65 'Mechanism of Structural Tuning of the Hepatitis C Virus Human Cellular Receptor CD81 Large Extracellular Loop.' 2017 ? 10.1016/j.str.2016.11.003 27916518 ? ? ? ? ? ? ? ? UK ? ? 1 'EMBO J.' EMJODG 0897 0261-4189 ? ? 20 ? 12 18 'CD81 extracellular domain 3D structure: insight into the tetraspanin superfamily structural motifs.' 2001 ? ? 11226150 ? ? ? ? ? ? ? ? GE ? ? 2 'Biol. Chem.' ? ? 1431-6730 ? ? 383 ? 1447 1452 'Subunit association and conformational flexibility in the head subdomain of human CD81 large extracellular loop.' 2002 ? ? 12437138 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cunha, E.S.' 1 primary 'Sfriso, P.' 2 primary 'Rojas, A.L.' 3 primary 'Roversi, P.' 4 primary 'Hospital, A.' 5 primary 'Orozco, M.' 6 primary 'Abrescia, N.G.' 7 1 'Kitadokoro, K.' 8 1 'Bordo, D.' 9 1 'Galli, G.' 10 1 'Petracca, R.' 11 1 'Falugi, F.' 12 1 'Abrignani, S.' 13 1 'Grandi, G.' 14 1 'Bolognesi, M.' 15 2 'Kitadokoro, K.' 16 2 'Ponassi, M.' 17 2 'Galli, G.' 18 2 'Petracca, R.' 19 2 'Falugi, F.' 20 2 'Grandi, G.' 21 2 'Bolognesi, M.' 22 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5M3T _cell.details ? _cell.formula_units_Z ? _cell.length_a 101.300 _cell.length_a_esd ? _cell.length_b 101.300 _cell.length_b_esd ? _cell.length_c 35.900 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5M3T _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CD81 antigen' 11182.417 2 ? ? 'LEL domain, UNP residues 112-201' ? 2 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 6 ? ? ? ? 4 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '26 kDa cell surface protein TAPA-1,Target of the antiproliferative antibody 1,Tetraspanin-28,Tspan-28' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ETGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKED CHQKIDDLFSGKGTKHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;ETGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKED CHQKIDDLFSGKGTKHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 THR n 1 3 GLY n 1 4 PHE n 1 5 VAL n 1 6 ASN n 1 7 LYS n 1 8 ASP n 1 9 GLN n 1 10 ILE n 1 11 ALA n 1 12 LYS n 1 13 ASP n 1 14 VAL n 1 15 LYS n 1 16 GLN n 1 17 PHE n 1 18 TYR n 1 19 ASP n 1 20 GLN n 1 21 ALA n 1 22 LEU n 1 23 GLN n 1 24 GLN n 1 25 ALA n 1 26 VAL n 1 27 VAL n 1 28 ASP n 1 29 ASP n 1 30 ASP n 1 31 ALA n 1 32 ASN n 1 33 ASN n 1 34 ALA n 1 35 LYS n 1 36 ALA n 1 37 VAL n 1 38 VAL n 1 39 LYS n 1 40 THR n 1 41 PHE n 1 42 HIS n 1 43 GLU n 1 44 THR n 1 45 LEU n 1 46 ASP n 1 47 CYS n 1 48 CYS n 1 49 GLY n 1 50 SER n 1 51 SER n 1 52 THR n 1 53 LEU n 1 54 THR n 1 55 ALA n 1 56 LEU n 1 57 THR n 1 58 THR n 1 59 SER n 1 60 VAL n 1 61 LEU n 1 62 LYS n 1 63 ASN n 1 64 ASN n 1 65 LEU n 1 66 CYS n 1 67 PRO n 1 68 SER n 1 69 GLY n 1 70 SER n 1 71 ASN n 1 72 ILE n 1 73 ILE n 1 74 SER n 1 75 ASN n 1 76 LEU n 1 77 PHE n 1 78 LYS n 1 79 GLU n 1 80 ASP n 1 81 CYS n 1 82 HIS n 1 83 GLN n 1 84 LYS n 1 85 ILE n 1 86 ASP n 1 87 ASP n 1 88 LEU n 1 89 PHE n 1 90 SER n 1 91 GLY n 1 92 LYS n 1 93 GLY n 1 94 THR n 1 95 LYS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 101 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CD81, TAPA1, TSPAN28' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name Human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line HEK293T _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pHLSec _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD81_HUMAN _struct_ref.pdbx_db_accession P60033 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCH QKIDDLFSGK ; _struct_ref.pdbx_align_begin 112 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5M3T A 3 ? 92 ? P60033 112 ? 201 ? 112 201 2 1 5M3T B 3 ? 92 ? P60033 112 ? 201 ? 112 201 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5M3T GLU A 1 ? UNP P60033 ? ? 'expression tag' 110 1 1 5M3T THR A 2 ? UNP P60033 ? ? 'expression tag' 111 2 1 5M3T GLY A 93 ? UNP P60033 ? ? 'expression tag' 202 3 1 5M3T THR A 94 ? UNP P60033 ? ? 'expression tag' 203 4 1 5M3T LYS A 95 ? UNP P60033 ? ? 'expression tag' 204 5 1 5M3T HIS A 96 ? UNP P60033 ? ? 'expression tag' 205 6 1 5M3T HIS A 97 ? UNP P60033 ? ? 'expression tag' 206 7 1 5M3T HIS A 98 ? UNP P60033 ? ? 'expression tag' 207 8 1 5M3T HIS A 99 ? UNP P60033 ? ? 'expression tag' 208 9 1 5M3T HIS A 100 ? UNP P60033 ? ? 'expression tag' 209 10 1 5M3T HIS A 101 ? UNP P60033 ? ? 'expression tag' 210 11 2 5M3T GLU B 1 ? UNP P60033 ? ? 'expression tag' 110 12 2 5M3T THR B 2 ? UNP P60033 ? ? 'expression tag' 111 13 2 5M3T GLY B 93 ? UNP P60033 ? ? 'expression tag' 202 14 2 5M3T THR B 94 ? UNP P60033 ? ? 'expression tag' 203 15 2 5M3T LYS B 95 ? UNP P60033 ? ? 'expression tag' 204 16 2 5M3T HIS B 96 ? UNP P60033 ? ? 'expression tag' 205 17 2 5M3T HIS B 97 ? UNP P60033 ? ? 'expression tag' 206 18 2 5M3T HIS B 98 ? UNP P60033 ? ? 'expression tag' 207 19 2 5M3T HIS B 99 ? UNP P60033 ? ? 'expression tag' 208 20 2 5M3T HIS B 100 ? UNP P60033 ? ? 'expression tag' 209 21 2 5M3T HIS B 101 ? UNP P60033 ? ? 'expression tag' 210 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5M3T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Protein: 10 mg/ml Buffer: 0.1 MMT pH 5, 25% w/v PEG 1500 grown in presence of fexofenadine although not visible in the electron density map ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5M3T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.02 _reflns.d_resolution_low 50.65 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12501 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 88.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.6 _reflns.pdbx_Rmerge_I_obs 0.03 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.02 _reflns_shell.d_res_low 2.07 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 53.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.396 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.802 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5M3T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.021 _refine.ls_d_res_low 50.650 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12489 _refine.ls_number_reflns_R_free 601 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 88.73 _refine.ls_percent_reflns_R_free 4.81 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1735 _refine.ls_R_factor_R_free 0.2084 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1717 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.12 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1G8Q _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.76 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1384 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1430 _refine_hist.d_res_high 2.021 _refine_hist.d_res_low 50.650 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1421 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.828 ? 1900 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.575 ? 513 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.032 ? 225 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 247 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0207 2.2240 . . 111 2096 63.00 . . . 0.2798 . 0.2139 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2240 2.5458 . . 154 3060 92.00 . . . 0.2242 . 0.1946 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5458 3.2074 . . 170 3316 100.00 . . . 0.2593 . 0.2088 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2074 50.6659 . . 166 3416 99.00 . . . 0.1836 . 0.1529 . . . . . . . . . . # _struct.entry_id 5M3T _struct.title 'Structural tuning of CD81LEL (space group P64)' _struct.pdbx_descriptor 'CD81 antigen' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5M3T _struct_keywords.text 'human cellular receptor for Hepatitis C virus, Immune system' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 4 ? M N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 6 ? VAL A 26 ? ASN A 115 VAL A 135 1 ? 21 HELX_P HELX_P2 AA2 ALA A 31 ? ASP A 46 ? ALA A 140 ASP A 155 1 ? 16 HELX_P HELX_P3 AA3 LEU A 53 ? ASN A 63 ? LEU A 162 ASN A 172 1 ? 11 HELX_P HELX_P4 AA4 ASN A 71 ? PHE A 77 ? ASN A 180 PHE A 186 1 ? 7 HELX_P HELX_P5 AA5 ASP A 80 ? GLY A 91 ? ASP A 189 GLY A 200 1 ? 12 HELX_P HELX_P6 AA6 ASN B 6 ? ASP B 28 ? ASN B 115 ASP B 137 1 ? 23 HELX_P HELX_P7 AA7 ALA B 31 ? ASP B 46 ? ALA B 140 ASP B 155 1 ? 16 HELX_P HELX_P8 AA8 SER B 51 ? LYS B 62 ? SER B 160 LYS B 171 1 ? 12 HELX_P HELX_P9 AA9 ASN B 63 ? CYS B 66 ? ASN B 172 CYS B 175 5 ? 4 HELX_P HELX_P10 AB1 ILE B 73 ? LYS B 78 ? ILE B 182 LYS B 187 1 ? 6 HELX_P HELX_P11 AB2 ASP B 80 ? SER B 90 ? ASP B 189 SER B 199 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 156 A CYS 190 1_555 ? ? ? ? ? ? ? 2.032 ? disulf2 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 157 A CYS 175 1_555 ? ? ? ? ? ? ? 2.024 ? disulf3 disulf ? ? B CYS 47 SG ? ? ? 1_555 B CYS 81 SG ? ? B CYS 156 B CYS 190 1_555 ? ? ? ? ? ? ? 2.028 ? disulf4 disulf ? ? B CYS 48 SG ? ? ? 1_555 B CYS 66 SG ? ? B CYS 157 B CYS 175 1_555 ? ? ? ? ? ? ? 2.023 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 301 ? 3 'binding site for residue CL A 301' AC2 Software A CL 302 ? 1 'binding site for residue CL A 302' AC3 Software A CL 303 ? 5 'binding site for residue CL A 303' AC4 Software A EDO 304 ? 2 'binding site for residue EDO A 304' AC5 Software A EDO 305 ? 6 'binding site for residue EDO A 305' AC6 Software A EDO 306 ? 3 'binding site for residue EDO A 306' AC7 Software B EDO 301 ? 6 'binding site for residue EDO B 301' AC8 Software B EDO 302 ? 3 'binding site for residue EDO B 302' AC9 Software B EDO 303 ? 3 'binding site for residue EDO B 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LEU A 61 ? LEU A 170 . ? 1_555 ? 2 AC1 3 ASN A 64 ? ASN A 173 . ? 1_555 ? 3 AC1 3 CYS A 66 ? CYS A 175 . ? 1_555 ? 4 AC2 1 LYS A 7 ? LYS A 116 . ? 1_555 ? 5 AC3 5 THR A 52 ? THR A 161 . ? 1_555 ? 6 AC3 5 LEU A 53 ? LEU A 162 . ? 1_555 ? 7 AC3 5 THR A 54 ? THR A 163 . ? 1_555 ? 8 AC3 5 HOH L . ? HOH A 408 . ? 1_555 ? 9 AC3 5 ASN B 63 ? ASN B 172 . ? 6_555 ? 10 AC4 2 GLN A 20 ? GLN A 129 . ? 1_555 ? 11 AC4 2 GLN A 24 ? GLN A 133 . ? 1_555 ? 12 AC5 6 LYS A 84 ? LYS A 193 . ? 1_555 ? 13 AC5 6 ASP A 87 ? ASP A 196 . ? 1_555 ? 14 AC5 6 LEU A 88 ? LEU A 197 . ? 1_555 ? 15 AC5 6 GLY A 93 ? GLY A 202 . ? 1_555 ? 16 AC5 6 EDO H . ? EDO A 306 . ? 1_555 ? 17 AC5 6 THR B 44 ? THR B 153 . ? 1_555 ? 18 AC6 3 LYS A 84 ? LYS A 193 . ? 1_555 ? 19 AC6 3 GLY A 93 ? GLY A 202 . ? 1_555 ? 20 AC6 3 EDO G . ? EDO A 305 . ? 1_555 ? 21 AC7 6 ASN B 63 ? ASN B 172 . ? 1_555 ? 22 AC7 6 ASN B 64 ? ASN B 173 . ? 1_555 ? 23 AC7 6 CYS B 66 ? CYS B 175 . ? 1_555 ? 24 AC7 6 PRO B 67 ? PRO B 176 . ? 1_555 ? 25 AC7 6 GLY B 69 ? GLY B 178 . ? 1_555 ? 26 AC7 6 SER B 70 ? SER B 179 . ? 1_555 ? 27 AC8 3 GLN B 20 ? GLN B 129 . ? 1_555 ? 28 AC8 3 GLN B 24 ? GLN B 133 . ? 1_555 ? 29 AC8 3 ASN B 33 ? ASN B 142 . ? 1_555 ? 30 AC9 3 SER B 50 ? SER B 159 . ? 1_555 ? 31 AC9 3 ASP B 80 ? ASP B 189 . ? 1_555 ? 32 AC9 3 HIS B 82 ? HIS B 191 . ? 1_555 ? # _atom_sites.entry_id 5M3T _atom_sites.fract_transf_matrix[1][1] 0.009872 _atom_sites.fract_transf_matrix[1][2] 0.005699 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011399 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027855 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 110 ? ? ? A . n A 1 2 THR 2 111 ? ? ? A . n A 1 3 GLY 3 112 ? ? ? A . n A 1 4 PHE 4 113 ? ? ? A . n A 1 5 VAL 5 114 114 VAL VAL A . n A 1 6 ASN 6 115 115 ASN ASN A . n A 1 7 LYS 7 116 116 LYS LYS A . n A 1 8 ASP 8 117 117 ASP ASP A . n A 1 9 GLN 9 118 118 GLN GLN A . n A 1 10 ILE 10 119 119 ILE ILE A . n A 1 11 ALA 11 120 120 ALA ALA A . n A 1 12 LYS 12 121 121 LYS LYS A . n A 1 13 ASP 13 122 122 ASP ASP A . n A 1 14 VAL 14 123 123 VAL VAL A . n A 1 15 LYS 15 124 124 LYS LYS A . n A 1 16 GLN 16 125 125 GLN GLN A . n A 1 17 PHE 17 126 126 PHE PHE A . n A 1 18 TYR 18 127 127 TYR TYR A . n A 1 19 ASP 19 128 128 ASP ASP A . n A 1 20 GLN 20 129 129 GLN GLN A . n A 1 21 ALA 21 130 130 ALA ALA A . n A 1 22 LEU 22 131 131 LEU LEU A . n A 1 23 GLN 23 132 132 GLN GLN A . n A 1 24 GLN 24 133 133 GLN GLN A . n A 1 25 ALA 25 134 134 ALA ALA A . n A 1 26 VAL 26 135 135 VAL VAL A . n A 1 27 VAL 27 136 136 VAL VAL A . n A 1 28 ASP 28 137 137 ASP ASP A . n A 1 29 ASP 29 138 138 ASP ASP A . n A 1 30 ASP 30 139 139 ASP ASP A . n A 1 31 ALA 31 140 140 ALA ALA A . n A 1 32 ASN 32 141 141 ASN ASN A . n A 1 33 ASN 33 142 142 ASN ASN A . n A 1 34 ALA 34 143 143 ALA ALA A . n A 1 35 LYS 35 144 144 LYS LYS A . n A 1 36 ALA 36 145 145 ALA ALA A . n A 1 37 VAL 37 146 146 VAL VAL A . n A 1 38 VAL 38 147 147 VAL VAL A . n A 1 39 LYS 39 148 148 LYS LYS A . n A 1 40 THR 40 149 149 THR THR A . n A 1 41 PHE 41 150 150 PHE PHE A . n A 1 42 HIS 42 151 151 HIS HIS A . n A 1 43 GLU 43 152 152 GLU GLU A . n A 1 44 THR 44 153 153 THR THR A . n A 1 45 LEU 45 154 154 LEU LEU A . n A 1 46 ASP 46 155 155 ASP ASP A . n A 1 47 CYS 47 156 156 CYS CYS A . n A 1 48 CYS 48 157 157 CYS CYS A . n A 1 49 GLY 49 158 158 GLY GLY A . n A 1 50 SER 50 159 159 SER SER A . n A 1 51 SER 51 160 160 SER SER A . n A 1 52 THR 52 161 161 THR THR A . n A 1 53 LEU 53 162 162 LEU LEU A . n A 1 54 THR 54 163 163 THR THR A . n A 1 55 ALA 55 164 164 ALA ALA A . n A 1 56 LEU 56 165 165 LEU LEU A . n A 1 57 THR 57 166 166 THR THR A . n A 1 58 THR 58 167 167 THR THR A . n A 1 59 SER 59 168 168 SER SER A . n A 1 60 VAL 60 169 169 VAL VAL A . n A 1 61 LEU 61 170 170 LEU LEU A . n A 1 62 LYS 62 171 171 LYS LYS A . n A 1 63 ASN 63 172 172 ASN ASN A . n A 1 64 ASN 64 173 173 ASN ASN A . n A 1 65 LEU 65 174 174 LEU LEU A . n A 1 66 CYS 66 175 175 CYS CYS A . n A 1 67 PRO 67 176 176 PRO PRO A . n A 1 68 SER 68 177 177 SER SER A . n A 1 69 GLY 69 178 178 GLY GLY A . n A 1 70 SER 70 179 179 SER SER A . n A 1 71 ASN 71 180 180 ASN ASN A . n A 1 72 ILE 72 181 181 ILE ILE A . n A 1 73 ILE 73 182 182 ILE ILE A . n A 1 74 SER 74 183 183 SER SER A . n A 1 75 ASN 75 184 184 ASN ASN A . n A 1 76 LEU 76 185 185 LEU LEU A . n A 1 77 PHE 77 186 186 PHE PHE A . n A 1 78 LYS 78 187 187 LYS LYS A . n A 1 79 GLU 79 188 188 GLU GLU A . n A 1 80 ASP 80 189 189 ASP ASP A . n A 1 81 CYS 81 190 190 CYS CYS A . n A 1 82 HIS 82 191 191 HIS HIS A . n A 1 83 GLN 83 192 192 GLN GLN A . n A 1 84 LYS 84 193 193 LYS LYS A . n A 1 85 ILE 85 194 194 ILE ILE A . n A 1 86 ASP 86 195 195 ASP ASP A . n A 1 87 ASP 87 196 196 ASP ASP A . n A 1 88 LEU 88 197 197 LEU LEU A . n A 1 89 PHE 89 198 198 PHE PHE A . n A 1 90 SER 90 199 199 SER SER A . n A 1 91 GLY 91 200 200 GLY GLY A . n A 1 92 LYS 92 201 201 LYS LYS A . n A 1 93 GLY 93 202 202 GLY GLY A . n A 1 94 THR 94 203 ? ? ? A . n A 1 95 LYS 95 204 ? ? ? A . n A 1 96 HIS 96 205 ? ? ? A . n A 1 97 HIS 97 206 ? ? ? A . n A 1 98 HIS 98 207 ? ? ? A . n A 1 99 HIS 99 208 ? ? ? A . n A 1 100 HIS 100 209 ? ? ? A . n A 1 101 HIS 101 210 ? ? ? A . n B 1 1 GLU 1 110 ? ? ? B . n B 1 2 THR 2 111 ? ? ? B . n B 1 3 GLY 3 112 112 GLY ALA B . n B 1 4 PHE 4 113 113 PHE PHE B . n B 1 5 VAL 5 114 114 VAL VAL B . n B 1 6 ASN 6 115 115 ASN ASN B . n B 1 7 LYS 7 116 116 LYS LYS B . n B 1 8 ASP 8 117 117 ASP ASP B . n B 1 9 GLN 9 118 118 GLN GLN B . n B 1 10 ILE 10 119 119 ILE ILE B . n B 1 11 ALA 11 120 120 ALA ALA B . n B 1 12 LYS 12 121 121 LYS LYS B . n B 1 13 ASP 13 122 122 ASP ASP B . n B 1 14 VAL 14 123 123 VAL VAL B . n B 1 15 LYS 15 124 124 LYS LYS B . n B 1 16 GLN 16 125 125 GLN GLN B . n B 1 17 PHE 17 126 126 PHE PHE B . n B 1 18 TYR 18 127 127 TYR TYR B . n B 1 19 ASP 19 128 128 ASP ASP B . n B 1 20 GLN 20 129 129 GLN GLN B . n B 1 21 ALA 21 130 130 ALA ALA B . n B 1 22 LEU 22 131 131 LEU LEU B . n B 1 23 GLN 23 132 132 GLN GLN B . n B 1 24 GLN 24 133 133 GLN GLN B . n B 1 25 ALA 25 134 134 ALA ALA B . n B 1 26 VAL 26 135 135 VAL VAL B . n B 1 27 VAL 27 136 136 VAL VAL B . n B 1 28 ASP 28 137 137 ASP ASP B . n B 1 29 ASP 29 138 138 ASP ASP B . n B 1 30 ASP 30 139 139 ASP ASP B . n B 1 31 ALA 31 140 140 ALA ALA B . n B 1 32 ASN 32 141 141 ASN ASN B . n B 1 33 ASN 33 142 142 ASN ASN B . n B 1 34 ALA 34 143 143 ALA ALA B . n B 1 35 LYS 35 144 144 LYS LYS B . n B 1 36 ALA 36 145 145 ALA ALA B . n B 1 37 VAL 37 146 146 VAL VAL B . n B 1 38 VAL 38 147 147 VAL VAL B . n B 1 39 LYS 39 148 148 LYS LYS B . n B 1 40 THR 40 149 149 THR THR B . n B 1 41 PHE 41 150 150 PHE PHE B . n B 1 42 HIS 42 151 151 HIS HIS B . n B 1 43 GLU 43 152 152 GLU GLU B . n B 1 44 THR 44 153 153 THR THR B . n B 1 45 LEU 45 154 154 LEU LEU B . n B 1 46 ASP 46 155 155 ASP ASP B . n B 1 47 CYS 47 156 156 CYS CYS B . n B 1 48 CYS 48 157 157 CYS CYS B . n B 1 49 GLY 49 158 158 GLY GLY B . n B 1 50 SER 50 159 159 SER SER B . n B 1 51 SER 51 160 160 SER SER B . n B 1 52 THR 52 161 161 THR THR B . n B 1 53 LEU 53 162 162 LEU LEU B . n B 1 54 THR 54 163 163 THR THR B . n B 1 55 ALA 55 164 164 ALA ALA B . n B 1 56 LEU 56 165 165 LEU LEU B . n B 1 57 THR 57 166 166 THR THR B . n B 1 58 THR 58 167 167 THR THR B . n B 1 59 SER 59 168 168 SER SER B . n B 1 60 VAL 60 169 169 VAL VAL B . n B 1 61 LEU 61 170 170 LEU LEU B . n B 1 62 LYS 62 171 171 LYS LYS B . n B 1 63 ASN 63 172 172 ASN ASN B . n B 1 64 ASN 64 173 173 ASN ASN B . n B 1 65 LEU 65 174 174 LEU LEU B . n B 1 66 CYS 66 175 175 CYS CYS B . n B 1 67 PRO 67 176 176 PRO PRO B . n B 1 68 SER 68 177 177 SER SER B . n B 1 69 GLY 69 178 178 GLY GLY B . n B 1 70 SER 70 179 179 SER SER B . n B 1 71 ASN 71 180 180 ASN ASN B . n B 1 72 ILE 72 181 181 ILE ILE B . n B 1 73 ILE 73 182 182 ILE ILE B . n B 1 74 SER 74 183 183 SER SER B . n B 1 75 ASN 75 184 184 ASN ASN B . n B 1 76 LEU 76 185 185 LEU LEU B . n B 1 77 PHE 77 186 186 PHE PHE B . n B 1 78 LYS 78 187 187 LYS LYS B . n B 1 79 GLU 79 188 188 GLU GLU B . n B 1 80 ASP 80 189 189 ASP ASP B . n B 1 81 CYS 81 190 190 CYS CYS B . n B 1 82 HIS 82 191 191 HIS HIS B . n B 1 83 GLN 83 192 192 GLN GLN B . n B 1 84 LYS 84 193 193 LYS LYS B . n B 1 85 ILE 85 194 194 ILE ILE B . n B 1 86 ASP 86 195 195 ASP ASP B . n B 1 87 ASP 87 196 196 ASP ASP B . n B 1 88 LEU 88 197 197 LEU LEU B . n B 1 89 PHE 89 198 198 PHE PHE B . n B 1 90 SER 90 199 199 SER SER B . n B 1 91 GLY 91 200 200 GLY GLY B . n B 1 92 LYS 92 201 201 LYS LYS B . n B 1 93 GLY 93 202 202 GLY GLY B . n B 1 94 THR 94 203 203 THR THR B . n B 1 95 LYS 95 204 204 LYS LYS B . n B 1 96 HIS 96 205 ? ? ? B . n B 1 97 HIS 97 206 ? ? ? B . n B 1 98 HIS 98 207 ? ? ? B . n B 1 99 HIS 99 208 ? ? ? B . n B 1 100 HIS 100 209 ? ? ? B . n B 1 101 HIS 101 210 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CL 1 301 2 CL CL A . D 2 CL 1 302 3 CL CL A . E 2 CL 1 303 4 CL CL A . F 3 EDO 1 304 2 EDO EDO A . G 3 EDO 1 305 4 EDO EDO A . H 3 EDO 1 306 5 EDO EDO A . I 3 EDO 1 301 1 EDO EDO B . J 3 EDO 1 302 3 EDO EDO B . K 3 EDO 1 303 7 EDO EDO B . L 4 HOH 1 401 4 HOH HOH A . L 4 HOH 2 402 5 HOH HOH A . L 4 HOH 3 403 1 HOH HOH A . L 4 HOH 4 404 13 HOH HOH A . L 4 HOH 5 405 3 HOH HOH A . L 4 HOH 6 406 2 HOH HOH A . L 4 HOH 7 407 15 HOH HOH A . L 4 HOH 8 408 11 HOH HOH A . L 4 HOH 9 409 14 HOH HOH A . L 4 HOH 10 410 12 HOH HOH A . L 4 HOH 11 411 17 HOH HOH A . M 4 HOH 1 401 7 HOH HOH B . M 4 HOH 2 402 6 HOH HOH B . M 4 HOH 3 403 8 HOH HOH B . M 4 HOH 4 404 16 HOH HOH B . M 4 HOH 5 405 9 HOH HOH B . M 4 HOH 6 406 19 HOH HOH B . M 4 HOH 7 407 18 HOH HOH B . M 4 HOH 8 408 10 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3600 ? 1 MORE -26 ? 1 'SSA (A^2)' 9250 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 408 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id M _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-12-14 2 'Structure model' 1 1 2017-01-18 3 'Structure model' 1 2 2017-12-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 3 'Structure model' citation_author # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -35.9169 15.8326 -1.5404 0.5107 0.2677 0.3023 -0.1015 0.0138 0.0346 6.4680 9.5039 6.7163 1.9936 -1.1525 -1.5442 0.4485 -0.4986 -0.2435 0.7549 -0.4254 0.1369 0.0286 0.0840 0.0102 'X-RAY DIFFRACTION' 2 ? refined -42.5755 8.9726 -10.1825 0.6933 0.4928 0.5444 0.0330 -0.0617 0.0390 1.9083 2.6973 2.3288 0.5366 -0.4194 1.2283 0.2588 0.3654 -0.1137 -0.8923 -0.0962 0.4644 -0.1536 -0.5668 -0.0004 'X-RAY DIFFRACTION' 3 ? refined -25.7463 25.6715 -4.4068 0.5635 0.3671 0.3492 -0.1841 -0.0479 0.0175 5.5305 9.0393 5.0225 0.9228 -1.1007 -1.3917 0.5351 -0.4734 0.0341 1.0472 -0.6462 -0.4717 -0.0118 0.4361 0.0072 'X-RAY DIFFRACTION' 4 ? refined -25.7400 35.2324 -14.8029 0.4898 0.3855 0.4628 -0.0825 0.0498 -0.0203 1.4875 2.4043 1.8575 0.3339 -1.1107 -1.8357 0.1362 0.3870 0.0876 -0.0994 -0.1592 0.4673 0.0468 -0.2260 0.0006 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and ((resid 114 : 155) or (resid 191:202)) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 156:190) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'B' and ((resid 112:155) or (resid 191:202)) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 156:190) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 137 ? ? -86.03 48.34 2 1 SER A 177 ? ? -92.62 -138.52 3 1 ASN A 180 ? ? 60.92 84.13 4 1 PHE A 186 ? ? -117.13 79.72 5 1 CYS B 157 ? ? -144.58 21.67 6 1 LYS B 171 ? ? -142.20 55.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 110 ? A GLU 1 2 1 Y 1 A THR 111 ? A THR 2 3 1 Y 1 A GLY 112 ? A GLY 3 4 1 Y 1 A PHE 113 ? A PHE 4 5 1 Y 1 A THR 203 ? A THR 94 6 1 Y 1 A LYS 204 ? A LYS 95 7 1 Y 1 A HIS 205 ? A HIS 96 8 1 Y 1 A HIS 206 ? A HIS 97 9 1 Y 1 A HIS 207 ? A HIS 98 10 1 Y 1 A HIS 208 ? A HIS 99 11 1 Y 1 A HIS 209 ? A HIS 100 12 1 Y 1 A HIS 210 ? A HIS 101 13 1 Y 1 B GLU 110 ? B GLU 1 14 1 Y 1 B THR 111 ? B THR 2 15 1 Y 1 B HIS 205 ? B HIS 96 16 1 Y 1 B HIS 206 ? B HIS 97 17 1 Y 1 B HIS 207 ? B HIS 98 18 1 Y 1 B HIS 208 ? B HIS 99 19 1 Y 1 B HIS 209 ? B HIS 100 20 1 Y 1 B HIS 210 ? B HIS 101 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal MINECO Spain BIO2012-32868 1 MINECO Spain BFU2012-33947 2 MINECO Spain BFU2015-64541-R 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 1,2-ETHANEDIOL EDO 4 water HOH #