data_5M3Y # _entry.id 5M3Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5M3Y WWPDB D_1200001888 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5M3Y _pdbx_database_status.recvd_initial_deposition_date 2016-10-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yan, Y.' 1 'Read, R.J.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 294 _citation.language ? _citation.page_first 2353 _citation.page_last 2364 _citation.title 'Structural basis for the specificity of renin-mediated angiotensinogen cleavage.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.RA118.006608 _citation.pdbx_database_id_PubMed 30563843 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yan, Y.' 1 ? primary 'Zhou, A.' 2 ? primary 'Carrell, R.W.' 3 ? primary 'Read, R.J.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5M3Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.350 _cell.length_a_esd ? _cell.length_b 71.350 _cell.length_b_esd ? _cell.length_c 125.310 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5M3Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 76 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Angiotensinogen 50647.656 1 ? 'N137Q, N271Q, N295Q, C232S, C308S' ? ? 2 branched man 'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542 1 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Serpin A8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFL GFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKQCTSRLDAHKVLSALQAVQGLLVA QGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGSSLMGASVD STLAFNTYVHFQGKMKGFSLLAEPQEFWVDQSTSVSVPMLSGMGTFQHWSDIQDQFSVTQVPFTESASLLLIQPHYASDL DKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELE ADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFL GFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKQCTSRLDAHKVLSALQAVQGLLVA QGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGSSLMGASVD STLAFNTYVHFQGKMKGFSLLAEPQEFWVDQSTSVSVPMLSGMGTFQHWSDIQDQFSVTQVPFTESASLLLIQPHYASDL DKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELE ADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ARG n 1 3 VAL n 1 4 TYR n 1 5 ILE n 1 6 HIS n 1 7 PRO n 1 8 PHE n 1 9 HIS n 1 10 LEU n 1 11 VAL n 1 12 ILE n 1 13 HIS n 1 14 ASN n 1 15 GLU n 1 16 SER n 1 17 THR n 1 18 CYS n 1 19 GLU n 1 20 GLN n 1 21 LEU n 1 22 ALA n 1 23 LYS n 1 24 ALA n 1 25 ASN n 1 26 ALA n 1 27 GLY n 1 28 LYS n 1 29 PRO n 1 30 LYS n 1 31 ASP n 1 32 PRO n 1 33 THR n 1 34 PHE n 1 35 ILE n 1 36 PRO n 1 37 ALA n 1 38 PRO n 1 39 ILE n 1 40 GLN n 1 41 ALA n 1 42 LYS n 1 43 THR n 1 44 SER n 1 45 PRO n 1 46 VAL n 1 47 ASP n 1 48 GLU n 1 49 LYS n 1 50 ALA n 1 51 LEU n 1 52 GLN n 1 53 ASP n 1 54 GLN n 1 55 LEU n 1 56 VAL n 1 57 LEU n 1 58 VAL n 1 59 ALA n 1 60 ALA n 1 61 LYS n 1 62 LEU n 1 63 ASP n 1 64 THR n 1 65 GLU n 1 66 ASP n 1 67 LYS n 1 68 LEU n 1 69 ARG n 1 70 ALA n 1 71 ALA n 1 72 MET n 1 73 VAL n 1 74 GLY n 1 75 MET n 1 76 LEU n 1 77 ALA n 1 78 ASN n 1 79 PHE n 1 80 LEU n 1 81 GLY n 1 82 PHE n 1 83 ARG n 1 84 ILE n 1 85 TYR n 1 86 GLY n 1 87 MET n 1 88 HIS n 1 89 SER n 1 90 GLU n 1 91 LEU n 1 92 TRP n 1 93 GLY n 1 94 VAL n 1 95 VAL n 1 96 HIS n 1 97 GLY n 1 98 ALA n 1 99 THR n 1 100 VAL n 1 101 LEU n 1 102 SER n 1 103 PRO n 1 104 THR n 1 105 ALA n 1 106 VAL n 1 107 PHE n 1 108 GLY n 1 109 THR n 1 110 LEU n 1 111 ALA n 1 112 SER n 1 113 LEU n 1 114 TYR n 1 115 LEU n 1 116 GLY n 1 117 ALA n 1 118 LEU n 1 119 ASP n 1 120 HIS n 1 121 THR n 1 122 ALA n 1 123 ASP n 1 124 ARG n 1 125 LEU n 1 126 GLN n 1 127 ALA n 1 128 ILE n 1 129 LEU n 1 130 GLY n 1 131 VAL n 1 132 PRO n 1 133 TRP n 1 134 LYS n 1 135 ASP n 1 136 LYS n 1 137 GLN n 1 138 CYS n 1 139 THR n 1 140 SER n 1 141 ARG n 1 142 LEU n 1 143 ASP n 1 144 ALA n 1 145 HIS n 1 146 LYS n 1 147 VAL n 1 148 LEU n 1 149 SER n 1 150 ALA n 1 151 LEU n 1 152 GLN n 1 153 ALA n 1 154 VAL n 1 155 GLN n 1 156 GLY n 1 157 LEU n 1 158 LEU n 1 159 VAL n 1 160 ALA n 1 161 GLN n 1 162 GLY n 1 163 ARG n 1 164 ALA n 1 165 ASP n 1 166 SER n 1 167 GLN n 1 168 ALA n 1 169 GLN n 1 170 LEU n 1 171 LEU n 1 172 LEU n 1 173 SER n 1 174 THR n 1 175 VAL n 1 176 VAL n 1 177 GLY n 1 178 VAL n 1 179 PHE n 1 180 THR n 1 181 ALA n 1 182 PRO n 1 183 GLY n 1 184 LEU n 1 185 HIS n 1 186 LEU n 1 187 LYS n 1 188 GLN n 1 189 PRO n 1 190 PHE n 1 191 VAL n 1 192 GLN n 1 193 GLY n 1 194 LEU n 1 195 ALA n 1 196 LEU n 1 197 TYR n 1 198 THR n 1 199 PRO n 1 200 VAL n 1 201 VAL n 1 202 LEU n 1 203 PRO n 1 204 ARG n 1 205 SER n 1 206 LEU n 1 207 ASP n 1 208 PHE n 1 209 THR n 1 210 GLU n 1 211 LEU n 1 212 ASP n 1 213 VAL n 1 214 ALA n 1 215 ALA n 1 216 GLU n 1 217 LYS n 1 218 ILE n 1 219 ASP n 1 220 ARG n 1 221 PHE n 1 222 MET n 1 223 GLN n 1 224 ALA n 1 225 VAL n 1 226 THR n 1 227 GLY n 1 228 TRP n 1 229 LYS n 1 230 THR n 1 231 GLY n 1 232 SER n 1 233 SER n 1 234 LEU n 1 235 MET n 1 236 GLY n 1 237 ALA n 1 238 SER n 1 239 VAL n 1 240 ASP n 1 241 SER n 1 242 THR n 1 243 LEU n 1 244 ALA n 1 245 PHE n 1 246 ASN n 1 247 THR n 1 248 TYR n 1 249 VAL n 1 250 HIS n 1 251 PHE n 1 252 GLN n 1 253 GLY n 1 254 LYS n 1 255 MET n 1 256 LYS n 1 257 GLY n 1 258 PHE n 1 259 SER n 1 260 LEU n 1 261 LEU n 1 262 ALA n 1 263 GLU n 1 264 PRO n 1 265 GLN n 1 266 GLU n 1 267 PHE n 1 268 TRP n 1 269 VAL n 1 270 ASP n 1 271 GLN n 1 272 SER n 1 273 THR n 1 274 SER n 1 275 VAL n 1 276 SER n 1 277 VAL n 1 278 PRO n 1 279 MET n 1 280 LEU n 1 281 SER n 1 282 GLY n 1 283 MET n 1 284 GLY n 1 285 THR n 1 286 PHE n 1 287 GLN n 1 288 HIS n 1 289 TRP n 1 290 SER n 1 291 ASP n 1 292 ILE n 1 293 GLN n 1 294 ASP n 1 295 GLN n 1 296 PHE n 1 297 SER n 1 298 VAL n 1 299 THR n 1 300 GLN n 1 301 VAL n 1 302 PRO n 1 303 PHE n 1 304 THR n 1 305 GLU n 1 306 SER n 1 307 ALA n 1 308 SER n 1 309 LEU n 1 310 LEU n 1 311 LEU n 1 312 ILE n 1 313 GLN n 1 314 PRO n 1 315 HIS n 1 316 TYR n 1 317 ALA n 1 318 SER n 1 319 ASP n 1 320 LEU n 1 321 ASP n 1 322 LYS n 1 323 VAL n 1 324 GLU n 1 325 GLY n 1 326 LEU n 1 327 THR n 1 328 PHE n 1 329 GLN n 1 330 GLN n 1 331 ASN n 1 332 SER n 1 333 LEU n 1 334 ASN n 1 335 TRP n 1 336 MET n 1 337 LYS n 1 338 LYS n 1 339 LEU n 1 340 SER n 1 341 PRO n 1 342 ARG n 1 343 THR n 1 344 ILE n 1 345 HIS n 1 346 LEU n 1 347 THR n 1 348 MET n 1 349 PRO n 1 350 GLN n 1 351 LEU n 1 352 VAL n 1 353 LEU n 1 354 GLN n 1 355 GLY n 1 356 SER n 1 357 TYR n 1 358 ASP n 1 359 LEU n 1 360 GLN n 1 361 ASP n 1 362 LEU n 1 363 LEU n 1 364 ALA n 1 365 GLN n 1 366 ALA n 1 367 GLU n 1 368 LEU n 1 369 PRO n 1 370 ALA n 1 371 ILE n 1 372 LEU n 1 373 HIS n 1 374 THR n 1 375 GLU n 1 376 LEU n 1 377 ASN n 1 378 LEU n 1 379 GLN n 1 380 LYS n 1 381 LEU n 1 382 SER n 1 383 ASN n 1 384 ASP n 1 385 ARG n 1 386 ILE n 1 387 ARG n 1 388 VAL n 1 389 GLY n 1 390 GLU n 1 391 VAL n 1 392 LEU n 1 393 ASN n 1 394 SER n 1 395 ILE n 1 396 PHE n 1 397 PHE n 1 398 GLU n 1 399 LEU n 1 400 GLU n 1 401 ALA n 1 402 ASP n 1 403 GLU n 1 404 ARG n 1 405 GLU n 1 406 PRO n 1 407 THR n 1 408 GLU n 1 409 SER n 1 410 THR n 1 411 GLN n 1 412 GLN n 1 413 LEU n 1 414 ASN n 1 415 LYS n 1 416 PRO n 1 417 GLU n 1 418 VAL n 1 419 LEU n 1 420 GLU n 1 421 VAL n 1 422 THR n 1 423 LEU n 1 424 ASN n 1 425 ARG n 1 426 PRO n 1 427 PHE n 1 428 LEU n 1 429 PHE n 1 430 ALA n 1 431 VAL n 1 432 TYR n 1 433 ASP n 1 434 GLN n 1 435 SER n 1 436 ALA n 1 437 THR n 1 438 ALA n 1 439 LEU n 1 440 HIS n 1 441 PHE n 1 442 LEU n 1 443 GLY n 1 444 ARG n 1 445 VAL n 1 446 ALA n 1 447 ASN n 1 448 PRO n 1 449 LEU n 1 450 SER n 1 451 THR n 1 452 ALA n 1 453 HIS n 1 454 HIS n 1 455 HIS n 1 456 HIS n 1 457 HIS n 1 458 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 458 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AGT, SERPINA8' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name Human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell 'HEK293 EBNA' _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pCEP4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ANGT_HUMAN _struct_ref.pdbx_db_accession P01019 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFL GFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVA QGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVD STLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDL DKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELE ADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA ; _struct_ref.pdbx_align_begin 34 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5M3Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 452 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01019 _struct_ref_seq.db_align_beg 34 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 485 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 452 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5M3Y GLN A 137 ? UNP P01019 ASN 170 'engineered mutation' 137 1 1 5M3Y SER A 232 ? UNP P01019 CYS 265 'engineered mutation' 232 2 1 5M3Y GLN A 271 ? UNP P01019 ASN 304 'engineered mutation' 271 3 1 5M3Y GLN A 295 ? UNP P01019 ASN 328 'engineered mutation' 295 4 1 5M3Y SER A 308 ? UNP P01019 CYS 341 'engineered mutation' 308 5 1 5M3Y HIS A 453 ? UNP P01019 ? ? 'expression tag' 453 6 1 5M3Y HIS A 454 ? UNP P01019 ? ? 'expression tag' 454 7 1 5M3Y HIS A 455 ? UNP P01019 ? ? 'expression tag' 455 8 1 5M3Y HIS A 456 ? UNP P01019 ? ? 'expression tag' 456 9 1 5M3Y HIS A 457 ? UNP P01019 ? ? 'expression tag' 457 10 1 5M3Y HIS A 458 ? UNP P01019 ? ? 'expression tag' 458 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose ? 'C6 H12 O6' 180.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5M3Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2.0M Ammonium Sulfate, 0.1M Bicine, pH9.0 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-07-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5M3Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 46.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27827 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.702 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5M3Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.300 _refine.ls_d_res_low 46.8 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27786 _refine.ls_number_reflns_R_free 1402 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 5.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1726 _refine.ls_R_factor_R_free 0.1889 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1699 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2WXW _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.80 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3256 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 3319 _refine_hist.d_res_high 2.300 _refine_hist.d_res_low 46.8 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 3371 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.483 ? 4593 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.795 ? 2004 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.040 ? 549 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 578 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3004 2.3826 . . 145 2614 95.00 . . . 0.2836 . 0.2670 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3826 2.4779 . . 153 2631 94.00 . . . 0.2654 . 0.2469 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4779 2.5907 . . 135 2589 95.00 . . . 0.2501 . 0.2403 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5907 2.7272 . . 137 2684 95.00 . . . 0.2392 . 0.2341 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7272 2.8980 . . 140 2604 95.00 . . . 0.2598 . 0.2297 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8980 3.1216 . . 133 2649 95.00 . . . 0.2178 . 0.2032 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1216 3.4355 . . 142 2633 95.00 . . . 0.2065 . 0.1876 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4355 3.9320 . . 138 2626 95.00 . . . 0.1953 . 0.1641 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9320 4.9515 . . 145 2659 95.00 . . . 0.1336 . 0.1242 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.9515 34.3154 . . 130 2684 95.00 . . . 0.1720 . 0.1474 . . . . . . . . . . # _struct.entry_id 5M3Y _struct.title 'Crystal structure of human glycosylated angiotensinogen' _struct.pdbx_descriptor Angiotensinogen _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5M3Y _struct_keywords.text 'glycosylated, human angiotensiogen, Serine protease inhibitor' _struct_keywords.pdbx_keywords 'Serine protease inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 47 ? LYS A 61 ? ASP A 47 LYS A 61 1 ? 15 HELX_P HELX_P2 AA2 ASP A 63 ? MET A 87 ? ASP A 63 MET A 87 1 ? 25 HELX_P HELX_P3 AA3 SER A 102 ? GLY A 116 ? SER A 102 GLY A 116 1 ? 15 HELX_P HELX_P4 AA4 LEU A 118 ? GLY A 130 ? LEU A 118 GLY A 130 1 ? 13 HELX_P HELX_P5 AA5 ASP A 143 ? ALA A 160 ? ASP A 143 ALA A 160 1 ? 18 HELX_P HELX_P6 AA6 GLN A 188 ? THR A 198 ? GLN A 188 THR A 198 1 ? 11 HELX_P HELX_P7 AA7 GLU A 210 ? GLY A 227 ? GLU A 210 GLY A 227 1 ? 18 HELX_P HELX_P8 AA8 TYR A 316 ? SER A 318 ? TYR A 316 SER A 318 5 ? 3 HELX_P HELX_P9 AA9 ASP A 319 ? PHE A 328 ? ASP A 319 PHE A 328 1 ? 10 HELX_P HELX_P10 AB1 GLN A 329 ? LYS A 337 ? GLN A 329 LYS A 337 5 ? 9 HELX_P HELX_P11 AB2 LEU A 359 ? LEU A 363 ? LEU A 359 LEU A 363 1 ? 5 HELX_P HELX_P12 AB3 GLU A 367 ? LEU A 372 ? GLU A 367 LEU A 372 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 138 SG ? ? A CYS 18 A CYS 138 1_555 ? ? ? ? ? ? ? 2.028 ? ? covale1 covale one ? A ASN 14 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 14 B NAG 1 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.438 ? ? covale3 covale both ? B NAG . O4 ? ? ? 1_555 B BMA . C1 ? ? B NAG 2 B BMA 3 1_555 ? ? ? ? ? ? ? 1.442 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 6 ? AA3 ? 7 ? AA4 ? 8 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA4 7 8 ? parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 33 ? PHE A 34 ? THR A 33 PHE A 34 AA1 2 LEU A 186 ? LYS A 187 ? LEU A 186 LYS A 187 AA2 1 HIS A 96 ? GLY A 97 ? HIS A 96 GLY A 97 AA2 2 VAL A 352 ? ASP A 358 ? VAL A 352 ASP A 358 AA2 3 VAL A 388 ? GLU A 400 ? VAL A 388 GLU A 400 AA2 4 LEU A 243 ? LYS A 254 ? LEU A 243 LYS A 254 AA2 5 LEU A 170 ? THR A 180 ? LEU A 170 THR A 180 AA2 6 VAL A 201 ? SER A 205 ? VAL A 201 SER A 205 AA3 1 VAL A 100 ? LEU A 101 ? VAL A 100 LEU A 101 AA3 2 ALA A 438 ? VAL A 445 ? ALA A 438 VAL A 445 AA3 3 PHE A 427 ? ASP A 433 ? PHE A 427 ASP A 433 AA3 4 ALA A 307 ? PRO A 314 ? ALA A 307 PRO A 314 AA3 5 PHE A 296 ? PRO A 302 ? PHE A 296 PRO A 302 AA3 6 MET A 279 ? ASP A 291 ? MET A 279 ASP A 291 AA3 7 PHE A 258 ? LEU A 260 ? PHE A 258 LEU A 260 AA4 1 VAL A 100 ? LEU A 101 ? VAL A 100 LEU A 101 AA4 2 ALA A 438 ? VAL A 445 ? ALA A 438 VAL A 445 AA4 3 PHE A 427 ? ASP A 433 ? PHE A 427 ASP A 433 AA4 4 ALA A 307 ? PRO A 314 ? ALA A 307 PRO A 314 AA4 5 PHE A 296 ? PRO A 302 ? PHE A 296 PRO A 302 AA4 6 MET A 279 ? ASP A 291 ? MET A 279 ASP A 291 AA4 7 SER A 340 ? PRO A 349 ? SER A 340 PRO A 349 AA4 8 LEU A 419 ? THR A 422 ? LEU A 419 THR A 422 AA5 1 GLN A 265 ? PHE A 267 ? GLN A 265 PHE A 267 AA5 2 VAL A 275 ? VAL A 277 ? VAL A 275 VAL A 277 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 34 ? N PHE A 34 O LEU A 186 ? O LEU A 186 AA2 1 2 N HIS A 96 ? N HIS A 96 O SER A 356 ? O SER A 356 AA2 2 3 N LEU A 353 ? N LEU A 353 O PHE A 397 ? O PHE A 397 AA2 3 4 O PHE A 396 ? O PHE A 396 N PHE A 251 ? N PHE A 251 AA2 4 5 O TYR A 248 ? O TYR A 248 N VAL A 175 ? N VAL A 175 AA2 5 6 N VAL A 176 ? N VAL A 176 O LEU A 202 ? O LEU A 202 AA3 1 2 N LEU A 101 ? N LEU A 101 O LEU A 442 ? O LEU A 442 AA3 2 3 O VAL A 445 ? O VAL A 445 N PHE A 427 ? N PHE A 427 AA3 3 4 O ALA A 430 ? O ALA A 430 N LEU A 310 ? N LEU A 310 AA3 4 5 O LEU A 311 ? O LEU A 311 N THR A 299 ? N THR A 299 AA3 5 6 O VAL A 298 ? O VAL A 298 N TRP A 289 ? N TRP A 289 AA3 6 7 O SER A 281 ? O SER A 281 N SER A 259 ? N SER A 259 AA4 1 2 N LEU A 101 ? N LEU A 101 O LEU A 442 ? O LEU A 442 AA4 2 3 O VAL A 445 ? O VAL A 445 N PHE A 427 ? N PHE A 427 AA4 3 4 O ALA A 430 ? O ALA A 430 N LEU A 310 ? N LEU A 310 AA4 4 5 O LEU A 311 ? O LEU A 311 N THR A 299 ? N THR A 299 AA4 5 6 O VAL A 298 ? O VAL A 298 N TRP A 289 ? N TRP A 289 AA4 6 7 N LEU A 280 ? N LEU A 280 O MET A 348 ? O MET A 348 AA4 7 8 N THR A 343 ? N THR A 343 O LEU A 419 ? O LEU A 419 AA5 1 2 N PHE A 267 ? N PHE A 267 O VAL A 275 ? O VAL A 275 # _atom_sites.entry_id 5M3Y _atom_sites.fract_transf_matrix[1][1] 0.014015 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014015 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007980 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 GLN 20 20 ? ? ? A . n A 1 21 LEU 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 LYS 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 ASN 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 GLY 27 27 ? ? ? A . n A 1 28 LYS 28 28 ? ? ? A . n A 1 29 PRO 29 29 ? ? ? A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 GLY 162 162 ? ? ? A . n A 1 163 ARG 163 163 ? ? ? A . n A 1 164 ALA 164 164 ? ? ? A . n A 1 165 ASP 165 165 ? ? ? A . n A 1 166 SER 166 166 ? ? ? A . n A 1 167 GLN 167 167 ? ? ? A . n A 1 168 ALA 168 168 ? ? ? A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 PHE 221 221 221 PHE PHE A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 TRP 228 228 228 TRP TRP A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 SER 241 241 241 SER SER A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 ASN 246 246 246 ASN ASN A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 TYR 248 248 248 TYR TYR A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 PHE 251 251 251 PHE PHE A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 MET 255 255 255 MET MET A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 PRO 264 264 264 PRO PRO A . n A 1 265 GLN 265 265 265 GLN GLN A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 TRP 268 268 268 TRP TRP A . n A 1 269 VAL 269 269 269 VAL VAL A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 GLN 271 271 271 GLN GLN A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 PRO 278 278 278 PRO PRO A . n A 1 279 MET 279 279 279 MET MET A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 MET 283 283 283 MET MET A . n A 1 284 GLY 284 284 284 GLY GLY A . n A 1 285 THR 285 285 285 THR THR A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 GLN 287 287 287 GLN GLN A . n A 1 288 HIS 288 288 288 HIS HIS A . n A 1 289 TRP 289 289 289 TRP TRP A . n A 1 290 SER 290 290 290 SER SER A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 ASP 294 294 294 ASP ASP A . n A 1 295 GLN 295 295 295 GLN GLN A . n A 1 296 PHE 296 296 296 PHE PHE A . n A 1 297 SER 297 297 297 SER SER A . n A 1 298 VAL 298 298 298 VAL VAL A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 GLN 300 300 300 GLN GLN A . n A 1 301 VAL 301 301 301 VAL VAL A . n A 1 302 PRO 302 302 302 PRO PRO A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 GLU 305 305 305 GLU GLU A . n A 1 306 SER 306 306 306 SER SER A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 GLN 313 313 313 GLN GLN A . n A 1 314 PRO 314 314 314 PRO PRO A . n A 1 315 HIS 315 315 315 HIS HIS A . n A 1 316 TYR 316 316 316 TYR TYR A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 SER 318 318 318 SER SER A . n A 1 319 ASP 319 319 319 ASP ASP A . n A 1 320 LEU 320 320 320 LEU LEU A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 LYS 322 322 322 LYS LYS A . n A 1 323 VAL 323 323 323 VAL VAL A . n A 1 324 GLU 324 324 324 GLU GLU A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 THR 327 327 327 THR THR A . n A 1 328 PHE 328 328 328 PHE PHE A . n A 1 329 GLN 329 329 329 GLN GLN A . n A 1 330 GLN 330 330 330 GLN GLN A . n A 1 331 ASN 331 331 331 ASN ASN A . n A 1 332 SER 332 332 332 SER SER A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 ASN 334 334 334 ASN ASN A . n A 1 335 TRP 335 335 335 TRP TRP A . n A 1 336 MET 336 336 336 MET MET A . n A 1 337 LYS 337 337 337 LYS LYS A . n A 1 338 LYS 338 338 338 LYS LYS A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 SER 340 340 340 SER SER A . n A 1 341 PRO 341 341 341 PRO PRO A . n A 1 342 ARG 342 342 342 ARG ARG A . n A 1 343 THR 343 343 343 THR THR A . n A 1 344 ILE 344 344 344 ILE ILE A . n A 1 345 HIS 345 345 345 HIS HIS A . n A 1 346 LEU 346 346 346 LEU LEU A . n A 1 347 THR 347 347 347 THR THR A . n A 1 348 MET 348 348 348 MET MET A . n A 1 349 PRO 349 349 349 PRO PRO A . n A 1 350 GLN 350 350 350 GLN GLN A . n A 1 351 LEU 351 351 351 LEU LEU A . n A 1 352 VAL 352 352 352 VAL VAL A . n A 1 353 LEU 353 353 353 LEU LEU A . n A 1 354 GLN 354 354 354 GLN GLN A . n A 1 355 GLY 355 355 355 GLY GLY A . n A 1 356 SER 356 356 356 SER SER A . n A 1 357 TYR 357 357 357 TYR TYR A . n A 1 358 ASP 358 358 358 ASP ASP A . n A 1 359 LEU 359 359 359 LEU LEU A . n A 1 360 GLN 360 360 360 GLN GLN A . n A 1 361 ASP 361 361 361 ASP ASP A . n A 1 362 LEU 362 362 362 LEU LEU A . n A 1 363 LEU 363 363 363 LEU LEU A . n A 1 364 ALA 364 364 364 ALA ALA A . n A 1 365 GLN 365 365 365 GLN GLN A . n A 1 366 ALA 366 366 366 ALA ALA A . n A 1 367 GLU 367 367 367 GLU GLU A . n A 1 368 LEU 368 368 368 LEU LEU A . n A 1 369 PRO 369 369 369 PRO PRO A . n A 1 370 ALA 370 370 370 ALA ALA A . n A 1 371 ILE 371 371 371 ILE ILE A . n A 1 372 LEU 372 372 372 LEU LEU A . n A 1 373 HIS 373 373 373 HIS HIS A . n A 1 374 THR 374 374 374 THR THR A . n A 1 375 GLU 375 375 375 GLU GLU A . n A 1 376 LEU 376 376 376 LEU LEU A . n A 1 377 ASN 377 377 377 ASN ASN A . n A 1 378 LEU 378 378 378 LEU LEU A . n A 1 379 GLN 379 379 379 GLN GLN A . n A 1 380 LYS 380 380 380 LYS LYS A . n A 1 381 LEU 381 381 381 LEU LEU A . n A 1 382 SER 382 382 382 SER SER A . n A 1 383 ASN 383 383 383 ASN ASN A . n A 1 384 ASP 384 384 384 ASP ASP A . n A 1 385 ARG 385 385 385 ARG ARG A . n A 1 386 ILE 386 386 386 ILE ILE A . n A 1 387 ARG 387 387 387 ARG ARG A . n A 1 388 VAL 388 388 388 VAL VAL A . n A 1 389 GLY 389 389 389 GLY GLY A . n A 1 390 GLU 390 390 390 GLU GLU A . n A 1 391 VAL 391 391 391 VAL VAL A . n A 1 392 LEU 392 392 392 LEU LEU A . n A 1 393 ASN 393 393 393 ASN ASN A . n A 1 394 SER 394 394 394 SER SER A . n A 1 395 ILE 395 395 395 ILE ILE A . n A 1 396 PHE 396 396 396 PHE PHE A . n A 1 397 PHE 397 397 397 PHE PHE A . n A 1 398 GLU 398 398 398 GLU GLU A . n A 1 399 LEU 399 399 399 LEU LEU A . n A 1 400 GLU 400 400 400 GLU GLU A . n A 1 401 ALA 401 401 401 ALA ALA A . n A 1 402 ASP 402 402 402 ASP ASP A . n A 1 403 GLU 403 403 ? ? ? A . n A 1 404 ARG 404 404 ? ? ? A . n A 1 405 GLU 405 405 ? ? ? A . n A 1 406 PRO 406 406 ? ? ? A . n A 1 407 THR 407 407 ? ? ? A . n A 1 408 GLU 408 408 ? ? ? A . n A 1 409 SER 409 409 ? ? ? A . n A 1 410 THR 410 410 ? ? ? A . n A 1 411 GLN 411 411 ? ? ? A . n A 1 412 GLN 412 412 ? ? ? A . n A 1 413 LEU 413 413 ? ? ? A . n A 1 414 ASN 414 414 ? ? ? A . n A 1 415 LYS 415 415 ? ? ? A . n A 1 416 PRO 416 416 ? ? ? A . n A 1 417 GLU 417 417 417 GLU GLU A . n A 1 418 VAL 418 418 418 VAL VAL A . n A 1 419 LEU 419 419 419 LEU LEU A . n A 1 420 GLU 420 420 420 GLU GLU A . n A 1 421 VAL 421 421 421 VAL VAL A . n A 1 422 THR 422 422 422 THR THR A . n A 1 423 LEU 423 423 423 LEU LEU A . n A 1 424 ASN 424 424 424 ASN ASN A . n A 1 425 ARG 425 425 425 ARG ARG A . n A 1 426 PRO 426 426 426 PRO PRO A . n A 1 427 PHE 427 427 427 PHE PHE A . n A 1 428 LEU 428 428 428 LEU LEU A . n A 1 429 PHE 429 429 429 PHE PHE A . n A 1 430 ALA 430 430 430 ALA ALA A . n A 1 431 VAL 431 431 431 VAL VAL A . n A 1 432 TYR 432 432 432 TYR TYR A . n A 1 433 ASP 433 433 433 ASP ASP A . n A 1 434 GLN 434 434 434 GLN GLN A . n A 1 435 SER 435 435 435 SER SER A . n A 1 436 ALA 436 436 436 ALA ALA A . n A 1 437 THR 437 437 437 THR THR A . n A 1 438 ALA 438 438 438 ALA ALA A . n A 1 439 LEU 439 439 439 LEU LEU A . n A 1 440 HIS 440 440 440 HIS HIS A . n A 1 441 PHE 441 441 441 PHE PHE A . n A 1 442 LEU 442 442 442 LEU LEU A . n A 1 443 GLY 443 443 443 GLY GLY A . n A 1 444 ARG 444 444 444 ARG ARG A . n A 1 445 VAL 445 445 445 VAL VAL A . n A 1 446 ALA 446 446 446 ALA ALA A . n A 1 447 ASN 447 447 447 ASN ASN A . n A 1 448 PRO 448 448 448 PRO PRO A . n A 1 449 LEU 449 449 449 LEU LEU A . n A 1 450 SER 450 450 450 SER SER A . n A 1 451 THR 451 451 ? ? ? A . n A 1 452 ALA 452 452 ? ? ? A . n A 1 453 HIS 453 453 ? ? ? A . n A 1 454 HIS 454 454 ? ? ? A . n A 1 455 HIS 455 455 ? ? ? A . n A 1 456 HIS 456 456 ? ? ? A . n A 1 457 HIS 457 457 ? ? ? A . n A 1 458 HIS 458 458 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 601 3 HOH HOH A . C 3 HOH 2 602 21 HOH HOH A . C 3 HOH 3 603 13 HOH HOH A . C 3 HOH 4 604 28 HOH HOH A . C 3 HOH 5 605 12 HOH HOH A . C 3 HOH 6 606 6 HOH HOH A . C 3 HOH 7 607 31 HOH HOH A . C 3 HOH 8 608 10 HOH HOH A . C 3 HOH 9 609 25 HOH HOH A . C 3 HOH 10 610 14 HOH HOH A . C 3 HOH 11 611 11 HOH HOH A . C 3 HOH 12 612 24 HOH HOH A . C 3 HOH 13 613 26 HOH HOH A . C 3 HOH 14 614 5 HOH HOH A . C 3 HOH 15 615 23 HOH HOH A . C 3 HOH 16 616 30 HOH HOH A . C 3 HOH 17 617 32 HOH HOH A . C 3 HOH 18 618 15 HOH HOH A . C 3 HOH 19 619 22 HOH HOH A . C 3 HOH 20 620 18 HOH HOH A . C 3 HOH 21 621 17 HOH HOH A . C 3 HOH 22 622 8 HOH HOH A . C 3 HOH 23 623 33 HOH HOH A . C 3 HOH 24 624 20 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 520 ? 1 MORE 5 ? 1 'SSA (A^2)' 18570 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-20 2 'Structure model' 1 1 2018-12-26 3 'Structure model' 1 2 2019-01-09 4 'Structure model' 1 3 2019-02-27 5 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Atomic model' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 3 'Structure model' pdbx_database_proc 6 4 'Structure model' citation 7 4 'Structure model' citation_author 8 4 'Structure model' pdbx_database_proc 9 5 'Structure model' atom_site 10 5 'Structure model' chem_comp 11 5 'Structure model' entity 12 5 'Structure model' pdbx_branch_scheme 13 5 'Structure model' pdbx_chem_comp_identifier 14 5 'Structure model' pdbx_entity_branch 15 5 'Structure model' pdbx_entity_branch_descriptor 16 5 'Structure model' pdbx_entity_branch_link 17 5 'Structure model' pdbx_entity_branch_list 18 5 'Structure model' pdbx_entity_nonpoly 19 5 'Structure model' pdbx_nonpoly_scheme 20 5 'Structure model' pdbx_struct_assembly_gen 21 5 'Structure model' struct_asym 22 5 'Structure model' struct_conn 23 5 'Structure model' struct_site 24 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_abbrev' 9 3 'Structure model' '_citation.pdbx_database_id_DOI' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 3 'Structure model' '_citation_author.identifier_ORCID' 13 4 'Structure model' '_citation.journal_volume' 14 4 'Structure model' '_citation.page_first' 15 4 'Structure model' '_citation.page_last' 16 4 'Structure model' '_citation.year' 17 4 'Structure model' '_citation_author.identifier_ORCID' 18 5 'Structure model' '_atom_site.auth_asym_id' 19 5 'Structure model' '_atom_site.auth_seq_id' 20 5 'Structure model' '_atom_site.label_asym_id' 21 5 'Structure model' '_atom_site.label_entity_id' 22 5 'Structure model' '_chem_comp.name' 23 5 'Structure model' '_chem_comp.type' 24 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 25 5 'Structure model' '_struct_conn.pdbx_role' 26 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 27 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 30 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 13.0101 61.5337 -1.5218 0.3156 0.3379 0.3084 0.0411 0.0639 0.0065 2.8102 2.7606 3.9540 -0.2065 -0.3174 0.4710 0.0837 0.2024 -0.3188 0.1725 -0.0852 0.3131 -0.1992 -0.3731 0.0128 'X-RAY DIFFRACTION' 2 ? refined 14.8249 67.5829 -5.9576 0.3463 0.3421 0.2778 0.0635 0.0538 0.0125 3.5253 3.3317 3.2769 -0.0859 -0.4972 0.1850 0.2243 0.4570 0.1056 0.0189 -0.1122 0.3490 -0.5660 -0.3687 -0.0627 'X-RAY DIFFRACTION' 3 ? refined 25.7865 81.8419 1.8029 1.0658 0.5367 0.7153 -0.1751 0.3504 -0.0850 2.6450 6.8875 3.1842 0.8215 -0.5037 -4.6799 0.2605 0.1167 1.0121 -0.2012 0.0256 -0.7645 -1.2287 0.6258 -0.1492 'X-RAY DIFFRACTION' 4 ? refined 37.9950 54.5145 -11.5219 0.3078 0.4740 0.4461 0.0208 0.0078 0.0101 3.8966 3.8219 3.9079 -0.6454 -2.6070 1.3759 -0.2069 -0.1602 -0.6862 0.0459 0.1065 -0.3642 0.1785 0.5486 0.1095 'X-RAY DIFFRACTION' 5 ? refined 29.2120 64.6360 -8.7306 0.3493 0.3680 0.2411 -0.0356 0.0150 -0.0014 4.5586 3.2956 3.5870 -0.7569 -1.9503 0.6286 0.1582 0.1759 0.0197 -0.0488 -0.0086 -0.0894 -0.4859 0.2676 -0.1206 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 86 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 87 through 197 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 198 through 242 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 243 through 339 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 340 through 450 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 207 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 209 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 4 ? ? -132.72 -34.58 2 1 PHE A 8 ? ? -100.09 68.89 3 1 ASP A 119 ? ? 62.00 -142.86 4 1 GLN A 295 ? ? 66.52 70.57 5 1 THR A 304 ? ? -128.85 -155.97 6 1 LEU A 378 ? ? -111.06 56.37 7 1 SER A 382 ? ? -171.28 139.92 8 1 LEU A 423 ? ? -104.20 65.04 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 19 ? A GLU 19 2 1 Y 1 A GLN 20 ? A GLN 20 3 1 Y 1 A LEU 21 ? A LEU 21 4 1 Y 1 A ALA 22 ? A ALA 22 5 1 Y 1 A LYS 23 ? A LYS 23 6 1 Y 1 A ALA 24 ? A ALA 24 7 1 Y 1 A ASN 25 ? A ASN 25 8 1 Y 1 A ALA 26 ? A ALA 26 9 1 Y 1 A GLY 27 ? A GLY 27 10 1 Y 1 A LYS 28 ? A LYS 28 11 1 Y 1 A PRO 29 ? A PRO 29 12 1 Y 1 A GLY 162 ? A GLY 162 13 1 Y 1 A ARG 163 ? A ARG 163 14 1 Y 1 A ALA 164 ? A ALA 164 15 1 Y 1 A ASP 165 ? A ASP 165 16 1 Y 1 A SER 166 ? A SER 166 17 1 Y 1 A GLN 167 ? A GLN 167 18 1 Y 1 A ALA 168 ? A ALA 168 19 1 Y 1 A GLU 403 ? A GLU 403 20 1 Y 1 A ARG 404 ? A ARG 404 21 1 Y 1 A GLU 405 ? A GLU 405 22 1 Y 1 A PRO 406 ? A PRO 406 23 1 Y 1 A THR 407 ? A THR 407 24 1 Y 1 A GLU 408 ? A GLU 408 25 1 Y 1 A SER 409 ? A SER 409 26 1 Y 1 A THR 410 ? A THR 410 27 1 Y 1 A GLN 411 ? A GLN 411 28 1 Y 1 A GLN 412 ? A GLN 412 29 1 Y 1 A LEU 413 ? A LEU 413 30 1 Y 1 A ASN 414 ? A ASN 414 31 1 Y 1 A LYS 415 ? A LYS 415 32 1 Y 1 A PRO 416 ? A PRO 416 33 1 Y 1 A THR 451 ? A THR 451 34 1 Y 1 A ALA 452 ? A ALA 452 35 1 Y 1 A HIS 453 ? A HIS 453 36 1 Y 1 A HIS 454 ? A HIS 454 37 1 Y 1 A HIS 455 ? A HIS 455 38 1 Y 1 A HIS 456 ? A HIS 456 39 1 Y 1 A HIS 457 ? A HIS 457 40 1 Y 1 A HIS 458 ? A HIS 458 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'British Heart Foundation' 'United Kingdom' PG/12/41/29679 1 'Wellcome Trust' 'United Kingdom' 082961/Z/07/Z 2 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 1014 n B 2 NAG 2 B NAG 2 A NAG 2014 n B 2 BMA 3 B BMA 3 A BMA 3014 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 BMA 3 n # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #